F450484

General Info

Members Datasets Scaffolds Average Seq Length
470 263 940 253

Family's Representative Sequence

Representative Sequence 3300047444|Ga0495675_0057135|Ga0495675_0057135_1550_2422
Length 290
Sequence VQAVEQAAMSISRPPGRHVMVRVKRMKAARLVVLTVAIAAGGVAAMLAGRSEKPPEVKMTPAPQIATVDVLVAKNDIPMGQAISPGDVRWEQWPTAAAGGNFIRRSDRPNAIENLSGSVARAPFVNGEPIREAKLVNAKGSGFMAAILPSGMRAISTQISPETGAGGFILPNDHVDVILTRRDRDAEKTAGADTHTSETILTNVRVLAIDQNVQEKDGQKVVVGKTATLELTPQQTEALAVSQQLGTLSLALRSITDASHDAPIAEDTLGKRRNGVNVVRFGVGTMMTPR

Samples

Sample ID Description Type Environment
1 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
158 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
253 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
262 2643221651 Afipia sp. Root123D2 Isolate Unclassified
263 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0.43
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.06
Nodule 0.21
Rhizoplane 1.7
Rhizosphere 84.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495675_0057135 3300047444 Bacteria 2474
2 JGI25153J46596_10011224 3300003215 Bacteria 3977
3 Ga0070658_10004547 3300005327 Bacteria 11276
4 Ga0070658_10184865 3300005327 Bacteria 1755
5 Ga0070676_10030145 3300005328 Bacteria 3091
6 Ga0070676_10168897 3300005328 Bacteria 1413
7 Ga0070683_100032251 3300005329 Bacteria 4771
8 Ga0070670_100188621 3300005331 Bacteria 1791
9 Ga0070670_100370769 3300005331 Bacteria 1260
10 Ga0070680_100011487 3300005336 Bacteria 6852
11 Ga0070680_100227613 3300005336 Bacteria 1574
12 Ga0070660_100019659 3300005339 Bacteria 4952
13 Ga0070660_100283202 3300005339 Bacteria 1357
14 Ga0070689_100517813 3300005340 Bacteria 1024
15 Ga0070669_100043776 3300005353 Bacteria 3262
16 Ga0070675_100033030 3300005354 Bacteria 4192
17 Ga0070671_100125732 3300005355 Bacteria 2158
18 Ga0070674_100011896 3300005356 Bacteria 5319
19 Ga0070673_100115783 3300005364 Bacteria 2229
20 Ga0070659_100026429 3300005366 Bacteria 4468
21 Ga0070659_100136206 3300005366 Bacteria 1997
22 Ga0070659_100161488 3300005366 Bacteria 1832
23 Ga0070667_100015594 3300005367 Bacteria 6283
24 Ga0070667_100185240 3300005367 Bacteria 1842
25 Ga0070714_100021688 3300005435 Bacteria 5257
26 Ga0070713_100009523 3300005436 Bacteria 6960
27 Ga0070710_10311802 3300005437 Bacteria 1030
28 Ga0070678_100012889 3300005456 Bacteria 5217
29 Ga0070681_10029471 3300005458 Bacteria 5512
30 Ga0070681_10069951 3300005458 Bacteria 3475
31 Ga0070681_10393948 3300005458 Bacteria 1296
32 Ga0068867_100186660 3300005459 Bacteria 1652
33 Ga0070685_10024129 3300005466 Bacteria 3337
34 Ga0070679_100096590 3300005530 Bacteria 2942
35 Ga0070679_100101330 3300005530 Bacteria 2866
36 Ga0070679_100106514 3300005530 Bacteria 2789
37 Ga0070684_100011557 3300005535 Bacteria 7034
38 Ga0068853_100094529 3300005539 Bacteria 2634
39 Ga0068853_100168828 3300005539 Bacteria 1978
40 Ga0070672_100081855 3300005543 Bacteria 2589
41 Ga0068855_100010706 3300005563 Bacteria 11066
42 Ga0068855_100135141 3300005563 Bacteria 2814
43 Ga0068855_100272344 3300005563 Bacteria 1882
44 Ga0068855_100362974 3300005563 Bacteria 1593
45 Ga0068857_100016403 3300005577 Bacteria 6491
46 Ga0068857_100063666 3300005577 Bacteria 3279
47 Ga0068854_100285596 3300005578 Bacteria 1330
48 Ga0068856_100708847 3300005614 Bacteria 1027
49 Ga0068852_100126890 3300005616 Bacteria 2344
50 Ga0068852_100358686 3300005616 Bacteria 1425
51 Ga0068859_100017592 3300005617 Bacteria 7186
52 Ga0068863_100028965 3300005841 Bacteria 5289
53 Ga0068858_100171046 3300005842 Bacteria 2049
54 Ga0068862_100478377 3300005844 Bacteria 1178
55 Ga0081455_10034830 3300005937 Bacteria 4507
56 Ga0081538_10072621 3300005981 Bacteria 1885
57 Ga0081540_1005218 3300005983 Bacteria 9724
58 Ga0075365_10000806 3300006038 Bacteria 12877
59 Ga0075365_10000993 3300006038 Bacteria 12114
60 Ga0075368_10021869 3300006042 Bacteria 2432
61 Ga0075363_100001522 3300006048 Bacteria 8872
62 Ga0075363_100096822 3300006048 Bacteria 1630
63 Ga0075363_100298578 3300006048 Bacteria 934
64 Ga0075364_10001819 3300006051 Bacteria 11812
65 Ga0075364_10007447 3300006051 Bacteria 6500
66 Ga0075364_10007652 3300006051 Bacteria 6424
67 Ga0070716_100305302 3300006173 Bacteria 1109
68 Ga0075362_10091774 3300006177 Bacteria 1410
69 Ga0075367_10009807 3300006178 Bacteria 5017
