F450552

General Info

Members Datasets Scaffolds Average Seq Length
471 224 942 504

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100012931|Ga0070699_1000129315
Length 563
Sequence VTSRNSHQKSGANQDNRNTQFVPDYDYELAVSYNVVQHIGRFFLVANPAGEGHMATAASVNWQEKHEQIGRAAGSCVLVLFGASGDLTRRKLVPSLFNLAKAKLLPKNFAVVGVSFDDLSLEKFRDQVTGFLQAEDRGTEAWEWFTQRLYYQRGDFADPATYSTLTAGLTEVDRQHSTEANYLFYLATAPKYFAPIVQQLGKAGLSNQDNGQWRRVVIEKPFGHDLESARALNRDVKAVLAENQIYRIDHYLGKETVQNIMVFRFDNAIFEPIWNRRYIDHVQITNAETVGVEQRGGYFDNAGTLRDMVPNHIMQLLSLTAMEPPVSFQADAVRNEQAKILRAVQPLDSEDVLHSSVRGQYGEGVIGGERVAAYRSEPGVAPESKTETFLALKLNIDNWRWAGVPFYVRTGKRLARRHTEITIQFKRTPFEIFRNAPVHNHTNQLVIQIQPVEAISLSFGAKVPGPVLRVGSVDMSFEYTKYFGADAYTGYEVLLYECMIGDATLFQRADMVEAGWSIVDPVLDVWQALPPRRFPNYPSGAWGPVESDELLARDGRQWRKIEP

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
215 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
216 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
217 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
218 2643221651 Afipia sp. Root123D2 Isolate Unclassified
219 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
220 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
221 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
222 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
223 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
224 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0.21
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 4.88
Rhizosphere 91.08
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100012931 3300005518 Bacteria 7196
2 JGI24752J21851_1003133 3300001976 Bacteria 2182
3 Ga0070658_10008172 3300005327 Bacteria 8411
4 Ga0070658_10062994 3300005327 Bacteria 3022
5 Ga0070676_10001792 3300005328 Bacteria 10938
6 Ga0070676_10007386 3300005328 Bacteria 5895
7 Ga0070683_100006666 3300005329 Bacteria 9698
8 Ga0070683_100020747 3300005329 Bacteria 5852
9 Ga0070670_100006813 3300005331 Bacteria 9675
10 Ga0070670_100019200 3300005331 Bacteria 5861
11 Ga0070666_10015834 3300005335 Bacteria 4816
12 Ga0070680_100010748 3300005336 Bacteria 7065
13 Ga0070680_100026631 3300005336 Bacteria 4624
14 Ga0070680_100130149 3300005336 Bacteria 2105
15 Ga0068868_100012055 3300005338 Bacteria 6312
16 Ga0068868_100149072 3300005338 Bacteria 1925
17 Ga0070689_100050517 3300005340 Bacteria 3213
18 Ga0070689_100055794 3300005340 Bacteria 3062
19 Ga0070687_100029801 3300005343 Bacteria 2661
20 Ga0070661_100002005 3300005344 Bacteria 14083
21 Ga0070668_100019291 3300005347 Bacteria 5132
22 Ga0070669_100097825 3300005353 Bacteria 2210
23 Ga0070675_100023044 3300005354 Bacteria 4975
24 Ga0070673_100013279 3300005364 Bacteria 5689
25 Ga0070688_100004903 3300005365 Bacteria 7002
26 Ga0070659_100007287 3300005366 Bacteria 8030
27 Ga0070659_100023178 3300005366 Bacteria 4747
28 Ga0070667_100003228 3300005367 Bacteria 13952
29 Ga0070667_100226009 3300005367 Bacteria 1667
30 Ga0070709_10002746 3300005434 Bacteria 9525
31 Ga0070709_10032354 3300005434 Bacteria 3153
32 Ga0070709_10103360 3300005434 Bacteria 1902
33 Ga0070714_100000781 3300005435 Bacteria 22569
34 Ga0070714_100026896 3300005435 Bacteria 4759
35 Ga0070714_100044629 3300005435 Bacteria 3753
36 Ga0070714_100191134 3300005435 Bacteria 1868
37 Ga0070713_100003699 3300005436 Bacteria 10124
38 Ga0070713_100004617 3300005436 Bacteria 9286
39 Ga0070713_100018501 3300005436 Bacteria 5294
40 Ga0070713_100042082 3300005436 Bacteria 3726
41 Ga0070713_100047267 3300005436 Bacteria 3536
42 Ga0070713_100100947 3300005436 Bacteria 2499
43 Ga0070710_10021671 3300005437 Bacteria 3353
44 Ga0070711_100000597 3300005439 Bacteria 18816
45 Ga0070711_100004279 3300005439 Bacteria 8399
46 Ga0070711_100112790 3300005439 Bacteria 1998
47 Ga0070694_100033574 3300005444 Bacteria 3378
48 Ga0070708_100000443 3300005445 Bacteria 30954
49 Ga0070708_100003046 3300005445 Bacteria 13014
50 Ga0070708_100008128 3300005445 Bacteria 8413
51 Ga0070708_100008510 3300005445 Bacteria 8243
52 Ga0070708_100010869 3300005445 Bacteria 7394
53 Ga0070708_100034542 3300005445 Bacteria 4400
54 Ga0070663_100004983 3300005455 Bacteria 7842
55 Ga0070678_100150857 3300005456 Bacteria 1872
56 Ga0070662_100002217 3300005457 Bacteria 11932
57 Ga0070662_100068313 3300005457 Bacteria 2612
58 Ga0070662_100122669 3300005457 Bacteria 1993
59 Ga0070681_10001215 3300005458 Bacteria 22413
60 Ga0070681_10027213 3300005458 Bacteria 5750
61 Ga0070681_10038176 3300005458 Bacteria 4816
62 Ga0070681_10093099 3300005458 Bacteria 2962
63 Ga0068867_100020670 3300005459 Bacteria 4691
64 Ga0068867_100075414 3300005459 Bacteria 2530
