F450620

General Info

Members Datasets Scaffolds Average Seq Length
471 247 945 246

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10051771|Ga0265328_100517712
Length 284
Sequence MSSTKQNKPSQPTGRQTGPQTGRLLLIPNTLDFGCLDDSTGEAAPDLRDVLPMGAITAAASLTHWIAENAKTTRAFLKRVGEISPLRAPLQEQDIQVLPRPNKGGNKGTSKRPDPQEDRQITDLLAPALAGHDVGLISEAGLPGVADPGAAVVLAAHKAGVPVLPLSGPSSLVLALAASGLHGQSFAFVGYLPVEAQERAQRIKDLEQTSRKAHQTQLVIETPYRNTALWQALLQHLQGNTLLSVSCGLTLPQGWSRTDTVERWRKLPVTLPDDIPTVFSWLAA

Samples

Sample ID Description Type Environment
1 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
133 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
141 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
174 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
175 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
176 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
177 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
178 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
179 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
220 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
221 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
231 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
236 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
237 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
238 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
239 2643221585 Pelomonas sp. Root662 Isolate Unclassified
240 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
241 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
242 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
243 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
244 2643221656 Pelomonas sp. Root405 Isolate Unclassified
245 2738541337 Pelomonas sp. BT06 Isolate Unclassified
246 2831864461 Roseateles noduli HZ7 Isolate Nodule
247 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0
Isolates 2.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.9
Nodule 1.06
Rhizoplane 1.49
Rhizosphere 67.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265328_10051771 3300031239 Bacteria 1508
2 rootH1_10008969 3300003316 Bacteria 8211
3 rootH1_10008969 3300003323 Bacteria 2355
4 rootH1_10016292 3300003316 Bacteria 16501
5 rootH1_10016292 3300003323 Bacteria 2576
6 rootL2_10004981 3300003322 Bacteria 32520
7 rootL2_10027282 3300003322 Bacteria 16821
8 rootL2_10031835 3300003322 Bacteria 1338
9 rootH1_10022507 3300003316 Bacteria 2279
10 rootH1_10022507 3300003323 Bacteria 4965
11 rootH1_10030030 3300003323 Bacteria 1758
12 rootH1_10046719 3300003323 Bacteria 1205
13 Ga0055525_1000004 3300003759 Bacteria 888039
14 Ga0055524_1000121 3300003775 Bacteria 91150
15 Ga0055524_1001224 3300003775 Bacteria 15168
16 Ga0055524_1002725 3300003775 Bacteria 8921
17 Ga0055530_10003903 3300003791 Bacteria 8125
18 Ga0055530_10035106 3300003791 Bacteria 1275
19 Ga0055540_1000001 3300003792 Bacteria 466834
20 Ga0055531_10000007 3300003794 Bacteria 225289
21 Ga0055531_10001660 3300003794 Bacteria 16067
22 Ga0055531_10005441 3300003794 Bacteria 7454
23 Ga0055531_10007705 3300003794 Bacteria 5816
24 Ga0055543_1002116 3300004625 Bacteria 6880
25 Ga0065165_1000016 3300005262 Bacteria 286248
26 Ga0070658_10149037 3300005327 Bacteria 1957
27 Ga0070658_10228879 3300005327 Bacteria 1574
28 Ga0070658_10261865 3300005327 Bacteria 1469
29 Ga0070676_10003277 3300005328 Bacteria 8410
30 Ga0070676_10267371 3300005328 Bacteria 1147
31 Ga0070683_100087166 3300005329 Bacteria 2927