70 Ga0075367_10088393 3300006178 Bacteria 1883
71 Ga0075367_10280624 3300006178 Bacteria 1047
72 Ga0075369_10196872 3300006186 Bacteria 929
73 Ga0075366_10000506 3300006195 Bacteria 18061
74 Ga0075366_10007060 3300006195 Bacteria 6180
75 Ga0075370_10060670 3300006353 Bacteria 2154
76 Ga0075370_10109448 3300006353 Bacteria 1603
77 Ga0075428_100645426 3300006844 Bacteria 1129
78 Ga0075431_100302302 3300006847 Bacteria 1616
79 Ga0075433_10518874 3300006852 Bacteria 1048
80 Ga0075434_100228531 3300006871 Bacteria 1880
81 Ga0075429_100148654 3300006880 Bacteria 2051
82 Ga0068865_100200418 3300006881 Bacteria 1549
83 Ga0075436_100033551 3300006914 Bacteria 3539
84 Ga0075436_100121741 3300006914 Bacteria 1826
85 Ga0097620_100017593 3300006931 Bacteria 7186
86 Ga0099795_10026962 3300007788 Bacteria 1940
87 Ga0105240_10042112 3300009093 Bacteria 5822
88 Ga0105247_10009142 3300009101 Bacteria 6031
89 Ga0114129_10139908 3300009147 Bacteria 3319
90 Ga0114129_10775183 3300009147 Bacteria 1225
91 Ga0114129_10814696 3300009147 Bacteria 1190
92 Ga0114129_10947626 3300009147 Bacteria 1087
93 Ga0105243_10148562 3300009148 Bacteria 2008
94 Ga0105237_10070183 3300009545 Bacteria 3499
95 Ga0105238_10053501 3300009551 Bacteria 4057
96 Ga0105238_10453697 3300009551 Bacteria 1279
97 Ga0105249_10384721 3300009553 Bacteria 1430
98 Ga0099796_10013528 3300010159 Bacteria 2333
99 Ga0157373_10025581 3300013100 Bacteria 4268
100 Ga0157371_10048722 3300013102 Bacteria 3012
101 Ga0157371_10487564 3300013102 Bacteria 909
102 Ga0157370_10014911 3300013104 Bacteria 7927
103 Ga0157370_10434241 3300013104 Bacteria 1208
104 Ga0157369_10072582 3300013105 Bacteria 3694
105 Ga0157372_10129979 3300013307 Bacteria 2897
106 Ga0157372_10270569 3300013307 Bacteria 1974
107 Ga0157372_10467612 3300013307 Bacteria 1470
108 Ga0157375_10201078 3300013308 Bacteria 2148
109 Ga0163163_10050530 3300014325 Bacteria 4094
110 Ga0182008_10113803 3300014497 Bacteria 1341
111 Ga0157379_10156736 3300014968 Bacteria 2054
112 Ga0163161_10260276 3300017792 Bacteria 1355
113 Ga0206354_10071518 3300020081 Bacteria 2371
114 Ga0206353_10496150 3300020082 Bacteria 1107
115 Ga0213875_10000011 3300021388 Bacteria 332447
116 Ga0209677_100388 3300025253 Bacteria 26746
117 Ga0209758_1006431 3300025297 Bacteria 8448
118 Ga0207682_10000372 3300025893 Bacteria 20677
119 Ga0207710_10008840 3300025900 Bacteria 4241
120 Ga0207688_10145530 3300025901 Bacteria 1397
121 Ga0207680_10405009 3300025903 Bacteria 964
122 Ga0207645_10017209 3300025907 Bacteria 4775
123 Ga0207645_10171534 3300025907 Bacteria 1422
124 Ga0207705_10115872 3300025909 Bacteria 1983
125 Ga0207705_10280147 3300025909 Bacteria 1276
126 Ga0207707_10048321 3300025912 Bacteria 3706
127 Ga0207707_10218387 3300025912 Bacteria 1659
128 Ga0207707_10544007 3300025912 Bacteria 987
129 Ga0207695_10028693 3300025913 Bacteria 6161
130 Ga0207693_10064980 3300025915 Bacteria 2857
131 Ga0207693_10152914 3300025915 Bacteria 1815
132 Ga0207693_10221995 3300025915 Bacteria 1484
133 Ga0207660_10145069 3300025917 Bacteria 1818
134 Ga0207660_10165959 3300025917 Bacteria 1707
135 Ga0207660_10250221 3300025917 Bacteria 1398
136 Ga0207662_10017734 3300025918 Bacteria 4031
137 Ga0207657_10002624 3300025919 Bacteria 19420
138 Ga0207657_10040730 3300025919 Bacteria 4114
139 Ga0207657_10050898 3300025919 Bacteria 3602
140 Ga0207652_10010745 3300025921 Bacteria 7371
141 Ga0207652_10088637 3300025921 Bacteria 2715
142 Ga0207681_10183317 3300025923 Bacteria 1596
143 Ga0207694_10037123 3300025924 Bacteria 3740
144 Ga0207694_10047880 3300025924 Bacteria 3307
145 Ga0207694_10049264 3300025924 Bacteria 3261
146 Ga0207650_10088906 3300025925 Bacteria 2357
147 Ga0207659_10142570 3300025926 Bacteria 1861
148 Ga0207659_10191974 3300025926 Bacteria 1626
149 Ga0207664_10029442 3300025929 Bacteria 4182
150 Ga0207686_10410330 3300025934 Bacteria 1034
151 Ga0207670_10375973 3300025936 Bacteria 1131
152 Ga0207669_10006211 3300025937 Bacteria 5439
153 Ga0207665_10037373 3300025939 Bacteria 3232
154 Ga0207661_10035067 3300025944 Bacteria 3907
155 Ga0207667_10053060 3300025949 Bacteria 4267
156 Ga0207667_10091817 3300025949 Bacteria 3136
157 Ga0207667_10221311 3300025949 Bacteria 1939
158 Ga0207667_10350584 3300025949 Bacteria 1505
159 Ga0207668_10166537 3300025972 Bacteria 1724