65 Ga0068867_100094773 3300005459 Bacteria 2270
66 Ga0068867_100117106 3300005459 Bacteria 2054
67 Ga0070685_10013968 3300005466 Bacteria 4248
68 Ga0070706_100000778 3300005467 Bacteria 35677
69 Ga0070706_100004970 3300005467 Bacteria 12731
70 Ga0070706_100037627 3300005467 Bacteria 4468
71 Ga0070706_100085566 3300005467 Bacteria 2921
72 Ga0070706_100127766 3300005467 Bacteria 2371
73 Ga0070706_100129984 3300005467 Bacteria 2350
74 Ga0070707_100000076 3300005468 Bacteria 86928
75 Ga0070707_100000668 3300005468 Bacteria 34057
76 Ga0070707_100018342 3300005468 Bacteria 6585
77 Ga0070707_100133957 3300005468 Bacteria 2410
78 Ga0070698_100000050 3300005471 Bacteria 83255
79 Ga0070698_100075464 3300005471 Bacteria 3375
80 Ga0070698_100141963 3300005471 Bacteria 2352
81 Ga0070699_100013355 3300005518 Bacteria 7079
82 Ga0070699_100015540 3300005518 Bacteria 6542
83 Ga0070699_100054940 3300005518 Bacteria 3448
84 Ga0070679_100038232 3300005530 Bacteria 4771
85 Ga0070679_100045309 3300005530 Bacteria 4383
86 Ga0070684_100008222 3300005535 Bacteria 8152
87 Ga0070684_100016911 3300005535 Bacteria 5974
88 Ga0070684_100217884 3300005535 Bacteria 1741
89 Ga0070697_100000190 3300005536 Bacteria 50723
90 Ga0070697_100000488 3300005536 Bacteria 30188
91 Ga0070697_100001083 3300005536 Bacteria 20588
92 Ga0070697_100002086 3300005536 Bacteria 15297
93 Ga0070697_100005113 3300005536 Bacteria 10072
94 Ga0070697_100030510 3300005536 Bacteria 4331
95 Ga0068853_100006218 3300005539 Bacteria 9457
96 Ga0068853_100020631 3300005539 Bacteria 5479
97 Ga0070695_100032333 3300005545 Bacteria 3270
98 Ga0070693_100060866 3300005547 Bacteria 2193
99 Ga0070665_100014040 3300005548 Bacteria 8052
100 Ga0070704_100001930 3300005549 Bacteria 11459
101 Ga0068855_100004612 3300005563 Bacteria 16821
102 Ga0068855_100035941 3300005563 Bacteria 5899
103 Ga0068855_100055061 3300005563 Bacteria 4673
104 Ga0068855_100237659 3300005563 Bacteria 2037
105 Ga0070664_100004506 3300005564 Bacteria 11177
106 Ga0070664_100007626 3300005564 Bacteria 8738
107 Ga0070664_100087102 3300005564 Bacteria 2699
108 Ga0068857_100008164 3300005577 Bacteria 9041
109 Ga0068857_100020375 3300005577 Bacteria 5832
110 Ga0068854_100000855 3300005578 Bacteria 18216
111 Ga0068856_100000273 3300005614 Bacteria 56215
112 Ga0068856_100003303 3300005614 Bacteria 16391
113 Ga0068856_100003852 3300005614 Bacteria 15057
114 Ga0068856_100034032 3300005614 Bacteria 4991
115 Ga0068856_100044141 3300005614 Bacteria 4386
116 Ga0068856_100107955 3300005614 Bacteria 2779
117 Ga0068859_100001440 3300005617 Bacteria 24102
118 Ga0068859_100014905 3300005617 Bacteria 7804
119 Ga0068864_100005850 3300005618 Bacteria 10083
120 Ga0068864_100035495 3300005618 Bacteria 4245
121 Ga0068866_10036632 3300005718 Bacteria 2404
122 Ga0068861_100021800 3300005719 Bacteria 4607
123 Ga0068851_10004326 3300005834 Bacteria 6397
124 Ga0068870_10023132 3300005840 Bacteria 3062
125 Ga0068870_10023544 3300005840 Bacteria 3039
126 Ga0068863_100021011 3300005841 Bacteria 6235
127 Ga0068863_100054480 3300005841 Bacteria 3789
128 Ga0068863_100121739 3300005841 Bacteria 2488
129 Ga0068863_100186384 3300005841 Bacteria 1993
130 Ga0068858_100002929 3300005842 Bacteria 17176
131 Ga0068858_100028286 3300005842 Bacteria 5208
132 Ga0068858_100035303 3300005842 Bacteria 4638
133 Ga0068860_100028567 3300005843 Bacteria 5370
134 Ga0081538_10032628 3300005981 Bacteria 3484
135 Ga0070717_10000685 3300006028 Bacteria 21839
136 Ga0070717_10001418 3300006028 Bacteria 16527
137 Ga0070717_10001705 3300006028 Bacteria 15310
138 Ga0070717_10004143 3300006028 Bacteria 10453
139 Ga0070717_10004202 3300006028 Bacteria 10386
140 Ga0070717_10009012 3300006028 Bacteria 7487
141 Ga0070717_10024000 3300006028 Bacteria 4839
142 Ga0070717_10041308 3300006028 Bacteria 3760
143 Ga0070717_10045623 3300006028 Bacteria 3583
144 Ga0070717_10114287 3300006028 Bacteria 2306
145 Ga0070717_10116059 3300006028 Bacteria 2288
146 Ga0070717_10201670 3300006028 Bacteria 1743
147 Ga0070715_10001937 3300006163 Bacteria 6228
148 Ga0070715_10002389 3300006163 Bacteria 5749
149 Ga0070716_100011816 3300006173 Bacteria 4406
150 Ga0070712_100000422 3300006175 Bacteria 24266
151 Ga0070712_100001314 3300006175 Bacteria 15043
152 Ga0070712_100003292 3300006175 Bacteria 9939
153 Ga0070712_100029927 3300006175 Bacteria 3654
154 Ga0070712_100030032 3300006175 Bacteria 3649
155 Ga0097621_100006893 3300006237 Bacteria 8084
156 Ga0068871_100012488 3300006358 Bacteria 6266
157 Ga0075433_10001451 3300006852 Bacteria 17504
158 Ga0075433_10017759 3300006852 Bacteria 5902
159 Ga0075433_10040678 3300006852 Bacteria 4024
160 Ga0075434_100000216 3300006871 Bacteria 39542
161 Ga0075434_100001578 3300006871 Bacteria 19305
162 Ga0075434_100007444 3300006871 Bacteria 10125
163 Ga0075434_100010531 3300006871 Bacteria 8674
164 Ga0068865_100025592 3300006881 Bacteria 3884
165 Ga0068865_100049625 3300006881 Bacteria 2894
166 Ga0075436_100000879 3300006914 Bacteria 19927
167 Ga0075436_100007045 3300006914 Bacteria 7697
168 Ga0075436_100046908 3300006914 Bacteria 2980
169 Ga0075436_100101381 3300006914 Bacteria 2005
170 Ga0097620_100001440 3300006931 Bacteria 24102
171 Ga0097620_100014905 3300006931 Bacteria 7804
172 Ga0075435_100000186 3300007076 Bacteria 37017
173 Ga0075435_100003448 3300007076 Bacteria 10730
174 Ga0099794_10017134 3300007265 Bacteria 3225
175 Ga0099794_10062985 3300007265 Bacteria 1805
176 Ga0105240_10005869 3300009093 Bacteria 18195
177 Ga0105240_10008346 3300009093 Bacteria 14824
178 Ga0105240_10012547 3300009093 Bacteria 11691
179 Ga0105240_10018502 3300009093 Bacteria 9352
180 Ga0105240_10051256 3300009093 Bacteria 5196
181 Ga0105240_10084494 3300009093 Bacteria 3892
182 Ga0105240_10089880 3300009093 Bacteria 3755
183 Ga0105245_10055944 3300009098 Unclassified 3545
184 Ga0105247_10015250 3300009101 Bacteria 4606
185 Ga0105247_10023736 3300009101 Bacteria 3696
186 Ga0105241_10004842 3300009174 Bacteria 9927
187 Ga0105241_10008999 3300009174 Bacteria 7343
188 Ga0105241_10024456 3300009174 Bacteria 4485
189 Ga0105241_10141139 3300009174 Bacteria 1962
190 Ga0105242_10022632 3300009176 Bacteria 4946
191 Ga0105242_10069418 3300009176 Bacteria 2919
192 Ga0105237_10038811 3300009545 Bacteria 4809
193 Ga0105237_10240824 3300009545 Bacteria 1810
194 Ga0105238_10014816 3300009551 Bacteria 7887
195 Ga0105238_10061858 3300009551 Bacteria 3746
196 Ga0105238_10095344 3300009551 Bacteria 2963
197 Ga0105238_10211855 3300009551 Bacteria 1914
198 Ga0105249_10009226 3300009553 Bacteria 8629
199 Ga0105249_10023234 3300009553 Bacteria 5562
200 Ga0105239_10016968 3300010375 Bacteria 8048
201 Ga0105246_10001911 3300011119 Bacteria 12552
202 Ga0105246_10010773 3300011119 Bacteria 5668
203 Ga0105246_10023645 3300011119 Bacteria 3979
204 Ga0157373_10014776 3300013100 Bacteria 5718
205 Ga0157371_10046612 3300013102 Bacteria 3083
206 Ga0157370_10050330 3300013104 Bacteria 3982
207 Ga0157370_10054475 3300013104 Bacteria 3813
208 Ga0157370_10090798 3300013104 Bacteria 2868
209 Ga0157370_10176247 3300013104 Bacteria 1987
210 Ga0157369_10007673 3300013105 Bacteria 12415
211 Ga0157369_10009064 3300013105 Bacteria 11392
212 Ga0157369_10010773 3300013105 Bacteria 10410
213 Ga0157369_10078067 3300013105 Bacteria 3548
214 Ga0157374_10000340 3300013296 Bacteria 43245
215 Ga0157374_10003771 3300013296 Bacteria 12744
216 Ga0157374_10083159 3300013296 Bacteria 3041
217 Ga0157378_10000371 3300013297 Bacteria 44375
218 Ga0163162_10004988 3300013306 Bacteria 12791
219 Ga0163162_10011526 3300013306 Bacteria 8623
220 Ga0157372_10001024 3300013307 Bacteria 30552
221 Ga0157372_10006105 3300013307 Bacteria 12801
222 Ga0157372_10026720 3300013307 Bacteria 6282
223 Ga0157372_10027308 3300013307 Bacteria 6215
224 Ga0157375_10210337 3300013308 Bacteria 2102
225 Ga0163163_10008060 3300014325 Bacteria 9333
226 Ga0163163_10095001 3300014325 Bacteria 3000
227 Ga0157380_10102511 3300014326 Bacteria 2386
228 Ga0182008_10007117 3300014497 Bacteria 6196
229 Ga0157377_10005464 3300014745 Bacteria 5975
230 Ga0157379_10000265 3300014968 Bacteria 41177
231 Ga0157379_10022282 3300014968 Bacteria 5611
232 Ga0157379_10079521 3300014968 Bacteria 2936
233 Ga0157376_10002452 3300014969 Bacteria 12546
234 Ga0157376_10021417 3300014969 Bacteria 5020
235 Ga0182006_1038209 3300015261 Bacteria 1899
236 Ga0182007_10000188 3300015262 Bacteria 41467
237 Ga0213875_10032192 3300021388 Bacteria 2478
238 Ga0207697_10011682 3300025315 Bacteria 3707
239 Ga0207656_10025909 3300025321 Bacteria 2385
240 Ga0207692_10022960 3300025898 Bacteria 2879
241 Ga0207710_10024868 3300025900 Bacteria 2582
242 Ga0207688_10011992 3300025901 Bacteria 4717
243 Ga0207680_10009286 3300025903 Bacteria 4872
244 Ga0207647_10019091 3300025904 Bacteria 4617
245 Ga0207685_10000337 3300025905 Bacteria 7589
246 Ga0207685_10001150 3300025905 Bacteria 5295
247 Ga0207699_10003355 3300025906 Bacteria 7631
248 Ga0207699_10024235 3300025906 Bacteria 3315
249 Ga0207699_10047279 3300025906 Bacteria 2522
250 Ga0207699_10126259 3300025906 Bacteria 1661
251 Ga0207645_10012752 3300025907 Bacteria 5698
252 Ga0207643_10000172 3300025908 Bacteria 44395
253 Ga0207643_10027398 3300025908 Bacteria 3159
254 Ga0207705_10012888 3300025909 Bacteria 6036