160 Ga0207640_10209093 3300025981 Bacteria 1485
161 Ga0207658_10024740 3300025986 Bacteria 4202
162 Ga0207639_10231283 3300026041 Bacteria 1602
163 Ga0207678_10564892 3300026067 Bacteria 996
164 Ga0207702_10000063 3300026078 Bacteria 123034
165 Ga0207702_10605833 3300026078 Bacteria 1075
166 Ga0207648_10014153 3300026089 Bacteria 7377
167 Ga0207648_10333860 3300026089 Bacteria 1364
168 Ga0207676_10011733 3300026095 Bacteria 6265
169 Ga0207674_10015694 3300026116 Bacteria 8311
170 Ga0207674_10055792 3300026116 Bacteria 4015
171 Ga0207683_10017090 3300026121 Bacteria 6174
172 Ga0207698_10098236 3300026142 Bacteria 2419
173 Ga0209179_1001693 3300027512 Bacteria 2793
174 Ga0265318_10011238 3300028577 Bacteria 3862
175 Ga0265338_10021310 3300028800 Bacteria 6764
176 Ga0265330_10007719 3300031235 Bacteria 5224
177 Ga0265330_10019518 3300031235 Bacteria 3106
178 Ga0265330_10033504 3300031235 Bacteria 2297
179 Ga0265332_10012252 3300031238 Bacteria 3805
180 Ga0265325_10000672 3300031241 Bacteria 24929
181 Ga0265325_10007938 3300031241 Bacteria 6305
182 Ga0265325_10020585 3300031241 Bacteria 3635
183 Ga0265325_10046028 3300031241 Bacteria 2264
184 Ga0265325_10070475 3300031241 Bacteria 1756
185 Ga0265329_10018102 3300031242 Bacteria 2413
186 Ga0265329_10048960 3300031242 Bacteria 1347
187 Ga0265340_10037930 3300031247 Bacteria 2385
188 Ga0265331_10046301 3300031250 Bacteria 2096
189 Ga0265316_10026170 3300031344 Bacteria 4860
190 Ga0265316_10029600 3300031344 Bacteria 4499
191 Ga0265316_10141291 3300031344 Bacteria 1808
192 Ga0265316_10158177 3300031344 Bacteria 1695
193 Ga0307408_100518742 3300031548 Bacteria 1046
194 Ga0265313_10000525 3300031595 Bacteria 40049
195 Ga0265313_10011516 3300031595 Bacteria 5490
196 Ga0265313_10011978 3300031595 Bacteria 5346
197 Ga0265314_10003505 3300031711 Bacteria 15140
198 Ga0265314_10007404 3300031711 Bacteria 9517
199 Ga0265314_10095938 3300031711 Bacteria 1919
200 Ga0265342_10000882 3300031712 Bacteria 29894
201 Ga0265342_10006148 3300031712 Bacteria 8986
202 Ga0265342_10011895 3300031712 Bacteria 5921
203 Ga0265342_10030931 3300031712 Bacteria 3313
204 Ga0307405_10148805 3300031731 Bacteria 1644
205 Ga0373923_0000353 3300035111 Bacteria 10413
206 Ga0373936_0001000 3300035113 Bacteria 10085
207 Ga0373941_0000525 3300035115 Bacteria 7684
208 Ga0373945_0002718 3300035116 Bacteria 5553
209 Ga0373953_0009859 3300035117 Bacteria 3306
210 Ga0373954_0028775 3300035118 Bacteria 2556
211 Ga0373956_0078482 3300035119 Bacteria 1512
212 Ga0373957_0021293 3300035120 Bacteria 2300
213 Ga0373943_0001873 3300035170 Bacteria 9516
214 Ga0373946_0011235 3300035171 Bacteria 3335
215 Ga0373955_0000087 3300035172 Bacteria 37402
216 Ga0373955_0013574 3300035172 Bacteria 3943
217 Ga0373955_0061181 3300035172 Bacteria 2079
218 Ga0373924_0000324 3300035410 Bacteria 14673
219 Ga0373924_0085274 3300035410 Bacteria 1347
220 Ga0373935_0000167 3300035692 Bacteria 30761
221 Ga0373927_0073662 3300035695 Bacteria 2211
222 Ga0373933_0010197 3300035724 Bacteria 5146
223 Ga0373933_0021539 3300035724 Bacteria 3662
224 Ga0373947_0003868 3300035725 Bacteria 8814
225 Ga0373937_0000006 3300036401 Bacteria 194781
226 Ga0373937_0078018 3300036401 Bacteria 3060
227 Ga0373925_0000002 3300037068 Bacteria 368879
228 Ga0395899_0012074 3300037312 Bacteria 6616
229 Ga0395900_0001475 3300037418 Bacteria 28056
230 Ga0395900_0481813 3300037418 Bacteria 1193
231 Ga0395898_0022707 3300037466 Bacteria 6350
232 Ga0395898_0289218 3300037466 Bacteria 1563
233 Ga0436364_0728139 3300037853 Bacteria 64829
234 Ga0436364_1379942 3300037853 Bacteria 1789
235 Ga0395901_0011499 3300038443 Bacteria 8969
236 Ga0395901_0037746 3300038443 Bacteria 4996
237 Ga0436365_1003223 3300039437 Bacteria 1652
238 Ga0436365_1681734 3300039437 Bacteria 2918
239 Ga0436365_1813374 3300039437 Bacteria 3886
240 Ga0436363_0348507 3300039450 Bacteria 1673
241 Ga0439453_0009821 3300041408 Bacteria 1566
242 Ga0450908_027652 3300042184 Bacteria 988
243 Ga0466961_0276189 3300044693 Bacteria 1029
244 Ga0466963_0003055 3300044694 Bacteria 9475
245 Ga0466963_0342592 3300044694 Bacteria 1052
246 Ga0466971_0064621 3300044719 Bacteria 1657
247 Ga0466971_0076364 3300044719 Bacteria 1524
248 Ga0466957_0010574 3300044842 Bacteria 5303
249 Ga0466959_0139706 3300045049 Bacteria 1713