255 Ga0207684_10000641 3300025910 Bacteria 41415
256 Ga0207684_10042712 3300025910 Bacteria 3844
257 Ga0207684_10076056 3300025910 Bacteria 2853
258 Ga0207684_10138371 3300025910 Bacteria 2092
259 Ga0207654_10031881 3300025911 Bacteria 2907
260 Ga0207707_10007765 3300025912 Bacteria 9337
261 Ga0207707_10017531 3300025912 Bacteria 6245
262 Ga0207707_10022888 3300025912 Bacteria 5465
263 Ga0207695_10001508 3300025913 Bacteria 38700
264 Ga0207695_10002608 3300025913 Bacteria 26414
265 Ga0207695_10008157 3300025913 Bacteria 13169
266 Ga0207695_10014641 3300025913 Bacteria 9276
267 Ga0207695_10116208 3300025913 Bacteria 2649
268 Ga0207671_10081717 3300025914 Bacteria 2424
269 Ga0207693_10000509 3300025915 Bacteria 35091
270 Ga0207693_10000977 3300025915 Bacteria 25718
271 Ga0207693_10001135 3300025915 Bacteria 23860
272 Ga0207693_10001584 3300025915 Bacteria 20129
273 Ga0207693_10045176 3300025915 Bacteria 3461
274 Ga0207693_10059705 3300025915 Bacteria 2987
275 Ga0207663_10000833 3300025916 Bacteria 13963
276 Ga0207663_10002444 3300025916 Bacteria 8931
277 Ga0207663_10005476 3300025916 Bacteria 6399
278 Ga0207663_10096949 3300025916 Bacteria 1971
279 Ga0207663_10134231 3300025916 Bacteria 1715
280 Ga0207660_10017098 3300025917 Bacteria 4812
281 Ga0207662_10006523 3300025918 Bacteria 6304
282 Ga0207657_10000511 3300025919 Bacteria 41041
283 Ga0207657_10003279 3300025919 Bacteria 17320
284 Ga0207657_10037727 3300025919 Bacteria 4311
285 Ga0207649_10000739 3300025920 Bacteria 21460
286 Ga0207652_10026056 3300025921 Bacteria 4867
287 Ga0207652_10032071 3300025921 Bacteria 4413
288 Ga0207652_10140153 3300025921 Bacteria 2162
289 Ga0207646_10000463 3300025922 Bacteria 54224
290 Ga0207646_10002220 3300025922 Bacteria 23118
291 Ga0207646_10002755 3300025922 Bacteria 20542
292 Ga0207681_10055077 3300025923 Bacteria 2707
293 Ga0207694_10017005 3300025924 Bacteria 5495
294 Ga0207650_10000059 3300025925 Bacteria 151427
295 Ga0207650_10029046 3300025925 Bacteria 3970
296 Ga0207687_10005122 3300025927 Bacteria 8689
297 Ga0207687_10015636 3300025927 Bacteria 4978
298 Ga0207700_10003358 3300025928 Bacteria 9289
299 Ga0207700_10011905 3300025928 Bacteria 5576
300 Ga0207700_10034800 3300025928 Bacteria 3620
301 Ga0207700_10079047 3300025928 Bacteria 2560
302 Ga0207664_10001715 3300025929 Bacteria 14448
303 Ga0207664_10077757 3300025929 Bacteria 2689
304 Ga0207664_10091985 3300025929 Bacteria 2489
305 Ga0207664_10107133 3300025929 Bacteria 2318
306 Ga0207664_10119243 3300025929 Bacteria 2206
307 Ga0207690_10051949 3300025932 Bacteria 2743
308 Ga0207706_10000130 3300025933 Bacteria 81196
309 Ga0207706_10038906 3300025933 Bacteria 4218
310 Ga0207706_10057594 3300025933 Bacteria 3423
311 Ga0207686_10074272 3300025934 Bacteria 2196
312 Ga0207670_10060716 3300025936 Bacteria 2577
313 Ga0207665_10001042 3300025939 Bacteria 18657
314 Ga0207665_10029707 3300025939 Bacteria 3612
315 Ga0207691_10022883 3300025940 Bacteria 5890
316 Ga0207711_10000861 3300025941 Bacteria 29357
317 Ga0207711_10006896 3300025941 Bacteria 9538
318 Ga0207689_10025199 3300025942 Bacteria 4986
319 Ga0207679_10000427 3300025945 Bacteria 29877
320 Ga0207679_10027184 3300025945 Bacteria 3954
321 Ga0207667_10004047 3300025949 Bacteria 18009
322 Ga0207667_10044278 3300025949 Bacteria 4717
323 Ga0207667_10174404 3300025949 Bacteria 2209
324 Ga0207712_10049776 3300025961 Bacteria 2922
325 Ga0207668_10099991 3300025972 Bacteria 2152
326 Ga0207677_10003872 3300026023 Bacteria 7971
327 Ga0207677_10018179 3300026023 Bacteria 4214
328 Ga0207703_10004766 3300026035 Bacteria 11061
329 Ga0207639_10050008 3300026041 Bacteria 3173
330 Ga0207678_10000169 3300026067 Bacteria 54815
331 Ga0207678_10014461 3300026067 Bacteria 6938
332 Ga0207702_10000796 3300026078 Bacteria 33448
333 Ga0207702_10009076 3300026078 Bacteria 8369
334 Ga0207702_10020580 3300026078 Bacteria 5462
335 Ga0207702_10048191 3300026078 Bacteria 3593
336 Ga0207702_10070744 3300026078 Bacteria 3001
337 Ga0207641_10000025 3300026088 Bacteria 247727
338 Ga0207641_10038024 3300026088 Bacteria 4023
339 Ga0207641_10043945 3300026088 Bacteria 3755
340 Ga0207641_10053447 3300026088 Bacteria 3424
341 Ga0207641_10104923 3300026088 Bacteria 2496
342 Ga0207641_10158124 3300026088 Bacteria 2058
343 Ga0207648_10000151 3300026089 Bacteria 69912
344 Ga0207648_10033089 3300026089 Bacteria 4561
345 Ga0207648_10038173 3300026089 Bacteria 4227
346 Ga0207648_10150359 3300026089 Bacteria 2054
347 Ga0207676_10000252 3300026095 Bacteria 46432
348 Ga0207676_10097967 3300026095 Bacteria 2423
349 Ga0207674_10000162 3300026116 Bacteria 79631
350 Ga0207674_10001344 3300026116 Bacteria 31814
351 Ga0207674_10075529 3300026116 Bacteria 3379
352 Ga0207675_100030890 3300026118 Bacteria 4989
353 Ga0207683_10000225 3300026121 Bacteria 49694
354 Ga0207683_10090183 3300026121 Bacteria 2729
355 Ga0207698_10038661 3300026142 Bacteria 3527
356 Ga0265356_1000868 3300028017 Bacteria 4960
357 Ga0268266_10020527 3300028379 Bacteria 5631
358 Ga0268265_10050030 3300028380 Bacteria 3147
359 Ga0268264_10009309 3300028381 Bacteria 8132
360 Ga0268264_10025658 3300028381 Bacteria 4814
361 Ga0268264_10036556 3300028381 Bacteria 4047
362 Ga0307517_10011680 3300028786 Bacteria 12151
363 Ga0265338_10007423 3300028800 Bacteria 13605
364 Ga0265338_10028722 3300028800 Bacteria 5539
365 Ga0307512_10012127 3300030522 Bacteria 8147
366 Ga0265760_10005433 3300031090 Bacteria 3655
367 Ga0265330_10023690 3300031235 Bacteria 2787
368 Ga0265316_10039529 3300031344 Bacteria 3788
369 Ga0265342_10047895 3300031712 Bacteria 2564
370 Ga0307416_100061144 3300032002 Bacteria 3072
371 Ga0373928_0009824 3300035084 Bacteria 1873
372 Ga0373936_0009866 3300035113 Bacteria 3604
373 Ga0373936_0018627 3300035113 Bacteria 2683
374 Ga0373953_0010075 3300035117 Bacteria 3276
375 Ga0373946_0002788 3300035171 Bacteria 6182
376 Ga0373955_0012350 3300035172 Bacteria 4105
377 Ga0373955_0012549 3300035172 Bacteria 4073
378 Ga0373931_0039276 3300035691 Bacteria 2480
379 Ga0373931_0053937 3300035691 Bacteria 2147
380 Ga0373931_0059942 3300035691 Bacteria 2048
381 Ga0373927_0000094 3300035695 Bacteria 66764
382 Ga0373937_0048972 3300036401 Bacteria 3869
383 Ga0373925_0000583 3300037068 Bacteria 35281
384 Ga0373925_0032455 3300037068 Bacteria 3844
385 Ga0373925_0062557 3300037068 Bacteria 2799
386 Ga0395905_0005868 3300037471 Bacteria 12470
387 Ga0395905_0012358 3300037471 Bacteria 8220
388 Ga0395905_0012753 3300037471 Bacteria 8084
389 Ga0395905_0109966 3300037471 Bacteria 2588
390 Ga0436364_0188179 3300037853 Bacteria 1745
391 Ga0436364_0360454 3300037853 Bacteria 27225
392 Ga0436364_1001807 3300037853 Bacteria 5235
393 Ga0436364_1552374 3300037853 Bacteria 9444
394 Ga0436365_0601983 3300039437 Bacteria 5901
395 Ga0436365_1014216 3300039437 Bacteria 4454
396 Ga0436365_1511156 3300039437 Bacteria 6565
397 Ga0436363_0240569 3300039450 Bacteria 4087
398 Ga0436363_0387480 3300039450 Bacteria 3859
399 Ga0436363_0533151 3300039450 Bacteria 2144
400 Ga0436363_1383917 3300039450 Bacteria 4385
401 Ga0466972_0008588 3300044658 Bacteria 5125
402 Ga0466972_0013962 3300044658 Bacteria 4029
403 Ga0453683_0015176 3300044673 Bacteria 4998
404 Ga0466964_0034039 3300044706 Bacteria 2032
405 Ga0451576_0028302 3300045051 Bacteria 6006
406 Ga0466958_0011257 3300045836 Bacteria 5036
407 Ga0495603_0045849 3300046455 Bacteria 2606
408 Ga0495580_0000162 3300046472 Bacteria 49248
409 Ga0495580_0000188 3300046472 Bacteria 46789
410 Ga0495580_0004889 3300046472 Bacteria 11203
411 Ga0495580_0018230 3300046472 Bacteria 5229
412 Ga0495580_0031357 3300046472 Bacteria 3841
413 Ga0495580_0063314 3300046472 Bacteria 2594
414 Ga0495664_0003452 3300046477 Bacteria 8601
415 Ga0495635_0060759 3300046663 Bacteria 2597
416 Ga0495674_0026827 3300047319 Bacteria 5268
417 Ga0495602_0025391 3300048088 Bacteria 5736
418 Ga0496102_0004651 3300048905 Bacteria 11620
419 Ga0496102_0103756 3300048905 Bacteria 2644
420 Ga0496103_0010566 3300048906 Bacteria 5466
421 Ga0496104_0018834 3300048907 Bacteria 6306
422 Ga0496104_0019386 3300048907 Bacteria 6222
423 Ga0496104_0101447 3300048907 Bacteria 2755
424 Ga0496106_0181494 3300048909 Bacteria 1671
425 Ga0496107_0113006 3300048910 Bacteria 1997
426 Ga0496108_0000210 3300048911 Bacteria 53448
427 Ga0496109_0000228 3300048912 Bacteria 54849
428 Ga0496109_0089340 3300048912 Bacteria 2848
429 Ga0496109_0108185 3300048912 Bacteria 2584
430 Ga0496110_0000145 3300048913 Bacteria 41800
431 Ga0496110_0012562 3300048913 Bacteria 6967
432 Ga0496111_0009110 3300048914 Bacteria 6607
433 Ga0496112_0000048 3300048915 Bacteria 84789
434 Ga0496112_0004487 3300048915 Bacteria 11841
435 Ga0496112_0019079 3300048915 Bacteria 6464
436 Ga0496112_0046808 3300048915 Bacteria 4243
437 Ga0496112_0061491 3300048915 Bacteria 3702
438 Ga0496113_0001549 3300048916 Bacteria 12890
439 Ga0496113_0108991 3300048916 Bacteria 2153
440 Ga0496115_0004990 3300048918 Bacteria 9636
441 Ga0501046_0058030 3300049580 Bacteria 3035
442 Ga0501046_0161198 3300049580 Bacteria 1687
443 Ga0501070_0135180 3300049586 Bacteria 2036
444 Ga0501076_0122816 3300049592 Bacteria 2103
445 Ga0501079_0053966 3300049741 Bacteria 3101
446 Ga0501044_0000495 3300049823 Bacteria 47801