250 Ga0466959_0225570 3300045049 Bacteria 1298
251 Ga0466958_0014051 3300045836 Bacteria 4568
252 Ga0466967_0001550 3300045976 Bacteria 13463
253 Ga0466967_0355552 3300045976 Bacteria 1418
254 Ga0466967_0503469 3300045976 Bacteria 1189
255 Ga0495592_0000039 3300046454 Bacteria 124471
256 Ga0495629_0003335 3300046459 Bacteria 12135
257 Ga0495641_0079913 3300046461 Bacteria 1465
258 Ga0495651_0000420 3300046462 Bacteria 32886
259 Ga0495651_0146209 3300046462 Bacteria 1709
260 Ga0495653_0000006 3300046463 Bacteria 363285
261 Ga0495662_0002917 3300046476 Bacteria 8643
262 Ga0495664_0000002 3300046477 Bacteria 625183
263 Ga0495608_0000009 3300046511 Bacteria 266614
264 Ga0495618_0000005 3300046514 Bacteria 230421
265 Ga0495628_0000002 3300046516 Bacteria 589399
266 Ga0495630_0000865 3300046517 Bacteria 21326
267 Ga0495652_0000004 3300046529 Bacteria 588877
268 Ga0495652_0139723 3300046529 Bacteria 1906
269 Ga0495640_0000005 3300046533 Bacteria 318271
270 Ga0495587_0000007 3300046536 Bacteria 290788
271 Ga0495587_0033812 3300046536 Bacteria 3085
272 Ga0495598_0023302 3300046537 Bacteria 1666
273 Ga0495621_0006145 3300046539 Bacteria 3490
274 Ga0495645_0000003 3300046543 Bacteria 570133
275 Ga0495667_0000002 3300046559 Bacteria 437535
276 Ga0495634_0000022 3300046642 Bacteria 118988
277 Ga0495635_0000020 3300046663 Bacteria 189698
278 Ga0495599_0000001 3300046678 Bacteria 537563
279 Ga0495623_0000001 3300046679 Bacteria 313861
280 Ga0495646_0000013 3300046680 Bacteria 159700
281 Ga0495613_0013661 3300046689 Bacteria 6025
282 Ga0495600_0000006 3300046809 Bacteria 151916
283 Ga0495600_0067932 3300046809 Bacteria 2330
284 Ga0495604_0000005 3300047317 Bacteria 424516
285 Ga0495674_0000003 3300047319 Bacteria 562126
286 Ga0495680_0000002 3300047322 Bacteria 197533
287 Ga0495675_0000010 3300047444 Bacteria 153375
288 Ga0495685_036010 3300047447 Bacteria 1700
289 Ga0495684_0000028 3300047471 Bacteria 123549
290 Ga0495593_0002430 3300047673 Bacteria 11194
291 Ga0495602_0000054 3300048088 Bacteria 111411
292 Ga0495602_0322499 3300048088 Bacteria 1123
293 Ga0496100_0169441 3300048903 Bacteria 1571
294 Ga0496104_0327630 3300048907 Bacteria 1445
295 Ga0496108_0230178 3300048911 Bacteria 1612
296 Ga0496109_0139483 3300048912 Bacteria 2267
297 Ga0496109_0324657 3300048912 Bacteria 1453
298 Ga0496112_0028323 3300048915 Bacteria 5406
299 Ga0496112_0323272 3300048915 Bacteria 1487
300 Ga0496113_0058576 3300048916 Bacteria 2899
301 Ga0496118_0003033 3300048921 Bacteria 21657
302 Ga0496121_0027791 3300048924 Bacteria 5284
303 Ga0496125_0138236 3300048928 Bacteria 1699
304 Ga0501031_0000538 3300049568 Bacteria 22173
305 Ga0501031_0072799 3300049568 Bacteria 2237
306 Ga0501031_0098829 3300049568 Bacteria 1904
307 Ga0501031_0229428 3300049568 Bacteria 1208
308 Ga0501032_0000040 3300049569 Bacteria 115662
309 Ga0501032_0056252 3300049569 Bacteria 2644
310 Ga0501033_0000326 3300049570 Bacteria 45367
311 Ga0501033_0011750 3300049570 Bacteria 6694
312 Ga0501033_0307172 3300049570 Bacteria 1116
313 Ga0501034_0000254 3300049571 Bacteria 97896
314 Ga0501034_0000734 3300049571 Bacteria 49577
315 Ga0501034_0022707 3300049571 Bacteria 6391
316 Ga0501034_0042997 3300049571 Bacteria 4573
317 Ga0501034_0148973 3300049571 Bacteria 2316
318 Ga0501034_0541288 3300049571 Bacteria 1074
319 Ga0501034_0568291 3300049571 Bacteria 1042
320 Ga0501036_0005317 3300049572 Bacteria 10414
321 Ga0501036_0119318 3300049572 Bacteria 2227
322 Ga0501037_0000041 3300049573 Bacteria 118457
323 Ga0501037_0010168 3300049573 Bacteria 6903
324 Ga0501037_0044444 3300049573 Bacteria 3262
325 Ga0501038_0000057 3300049574 Bacteria 92766
326 Ga0501038_0066265 3300049574 Bacteria 3075
327 Ga0501038_0106367 3300049574 Bacteria 2329
328 Ga0501038_0126383 3300049574 Bacteria 2104
329 Ga0501039_0000084 3300049575 Bacteria 71542
330 Ga0501039_0015274 3300049575 Bacteria 5877
331 Ga0501039_0044970 3300049575 Bacteria 3410
332 Ga0501042_0180437 3300049578 Bacteria 1523
333 Ga0501042_0194527 3300049578 Bacteria 1463
334 Ga0501042_0235404 3300049578 Bacteria 1321
335 Ga0501043_0000184 3300049579 Bacteria 56470
336 Ga0501043_0011800 3300049579 Bacteria 6843
337 Ga0501043_0031876 3300049579 Bacteria 4143
338 Ga0501043_0330107 3300049579 Bacteria 1162
339 Ga0501046_0000072 3300049580 Bacteria 106407