447 Ga0501044_0001219 3300049823 Bacteria 30541
448 Ga0501044_0095688 3300049823 Bacteria 2992
449 nmdc:mga05p37_91458_c1 3300050507 Bacteria 3749
450 nmdc:mga0n895_16022_c1 3300050512 Bacteria 6865
451 nmdc:mga0n895_235_c1 3300050512 Bacteria 35123
452 nmdc:mga0n895_5251_c1 3300050512 Bacteria 10790
453 nmdc:mga0rr50_382_c1 3300050513 Bacteria 24211
454 nmdc:mga0rr50_3967_c1 3300050513 Bacteria 8613
455 nmdc:mga08x19_89377_c1 3300050514 Bacteria 2031
456 nmdc:mga08x19_9755_c1 3300050514 Bacteria 5752
457 nmdc:mga0a205_212_c1 3300050515 Bacteria 40921
458 nmdc:mga0a205_27359_c1 3300050515 Bacteria 5447
459 nmdc:mga0a205_41997_c1 3300050515 Bacteria 4406
460 Ga0500643_001041 3300053087 Bacteria 16872
461 Ga0466962_0026927 3300061719 Bacteria 2760
462 2547412987 2547132111 Bacteria 8013147
463 2554259131 2554235005 Bacteria 6457341
464 2585314324 2582581314 Bacteria 11452267
465 2644290661 2643221651 Bacteria 4798932
466 2808848184 2808606359 Bacteria 9866990
467 2856745816 2856741275 Bacteria 8096094
468 2912721863 2912715099 Bacteria 9460473
469 2912759322 2912757875 Bacteria 7940295
470 2947231285 2947224130 Bacteria 9938529
471 8025535554 8025530807 Bacteria 8495698
472 Ga0070699_100012931
473 JGI24752J21851_1003133
474 Ga0070658_10008172
475 Ga0070658_10062994
476 Ga0070676_10001792
477 Ga0070676_10007386
478 Ga0070683_100006666
479 Ga0070683_100020747
480 Ga0070670_100006813
481 Ga0070670_100019200
482 Ga0070666_10015834
483 Ga0070680_100010748
484 Ga0070680_100026631
485 Ga0070680_100130149
486 Ga0068868_100012055
487 Ga0068868_100149072
488 Ga0070689_100050517
489 Ga0070689_100055794
490 Ga0070687_100029801
491 Ga0070661_100002005
492 Ga0070668_100019291
493 Ga0070669_100097825
494 Ga0070675_100023044
495 Ga0070673_100013279
496 Ga0070688_100004903
497 Ga0070659_100007287
498 Ga0070659_100023178
499 Ga0070667_100003228
500 Ga0070667_100226009
501 Ga0070709_10002746
502 Ga0070709_10032354
503 Ga0070709_10103360
504 Ga0070714_100000781
505 Ga0070714_100026896
506 Ga0070714_100044629
507 Ga0070714_100191134
508 Ga0070713_100003699
509 Ga0070713_100004617
510 Ga0070713_100018501
511 Ga0070713_100042082
512 Ga0070713_100047267
513 Ga0070713_100100947
514 Ga0070710_10021671
515 Ga0070711_100000597
516 Ga0070711_100004279
517 Ga0070711_100112790
518 Ga0070694_100033574
519 Ga0070708_100000443
520 Ga0070708_100003046
521 Ga0070708_100008128
522 Ga0070708_100008510
523 Ga0070708_100010869
524 Ga0070708_100034542
525 Ga0070663_100004983
526 Ga0070678_100150857
527 Ga0070662_100002217
528 Ga0070662_100068313
529 Ga0070662_100122669
530 Ga0070681_10001215
531 Ga0070681_10027213
532 Ga0070681_10038176
533 Ga0070681_10093099
534 Ga0068867_100020670
535 Ga0068867_100075414
536 Ga0068867_100094773
537 Ga0068867_100117106
538 Ga0070685_10013968
539 Ga0070706_100000778
540 Ga0070706_100004970
541 Ga0070706_100037627
542 Ga0070706_100085566
543 Ga0070706_100127766
544 Ga0070706_100129984
545 Ga0070707_100000076
546 Ga0070707_100000668
547 Ga0070707_100018342
548 Ga0070707_100133957
549 Ga0070698_100000050
550 Ga0070698_100075464
551 Ga0070698_100141963
552 Ga0070699_100013355
553 Ga0070699_100015540
554 Ga0070699_100054940
555 Ga0070679_100038232
556 Ga0070679_100045309
557 Ga0070684_100008222
558 Ga0070684_100016911
559 Ga0070684_100217884
560 Ga0070697_100000190
561 Ga0070697_100000488
562 Ga0070697_100001083
563 Ga0070697_100002086
564 Ga0070697_100005113
565 Ga0070697_100030510
566 Ga0068853_100006218
567 Ga0068853_100020631
568 Ga0070695_100032333
569 Ga0070693_100060866
570 Ga0070665_100014040
571 Ga0070704_100001930
572 Ga0068855_100004612
573 Ga0068855_100035941
574 Ga0068855_100055061
575 Ga0068855_100237659
576 Ga0070664_100004506
577 Ga0070664_100007626
578 Ga0070664_100087102
579 Ga0068857_100008164
580 Ga0068857_100020375
581 Ga0068854_100000855
582 Ga0068856_100000273
583 Ga0068856_100003303
584 Ga0068856_100003852
585 Ga0068856_100034032
586 Ga0068856_100044141
587 Ga0068856_100107955
588 Ga0068859_100001440
589 Ga0068859_100014905
590 Ga0068864_100005850
591 Ga0068864_100035495
592 Ga0068866_10036632
593 Ga0068861_100021800
594 Ga0068851_10004326
595 Ga0068870_10023132
596 Ga0068870_10023544
597 Ga0068863_100021011
598 Ga0068863_100054480
599 Ga0068863_100121739
600 Ga0068863_100186384
601 Ga0068858_100002929
602 Ga0068858_100028286
603 Ga0068858_100035303
604 Ga0068860_100028567
605 Ga0081538_10032628
606 Ga0070717_10000685
607 Ga0070717_10001418
608 Ga0070717_10001705
609 Ga0070717_10004143
610 Ga0070717_10004202
611 Ga0070717_10009012
612 Ga0070717_10024000
613 Ga0070717_10041308