340 Ga0501046_0020915 3300049580 Bacteria 5403
341 Ga0501046_0070864 3300049580 Bacteria 2709
342 Ga0501046_0182011 3300049580 Bacteria 1571
343 Ga0501047_0000044 3300049581 Bacteria 174789
344 Ga0501047_0011180 3300049581 Bacteria 8494
345 Ga0501047_0024453 3300049581 Bacteria 5796
346 Ga0501047_0038179 3300049581 Bacteria 4645
347 Ga0501047_0050728 3300049581 Bacteria 4007
348 Ga0501047_0087365 3300049581 Bacteria 2995
349 Ga0501047_0220785 3300049581 Bacteria 1751
350 Ga0501047_0450871 3300049581 Bacteria 1116
351 Ga0501047_0477811 3300049581 Bacteria 1074
352 Ga0501048_0069756 3300049582 Bacteria 2482
353 Ga0501048_0093316 3300049582 Bacteria 2123
354 Ga0501067_0000946 3300049583 Bacteria 15551
355 Ga0501067_0033763 3300049583 Bacteria 2838
356 Ga0501067_0049530 3300049583 Bacteria 2327
357 Ga0501067_0104976 3300049583 Bacteria 1570
358 Ga0501068_0000113 3300049584 Bacteria 34900
359 Ga0501068_0072334 3300049584 Bacteria 2105
360 Ga0501068_0138455 3300049584 Bacteria 1525
361 Ga0501068_0152519 3300049584 Bacteria 1453
362 Ga0501069_0001364 3300049585 Bacteria 11987
363 Ga0501069_0019185 3300049585 Bacteria 3695
364 Ga0501069_0064922 3300049585 Bacteria 2040
365 Ga0501069_0200933 3300049585 Bacteria 1155
366 Ga0501070_0000310 3300049586 Bacteria 44627
367 Ga0501070_0012759 3300049586 Bacteria 7084
368 Ga0501070_0170535 3300049586 Bacteria 1792
369 Ga0501070_0206382 3300049586 Bacteria 1613
370 Ga0501070_0492621 3300049586 Bacteria 985
371 Ga0501071_0141085 3300049587 Bacteria 1794
372 Ga0501072_0000297 3300049588 Bacteria 35134
373 Ga0501072_0081941 3300049588 Bacteria 2558
374 Ga0501072_0224051 3300049588 Bacteria 1498
375 Ga0501072_0274212 3300049588 Bacteria 1342
376 Ga0501072_0408587 3300049588 Bacteria 1077
377 Ga0501073_0000043 3300049589 Bacteria 80142
378 Ga0501073_0030355 3300049589 Bacteria 3859
379 Ga0501073_0265037 3300049589 Bacteria 1185
380 Ga0501074_0000111 3300049590 Bacteria 40575
381 Ga0501074_0005366 3300049590 Bacteria 9220
382 Ga0501074_0093031 3300049590 Bacteria 2159
383 Ga0501074_0256124 3300049590 Bacteria 1244
384 Ga0501074_0472186 3300049590 Bacteria 889
385 Ga0501075_0333598 3300049591 Bacteria 1156
386 Ga0501079_0027449 3300049741 Bacteria 4365
387 Ga0501079_0065854 3300049741 Bacteria 2795
388 Ga0501079_0123756 3300049741 Bacteria 2011
389 Ga0501080_0001812 3300049742 Bacteria 18330
390 Ga0501080_0138607 3300049742 Bacteria 2250
391 Ga0501080_0155262 3300049742 Bacteria 2114
392 Ga0501080_0264661 3300049742 Bacteria 1566
393 Ga0501081_0088042 3300049743 Bacteria 2181
394 Ga0501081_0191354 3300049743 Bacteria 1482
395 Ga0501083_0003568 3300049744 Bacteria 10904
396 Ga0501083_0015275 3300049744 Bacteria 5377
397 Ga0501083_0040771 3300049744 Bacteria 3151
398 Ga0501083_0129306 3300049744 Bacteria 1655
399 Ga0501083_0255843 3300049744 Bacteria 1140
400 Ga0501083_0259416 3300049744 Bacteria 1131
401 Ga0501035_0000128 3300049822 Bacteria 92297
402 Ga0501035_0038703 3300049822 Bacteria 4317
403 Ga0501035_0458675 3300049822 Bacteria 1053
404 Ga0501044_0000907 3300049823 Bacteria 35617
405 Ga0501044_0057312 3300049823 Bacteria 3998
406 Ga0501044_0144918 3300049823 Bacteria 2361
407 Ga0501044_0257213 3300049823 Bacteria 1685
408 Ga0501044_0294670 3300049823 Bacteria 1553
409 Ga0501045_0011740 3300049824 Bacteria 6155
410 Ga0501045_0035779 3300049824 Bacteria 3606
411 Ga0501045_0398254 3300049824 Bacteria 1025
412 nmdc:mga03n38_131528_c1 3300050490 Bacteria 1240
413 nmdc:mga03n38_62208_c1 3300050490 Bacteria 1702
414 nmdc:mga03n38_71221_c1 3300050490 Bacteria 1610
415 nmdc:mga00v17_147213_c1 3300050491 Bacteria 1512
416 nmdc:mga00v17_388941_c1 3300050491 Bacteria 907
417 nmdc:mga00v17_4175_c1 3300050491 Bacteria 7487
418 nmdc:mga00v17_7230_c1 3300050491 Bacteria 5916
419 nmdc:mga0yw44_101092_c1 3300050492 Bacteria 1837
420 nmdc:mga0yw44_633_c1 3300050492 Bacteria 12783
421 nmdc:mga0yw44_77769_c1 3300050492 Bacteria 2073
422 nmdc:mga0yw44_88888_c1 3300050492 Bacteria 1949
423 nmdc:mga0k408_1585_c1 3300050493 Bacteria 12299
424 nmdc:mga0k408_23450_c1 3300050493 Bacteria 3045
425 nmdc:mga06z11_12271_c1 3300050494 Bacteria 3722
426 nmdc:mga06z11_156771_c1 3300050494 Bacteria 1299
427 nmdc:mga06z11_171043_c1 3300050494 Bacteria 1248
428 nmdc:mga06z11_47475_c1 3300050494 Bacteria 2181
429 nmdc:mga06z11_5156_c1 3300050494 Bacteria 5213