614 Ga0070717_10045623
615 Ga0070717_10114287
616 Ga0070717_10116059
617 Ga0070717_10201670
618 Ga0070715_10001937
619 Ga0070715_10002389
620 Ga0070716_100011816
621 Ga0070712_100000422
622 Ga0070712_100001314
623 Ga0070712_100003292
624 Ga0070712_100029927
625 Ga0070712_100030032
626 Ga0097621_100006893
627 Ga0068871_100012488
628 Ga0075433_10001451
629 Ga0075433_10017759
630 Ga0075433_10040678
631 Ga0075434_100000216
632 Ga0075434_100001578
633 Ga0075434_100007444
634 Ga0075434_100010531
635 Ga0068865_100025592
636 Ga0068865_100049625
637 Ga0075436_100000879
638 Ga0075436_100007045
639 Ga0075436_100046908
640 Ga0075436_100101381
641 Ga0097620_100001440
642 Ga0097620_100014905
643 Ga0075435_100000186
644 Ga0075435_100003448
645 Ga0099794_10017134
646 Ga0099794_10062985
647 Ga0105240_10005869
648 Ga0105240_10008346
649 Ga0105240_10012547
650 Ga0105240_10018502
651 Ga0105240_10051256
652 Ga0105240_10084494
653 Ga0105240_10089880
654 Ga0105245_10055944
655 Ga0105247_10015250
656 Ga0105247_10023736
657 Ga0105241_10004842
658 Ga0105241_10008999
659 Ga0105241_10024456
660 Ga0105241_10141139
661 Ga0105242_10022632
662 Ga0105242_10069418
663 Ga0105237_10038811
664 Ga0105237_10240824
665 Ga0105238_10014816
666 Ga0105238_10061858
667 Ga0105238_10095344
668 Ga0105238_10211855
669 Ga0105249_10009226
670 Ga0105249_10023234
671 Ga0105239_10016968
672 Ga0105246_10001911
673 Ga0105246_10010773
674 Ga0105246_10023645
675 Ga0157373_10014776
676 Ga0157371_10046612
677 Ga0157370_10050330
678 Ga0157370_10054475
679 Ga0157370_10090798
680 Ga0157370_10176247
681 Ga0157369_10007673
682 Ga0157369_10009064
683 Ga0157369_10010773
684 Ga0157369_10078067
685 Ga0157374_10000340
686 Ga0157374_10003771
687 Ga0157374_10083159
688 Ga0157378_10000371
689 Ga0163162_10004988
690 Ga0163162_10011526
691 Ga0157372_10001024
692 Ga0157372_10006105
693 Ga0157372_10026720
694 Ga0157372_10027308
695 Ga0157375_10210337
696 Ga0163163_10008060
697 Ga0163163_10095001
698 Ga0157380_10102511
699 Ga0182008_10007117
700 Ga0157377_10005464
701 Ga0157379_10000265
702 Ga0157379_10022282
703 Ga0157379_10079521
704 Ga0157376_10002452
705 Ga0157376_10021417
706 Ga0182006_1038209
707 Ga0182007_10000188
708 Ga0213875_10032192
709 Ga0207697_10011682
710 Ga0207656_10025909
711 Ga0207692_10022960
712 Ga0207710_10024868
713 Ga0207688_10011992
714 Ga0207680_10009286
715 Ga0207647_10019091
716 Ga0207685_10000337
717 Ga0207685_10001150
718 Ga0207699_10003355
719 Ga0207699_10024235
720 Ga0207699_10047279
721 Ga0207699_10126259
722 Ga0207645_10012752
723 Ga0207643_10000172
724 Ga0207643_10027398
725 Ga0207705_10012888
726 Ga0207684_10000641
727 Ga0207684_10042712
728 Ga0207684_10076056
729 Ga0207684_10138371
730 Ga0207654_10031881
731 Ga0207707_10007765
732 Ga0207707_10017531
733 Ga0207707_10022888
734 Ga0207695_10001508
735 Ga0207695_10002608
736 Ga0207695_10008157
737 Ga0207695_10014641
738 Ga0207695_10116208
739 Ga0207671_10081717
740 Ga0207693_10000509
741 Ga0207693_10000977
742 Ga0207693_10001135
743 Ga0207693_10001584
744 Ga0207693_10045176
745 Ga0207693_10059705
746 Ga0207663_10000833
747 Ga0207663_10002444
748 Ga0207663_10005476
749 Ga0207663_10096949
750 Ga0207663_10134231
751 Ga0207660_10017098
752 Ga0207662_10006523
753 Ga0207657_10000511
754 Ga0207657_10003279
755 Ga0207657_10037727
756 Ga0207649_10000739
757 Ga0207652_10026056
758 Ga0207652_10032071
759 Ga0207652_10140153
760 Ga0207646_10000463
761 Ga0207646_10002220
762 Ga0207646_10002755
763 Ga0207681_10055077
764 Ga0207694_10017005
765 Ga0207650_10000059
766 Ga0207650_10029046
767 Ga0207687_10005122
768 Ga0207687_10015636
769 Ga0207700_10003358
770 Ga0207700_10011905
771 Ga0207700_10034800
772 Ga0207700_10079047
773 Ga0207664_10001715
774 Ga0207664_10077757
775 Ga0207664_10091985
776 Ga0207664_10107133
777 Ga0207664_10119243
778 Ga0207690_10051949
779 Ga0207706_10000130
780 Ga0207706_10038906
781 Ga0207706_10057594
782 Ga0207686_10074272
783 Ga0207670_10060716
784 Ga0207665_10001042
785 Ga0207665_10029707
786 Ga0207691_10022883
787 Ga0207711_10000861
788 Ga0207711_10006896
789 Ga0207689_10025199
790 Ga0207679_10000427
791 Ga0207679_10027184
792 Ga0207667_10004047
793 Ga0207667_10044278
794 Ga0207667_10174404
795 Ga0207712_10049776
796 Ga0207668_10099991
797 Ga0207677_10003872
798 Ga0207677_10018179
799 Ga0207703_10004766
800 Ga0207639_10050008
801 Ga0207678_10000169
802 Ga0207678_10014461
803 Ga0207702_10000796
804 Ga0207702_10009076
805 Ga0207702_10020580
806 Ga0207702_10048191
807 Ga0207702_10070744
808 Ga0207641_10000025
809 Ga0207641_10038024
810 Ga0207641_10043945
811 Ga0207641_10053447
812 Ga0207641_10104923