430 nmdc:mga07m45_103498_c1 3300050496 Bacteria 1636
431 nmdc:mga07m45_103876_c1 3300050496 Bacteria 1633
432 nmdc:mga07m45_32590_c1 3300050496 Bacteria 2890
433 nmdc:mga05p37_142109_c1 3300050507 Bacteria 2940
434 nmdc:mga05p37_507020_c1 3300050507 Bacteria 1383
435 nmdc:mga0qj67_563241_c1 3300050509 Bacteria 913
436 nmdc:mga06r32_114921_c1 3300050510 Bacteria 2650
437 nmdc:mga08y16_209897_c1 3300050511 Bacteria 2017
438 nmdc:mga08x19_122523_c1 3300050514 Bacteria 1744
439 nmdc:mga0sz30_63508_c1 3300050516 Bacteria 1581
440 Ga0495601_0000008 3300053077 Bacteria 362152
441 Ga0495601_0020902 3300053077 Bacteria 4002
442 Ga0495601_0175805 3300053077 Bacteria 1399
443 Ga0495612_0000002 3300053078 Bacteria 310466
444 Ga0495612_0041019 3300053078 Bacteria 1887
445 Ga0495612_0066416 3300053078 Bacteria 1499
446 Ga0495595_0000008 3300053084 Bacteria 196206
447 Ga0495619_0000002 3300053085 Bacteria 530226
448 Ga0495619_0036464 3300053085 Bacteria 3203
449 Ga0495619_0045272 3300053085 Bacteria 2891
450 Ga0495619_0133438 3300053085 Bacteria 1707
451 Ga0495619_0138197 3300053085 Bacteria 1676
452 Ga0500583_0140975 3300053092 Bacteria 1198
453 Ga0500641_0001637 3300053096 Bacteria 7976
454 Ga0500641_0085381 3300053096 Bacteria 1343
455 Ga0500641_0148999 3300053096 Bacteria 1010
456 Ga0500658_0129710 3300053134 Bacteria 1123
457 Ga0500568_0061605 3300053139 Bacteria 1451
458 Ga0500604_0120639 3300053151 Bacteria 876
459 Ga0500616_0000038 3300053153 Bacteria 386801
460 Ga0500645_016332 3300053730 Bacteria 2340
461 Ga0501084_0006582 3300054114 Bacteria 9547
462 Ga0501084_0043717 3300054114 Bacteria 3747
463 Ga0501084_0592228 3300054114 Bacteria 937
464 Ga0501082_0006113 3300060353 Bacteria 10451
465 Ga0501082_0237183 3300060353 Bacteria 1587
466 Ga0501082_0237436 3300060353 Bacteria 1586
467 Ga0501082_0274387 3300060353 Bacteria 1468
468 2524465285 2524023210 Bacteria 9029266
469 2644290466 2643221651 Bacteria 4798932
470 2885390136 2885383462 Bacteria 9473874
471 Ga0495675_0057135
472 JGI25153J46596_10011224
473 Ga0070658_10004547
474 Ga0070658_10184865
475 Ga0070676_10030145
476 Ga0070676_10168897
477 Ga0070683_100032251
478 Ga0070670_100188621
479 Ga0070670_100370769
480 Ga0070680_100011487
481 Ga0070680_100227613
482 Ga0070660_100019659
483 Ga0070660_100283202
484 Ga0070689_100517813
485 Ga0070669_100043776
486 Ga0070675_100033030
487 Ga0070671_100125732
488 Ga0070674_100011896
489 Ga0070673_100115783
490 Ga0070659_100026429
491 Ga0070659_100136206
492 Ga0070659_100161488
493 Ga0070667_100015594
494 Ga0070667_100185240
495 Ga0070714_100021688
496 Ga0070713_100009523
497 Ga0070710_10311802
498 Ga0070678_100012889
499 Ga0070681_10029471
500 Ga0070681_10069951
501 Ga0070681_10393948
502 Ga0068867_100186660
503 Ga0070685_10024129
504 Ga0070679_100096590
505 Ga0070679_100101330
506 Ga0070679_100106514
507 Ga0070684_100011557
508 Ga0068853_100094529
509 Ga0068853_100168828
510 Ga0070672_100081855
511 Ga0068855_100010706
512 Ga0068855_100135141
513 Ga0068855_100272344
514 Ga0068855_100362974
515 Ga0068857_100016403
516 Ga0068857_100063666
517 Ga0068854_100285596
518 Ga0068856_100708847
519 Ga0068852_100126890
520 Ga0068852_100358686
521 Ga0068859_100017592
522 Ga0068863_100028965
523 Ga0068858_100171046
524 Ga0068862_100478377
525 Ga0081455_10034830
526 Ga0081538_10072621
527 Ga0081540_1005218
528 Ga0075365_10000806
529 Ga0075365_10000993
530 Ga0075368_10021869
531 Ga0075363_100001522
532 Ga0075363_100096822
533 Ga0075363_100298578
534 Ga0075364_10001819
535 Ga0075364_10007447
536 Ga0075364_10007652
537 Ga0070716_100305302
538 Ga0075362_10091774
539 Ga0075367_10009807
540 Ga0075367_10088393
541 Ga0075367_10280624
542 Ga0075369_10196872
543 Ga0075366_10000506
544 Ga0075366_10007060
545 Ga0075370_10060670
546 Ga0075370_10109448
547 Ga0075428_100645426
548 Ga0075431_100302302
549 Ga0075433_10518874
550 Ga0075434_100228531
551 Ga0075429_100148654
552 Ga0068865_100200418
553 Ga0075436_100033551
554 Ga0075436_100121741
555 Ga0097620_100017593
556 Ga0099795_10026962
557 Ga0105240_10042112
558 Ga0105247_10009142
559 Ga0114129_10139908
560 Ga0114129_10775183
561 Ga0114129_10814696
562 Ga0114129_10947626
563 Ga0105243_10148562
564 Ga0105237_10070183
565 Ga0105238_10053501
566 Ga0105238_10453697
567 Ga0105249_10384721