813 Ga0207641_10158124
814 Ga0207648_10000151
815 Ga0207648_10033089
816 Ga0207648_10038173
817 Ga0207648_10150359
818 Ga0207676_10000252
819 Ga0207676_10097967
820 Ga0207674_10000162
821 Ga0207674_10001344
822 Ga0207674_10075529
823 Ga0207675_100030890
824 Ga0207683_10000225
825 Ga0207683_10090183
826 Ga0207698_10038661
827 Ga0265356_1000868
828 Ga0268266_10020527
829 Ga0268265_10050030
830 Ga0268264_10009309
831 Ga0268264_10025658
832 Ga0268264_10036556
833 Ga0307517_10011680
834 Ga0265338_10007423
835 Ga0265338_10028722
836 Ga0307512_10012127
837 Ga0265760_10005433
838 Ga0265330_10023690
839 Ga0265316_10039529
840 Ga0265342_10047895
841 Ga0307416_100061144
842 Ga0373928_0009824
843 Ga0373936_0009866
844 Ga0373936_0018627
845 Ga0373953_0010075
846 Ga0373946_0002788
847 Ga0373955_0012350
848 Ga0373955_0012549
849 Ga0373931_0039276
850 Ga0373931_0053937
851 Ga0373931_0059942
852 Ga0373927_0000094
853 Ga0373937_0048972
854 Ga0373925_0000583
855 Ga0373925_0032455
856 Ga0373925_0062557
857 Ga0395905_0005868
858 Ga0395905_0012358
859 Ga0395905_0012753
860 Ga0395905_0109966
861 Ga0436364_0188179
862 Ga0436364_0360454
863 Ga0436364_1001807
864 Ga0436364_1552374
865 Ga0436365_0601983
866 Ga0436365_1014216
867 Ga0436365_1511156
868 Ga0436363_0240569
869 Ga0436363_0387480
870 Ga0436363_0533151
871 Ga0436363_1383917
872 Ga0466972_0008588
873 Ga0466972_0013962
874 Ga0453683_0015176
875 Ga0466964_0034039
876 Ga0451576_0028302
877 Ga0466958_0011257
878 Ga0495603_0045849
879 Ga0495580_0000162
880 Ga0495580_0000188
881 Ga0495580_0004889
882 Ga0495580_0018230
883 Ga0495580_0031357
884 Ga0495580_0063314
885 Ga0495664_0003452
886 Ga0495635_0060759
887 Ga0495674_0026827
888 Ga0495602_0025391
889 Ga0496102_0004651
890 Ga0496102_0103756
891 Ga0496103_0010566
892 Ga0496104_0018834
893 Ga0496104_0019386
894 Ga0496104_0101447
895 Ga0496106_0181494
896 Ga0496107_0113006
897 Ga0496108_0000210
898 Ga0496109_0000228
899 Ga0496109_0089340
900 Ga0496109_0108185
901 Ga0496110_0000145
902 Ga0496110_0012562
903 Ga0496111_0009110
904 Ga0496112_0000048
905 Ga0496112_0004487
906 Ga0496112_0019079
907 Ga0496112_0046808
908 Ga0496112_0061491
909 Ga0496113_0001549
910 Ga0496113_0108991
911 Ga0496115_0004990
912 Ga0501046_0058030
913 Ga0501046_0161198
914 Ga0501070_0135180
915 Ga0501076_0122816
916 Ga0501079_0053966
917 Ga0501044_0000495
918 Ga0501044_0001219
919 Ga0501044_0095688
920 nmdc:mga05p37_91458_c1
921 nmdc:mga0n895_16022_c1
922 nmdc:mga0n895_235_c1
923 nmdc:mga0n895_5251_c1
924 nmdc:mga0rr50_382_c1
925 nmdc:mga0rr50_3967_c1
926 nmdc:mga08x19_89377_c1
927 nmdc:mga08x19_9755_c1
928 nmdc:mga0a205_212_c1
929 nmdc:mga0a205_27359_c1
930 nmdc:mga0a205_41997_c1
931 Ga0500643_001041
932 Ga0466962_0026927
933 2547412987
934 2554259131
935 2585314324
936 2644290661
937 2808848184
938 2856745816
939 2912721863
940 2912759322
941 2947231285
942 8025535554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

261

559

0.98

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

79

259

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e77-assembly1.cif.gz_A complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides with substrate 0.9483 17 510
1h93-assembly1.cif.gz_A active mutant (s215->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.9473 18 510
7snh-assembly1.cif.gz_D structure of g6pd-d200n tetramer bound to nadp+ 0.9463 19 510
1e7m-assembly1.cif.gz_A active site mutant (d177->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.9461 18 510
1dpg-assembly1.cif.gz_B glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.9427 17 510
ID Description Score Start End Superfamily
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9765 26 199 3.40.50.720
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9656 26 199 3.40.50.720
af_Q2FY66_6_179_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 19 196 3.40.50.720
af_P9WN73_204_512_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 197 509 3.40.50.720
af_Q2FY66_180_491_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9573 197 510 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A2V9L8L6-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9947 235 366 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-X1A683-F1-model_v4 Glucose-6-phosphate dehydrogenase C-terminal domain-containing protein 0.985 235 509 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A0L8NUJ8-F1-model_v4 deleted 0.9801 236 379
AF-A0A7I0BZY7-F1-model_v4 deleted 0.9784 271 365
AF-A0A3M3WFC8-F1-model_v4 Glucose-6-phosphate 1-dehydrogenase 0.9775 129 511 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Map