568 Ga0099796_10013528
569 Ga0157373_10025581
570 Ga0157371_10048722
571 Ga0157371_10487564
572 Ga0157370_10014911
573 Ga0157370_10434241
574 Ga0157369_10072582
575 Ga0157372_10129979
576 Ga0157372_10270569
577 Ga0157372_10467612
578 Ga0157375_10201078
579 Ga0163163_10050530
580 Ga0182008_10113803
581 Ga0157379_10156736
582 Ga0163161_10260276
583 Ga0206354_10071518
584 Ga0206353_10496150
585 Ga0213875_10000011
586 Ga0209677_100388
587 Ga0209758_1006431
588 Ga0207682_10000372
589 Ga0207710_10008840
590 Ga0207688_10145530
591 Ga0207680_10405009
592 Ga0207645_10017209
593 Ga0207645_10171534
594 Ga0207705_10115872
595 Ga0207705_10280147
596 Ga0207707_10048321
597 Ga0207707_10218387
598 Ga0207707_10544007
599 Ga0207695_10028693
600 Ga0207693_10064980
601 Ga0207693_10152914
602 Ga0207693_10221995
603 Ga0207660_10145069
604 Ga0207660_10165959
605 Ga0207660_10250221
606 Ga0207662_10017734
607 Ga0207657_10002624
608 Ga0207657_10040730
609 Ga0207657_10050898
610 Ga0207652_10010745
611 Ga0207652_10088637
612 Ga0207681_10183317
613 Ga0207694_10037123
614 Ga0207694_10047880
615 Ga0207694_10049264
616 Ga0207650_10088906
617 Ga0207659_10142570
618 Ga0207659_10191974
619 Ga0207664_10029442
620 Ga0207686_10410330
621 Ga0207670_10375973
622 Ga0207669_10006211
623 Ga0207665_10037373
624 Ga0207661_10035067
625 Ga0207667_10053060
626 Ga0207667_10091817
627 Ga0207667_10221311
628 Ga0207667_10350584
629 Ga0207668_10166537
630 Ga0207640_10209093
631 Ga0207658_10024740
632 Ga0207639_10231283
633 Ga0207678_10564892
634 Ga0207702_10000063
635 Ga0207702_10605833
636 Ga0207648_10014153
637 Ga0207648_10333860
638 Ga0207676_10011733
639 Ga0207674_10015694
640 Ga0207674_10055792
641 Ga0207683_10017090
642 Ga0207698_10098236
643 Ga0209179_1001693
644 Ga0265318_10011238
645 Ga0265338_10021310
646 Ga0265330_10007719
647 Ga0265330_10019518
648 Ga0265330_10033504
649 Ga0265332_10012252
650 Ga0265325_10000672
651 Ga0265325_10007938
652 Ga0265325_10020585
653 Ga0265325_10046028
654 Ga0265325_10070475
655 Ga0265329_10018102
656 Ga0265329_10048960
657 Ga0265340_10037930
658 Ga0265331_10046301
659 Ga0265316_10026170
660 Ga0265316_10029600
661 Ga0265316_10141291
662 Ga0265316_10158177
663 Ga0307408_100518742
664 Ga0265313_10000525
665 Ga0265313_10011516
666 Ga0265313_10011978
667 Ga0265314_10003505
668 Ga0265314_10007404
669 Ga0265314_10095938
670 Ga0265342_10000882
671 Ga0265342_10006148
672 Ga0265342_10011895
673 Ga0265342_10030931
674 Ga0307405_10148805
675 Ga0373923_0000353
676 Ga0373936_0001000
677 Ga0373941_0000525
678 Ga0373945_0002718
679 Ga0373953_0009859
680 Ga0373954_0028775
681 Ga0373956_0078482
682 Ga0373957_0021293
683 Ga0373943_0001873
684 Ga0373946_0011235
685 Ga0373955_0000087
686 Ga0373955_0013574
687 Ga0373955_0061181
688 Ga0373924_0000324
689 Ga0373924_0085274
690 Ga0373935_0000167
691 Ga0373927_0073662
692 Ga0373933_0010197
693 Ga0373933_0021539
694 Ga0373947_0003868
695 Ga0373937_0000006
696 Ga0373937_0078018
697 Ga0373925_0000002
698 Ga0395899_0012074
699 Ga0395900_0001475
700 Ga0395900_0481813
701 Ga0395898_0022707
702 Ga0395898_0289218
703 Ga0436364_0728139
704 Ga0436364_1379942
705 Ga0395901_0011499
706 Ga0395901_0037746
707 Ga0436365_1003223
708 Ga0436365_1681734
709 Ga0436365_1813374
710 Ga0436363_0348507
711 Ga0439453_0009821
712 Ga0450908_027652
713 Ga0466961_0276189
714 Ga0466963_0003055
715 Ga0466963_0342592
716 Ga0466971_0064621
717 Ga0466971_0076364
718 Ga0466957_0010574
719 Ga0466959_0139706
720 Ga0466959_0225570
721 Ga0466958_0014051
722 Ga0466967_0001550
723 Ga0466967_0355552
724 Ga0466967_0503469
725 Ga0495592_0000039
726 Ga0495629_0003335
727 Ga0495641_0079913
728 Ga0495651_0000420
729 Ga0495651_0146209
730 Ga0495653_0000006
731 Ga0495662_0002917
732 Ga0495664_0000002
733 Ga0495608_0000009
734 Ga0495618_0000005
735 Ga0495628_0000002
736 Ga0495630_0000865
737 Ga0495652_0000004
738 Ga0495652_0139723
739 Ga0495640_0000005
740 Ga0495587_0000007
741 Ga0495587_0033812
742 Ga0495598_0023302
743 Ga0495621_0006145
744 Ga0495645_0000003
745 Ga0495667_0000002
746 Ga0495634_0000022
747 Ga0495635_0000020
748 Ga0495599_0000001
749 Ga0495623_0000001
750 Ga0495646_0000013
751 Ga0495613_0013661
752 Ga0495600_0000006
753 Ga0495600_0067932
754 Ga0495604_0000005
755 Ga0495674_0000003
756 Ga0495680_0000002
757 Ga0495675_0000010
758 Ga0495685_036010
759 Ga0495684_0000028
760 Ga0495593_0002430
761 Ga0495602_0000054
762 Ga0495602_0322499
763 Ga0496100_0169441
764 Ga0496104_0327630
765 Ga0496108_0230178
766 Ga0496109_0139483
767 Ga0496109_0324657
768 Ga0496112_0028323
769 Ga0496112_0323272
770 Ga0496113_0058576
771 Ga0496118_0003033
772 Ga0496121_0027791
773 Ga0496125_0138236
774 Ga0501031_0000538
775 Ga0501031_0072799
776 Ga0501031_0098829
777 Ga0501031_0229428
778 Ga0501032_0000040
779 Ga0501032_0056252
780 Ga0501033_0000326
781 Ga0501033_0011750
782 Ga0501033_0307172
783 Ga0501034_0000254
784 Ga0501034_0000734
785 Ga0501034_0022707
786 Ga0501034_0042997
787 Ga0501034_0148973
788 Ga0501034_0541288
789 Ga0501034_0568291
790 Ga0501036_0005317
791 Ga0501036_0119318
792 Ga0501037_0000041
793 Ga0501037_0010168
794 Ga0501037_0044444
795 Ga0501038_0000057
796 Ga0501038_0066265
797 Ga0501038_0106367
798 Ga0501038_0126383
799 Ga0501039_0000084
800 Ga0501039_0015274
801 Ga0501039_0044970
802 Ga0501042_0180437
803 Ga0501042_0194527
804 Ga0501042_0235404
805 Ga0501043_0000184
806 Ga0501043_0011800
807 Ga0501043_0031876
808 Ga0501043_0330107
809 Ga0501046_0000072
810 Ga0501046_0020915
811 Ga0501046_0070864
812 Ga0501046_0182011
813 Ga0501047_0000044
814 Ga0501047_0011180
815 Ga0501047_0024453
816 Ga0501047_0038179
817 Ga0501047_0050728
818 Ga0501047_0087365
819 Ga0501047_0220785
820 Ga0501047_0450871
821 Ga0501047_0477811
822 Ga0501048_0069756
823 Ga0501048_0093316
824 Ga0501067_0000946
825 Ga0501067_0033763
826 Ga0501067_0049530
827 Ga0501067_0104976
828 Ga0501068_0000113
829 Ga0501068_0072334
830 Ga0501068_0138455
831 Ga0501068_0152519
832 Ga0501069_0001364
833 Ga0501069_0019185
834 Ga0501069_0064922
835 Ga0501069_0200933
836 Ga0501070_0000310
837 Ga0501070_0012759
838 Ga0501070_0170535
839 Ga0501070_0206382
840 Ga0501070_0492621
841 Ga0501071_0141085
842 Ga0501072_0000297
843 Ga0501072_0081941
844 Ga0501072_0224051
845 Ga0501072_0274212
846 Ga0501072_0408587
847 Ga0501073_0000043
848 Ga0501073_0030355
849 Ga0501073_0265037
850 Ga0501074_0000111
851 Ga0501074_0005366
852 Ga0501074_0093031
853 Ga0501074_0256124
854 Ga0501074_0472186
855 Ga0501075_0333598
856 Ga0501079_0027449
857 Ga0501079_0065854
858 Ga0501079_0123756
859 Ga0501080_0001812
860 Ga0501080_0138607
861 Ga0501080_0155262
862 Ga0501080_0264661
863 Ga0501081_0088042
864 Ga0501081_0191354
865 Ga0501083_0003568
866 Ga0501083_0015275
867 Ga0501083_0040771
868 Ga0501083_0129306
869 Ga0501083_0255843
870 Ga0501083_0259416
871 Ga0501035_0000128
872 Ga0501035_0038703
873 Ga0501035_0458675
874 Ga0501044_0000907
875 Ga0501044_0057312
876 Ga0501044_0144918
877 Ga0501044_0257213
878 Ga0501044_0294670
879 Ga0501045_0011740
880 Ga0501045_0035779
881 Ga0501045_0398254
882 nmdc:mga03n38_131528_c1
883 nmdc:mga03n38_62208_c1
884 nmdc:mga03n38_71221_c1
885 nmdc:mga00v17_147213_c1
886 nmdc:mga00v17_388941_c1
887 nmdc:mga00v17_4175_c1
888 nmdc:mga00v17_7230_c1
889 nmdc:mga0yw44_101092_c1
890 nmdc:mga0yw44_633_c1
891 nmdc:mga0yw44_77769_c1
892 nmdc:mga0yw44_88888_c1
893 nmdc:mga0k408_1585_c1
894 nmdc:mga0k408_23450_c1
895 nmdc:mga06z11_12271_c1
896 nmdc:mga06z11_156771_c1
897 nmdc:mga06z11_171043_c1
898 nmdc:mga06z11_47475_c1
899 nmdc:mga06z11_5156_c1
900 nmdc:mga07m45_103498_c1
901 nmdc:mga07m45_103876_c1
902 nmdc:mga07m45_32590_c1
903 nmdc:mga05p37_142109_c1
904 nmdc:mga05p37_507020_c1
905 nmdc:mga0qj67_563241_c1
906 nmdc:mga06r32_114921_c1
907 nmdc:mga08y16_209897_c1
908 nmdc:mga08x19_122523_c1
909 nmdc:mga0sz30_63508_c1
910 Ga0495601_0000008
911 Ga0495601_0020902
912 Ga0495601_0175805
913 Ga0495612_0000002
914 Ga0495612_0041019
915 Ga0495612_0066416
916 Ga0495595_0000008
917 Ga0495619_0000002
918 Ga0495619_0036464
919 Ga0495619_0045272
920 Ga0495619_0133438
921 Ga0495619_0138197
922 Ga0500583_0140975
923 Ga0500641_0001637
924 Ga0500641_0085381
925 Ga0500641_0148999
926 Ga0500658_0129710
927 Ga0500568_0061605
928 Ga0500604_0120639
929 Ga0500616_0000038
930 Ga0500645_016332
931 Ga0501084_0006582
932 Ga0501084_0043717
933 Ga0501084_0592228
934 Ga0501082_0006113
935 Ga0501082_0237183
936 Ga0501082_0237436
937 Ga0501082_0274387
938 2524465285
939 2644290466
940 2885390136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16976

RcpC

Flp pilus assembly protein RcpC/CpaB

142

253

0.98

PF08666

SAF

SAF domain

68

136

0.96

Map