32 Ga0070690_100018361 3300005330 Bacteria 4223
33 Ga0070670_100011243 3300005331 Bacteria 7651
34 Ga0070670_100124087 3300005331 Bacteria 2228
35 Ga0070670_100484384 3300005331 Bacteria 1099
36 Ga0070677_10012600 3300005333 Bacteria 2939
37 Ga0070677_10063304 3300005333 Bacteria 1533
38 Ga0068869_100014800 3300005334 Bacteria 5218
39 Ga0068869_100032980 3300005334 Bacteria 3653
40 Ga0068869_100306482 3300005334 Bacteria 1284
41 Ga0070666_10035660 3300005335 Bacteria 3299
42 Ga0070682_100043043 3300005337 Bacteria 2791
43 Ga0068868_100065876 3300005338 Bacteria 2878
44 Ga0068868_100131718 3300005338 Bacteria 2046
45 Ga0070660_100240931 3300005339 Bacteria 1473
46 Ga0070661_100003258 3300005344 Bacteria 11197
47 Ga0070661_100261733 3300005344 Bacteria 1337
48 Ga0070668_100002286 3300005347 Bacteria 14134
49 Ga0070669_100001842 3300005353 Bacteria 15288
50 Ga0070675_100011141 3300005354 Bacteria 7035
51 Ga0070675_100038928 3300005354 Bacteria 3878
52 Ga0070675_100041985 3300005354 Bacteria 3736
53 Ga0070671_100019170 3300005355 Bacteria 5565
54 Ga0070671_100053922 3300005355 Bacteria 3342
55 Ga0070671_100139210 3300005355 Bacteria 2047
56 Ga0070674_100022459 3300005356 Bacteria 4070
57 Ga0070674_100086152 3300005356 Bacteria 2256
58 Ga0070673_100023530 3300005364 Bacteria 4501
59 Ga0070673_100153569 3300005364 Bacteria 1952
60 Ga0070673_100462496 3300005364 Bacteria 1143
61 Ga0070659_100044882 3300005366 Bacteria 3462
62 Ga0070659_100081375 3300005366 Bacteria 2586
63 Ga0070667_100000606 3300005367 Bacteria 34995
64 Ga0070667_100011188 3300005367 Bacteria 7423
65 Ga0070667_100196641 3300005367 Bacteria 1788
66 Ga0070703_10074125 3300005406 Bacteria 1143
67 Ga0070701_10094831 3300005438 Bacteria 1642
68 Ga0070700_100035802 3300005441 Bacteria 3006
69 Ga0070663_100000279 3300005455 Bacteria 25824
70 Ga0070663_100102106 3300005455 Bacteria 2142
71 Ga0070678_100057896 3300005456 Bacteria 2842
72 Ga0070678_100102688 3300005456 Bacteria 2219
73 Ga0070678_100159388 3300005456 Bacteria 1826
74 Ga0070662_100006467 3300005457 Bacteria 7555
75 Ga0070662_100034953 3300005457 Bacteria 3546
76 Ga0070662_100072639 3300005457 Bacteria 2540
77 Ga0068867_100000453 3300005459 Bacteria 27171
78 Ga0068867_100024108 3300005459 Bacteria 4360
79 Ga0068867_100036925 3300005459 Bacteria 3549
80 Ga0068867_100071565 3300005459 Bacteria 2594
81 Ga0068867_100084974 3300005459 Bacteria 2392
82 Ga0068867_100329259 3300005459 Bacteria 1268
83 Ga0068853_100733400 3300005539 Bacteria 944
84 Ga0070672_100001113 3300005543 Bacteria 16417
85 Ga0070672_100127278 3300005543 Bacteria 2090
86 Ga0070672_100134731 3300005543 Bacteria 2033
87 Ga0070672_100182061 3300005543 Bacteria 1751
88 Ga0070665_100365619 3300005548 Bacteria 1449
89 Ga0070665_100820516 3300005548 Bacteria 943
90 Ga0070664_100011508 3300005564 Bacteria 7181
91 Ga0070664_100070590 3300005564 Bacteria 2991
92 Ga0070664_100093819 3300005564 Bacteria 2601
93 Ga0070664_100182097 3300005564 Bacteria 1868
94 Ga0068852_100089152 3300005616 Bacteria 2756
95 Ga0068852_100146984 3300005616 Bacteria 2187
96 Ga0068852_100168080 3300005616 Bacteria 2053
97 Ga0068852_100305184 3300005616 Bacteria 1542
98 Ga0068852_100311791 3300005616 Bacteria 1526
99 Ga0068859_100120373 3300005617 Bacteria 2692
100 Ga0068864_100043110 3300005618 Bacteria 3862
101 Ga0068864_100492106 3300005618 Bacteria 1179
102 Ga0068866_10007428 3300005718 Bacteria 4587
103 Ga0068861_100002727 3300005719 Bacteria 11570
104 Ga0068851_10038362 3300005834 Bacteria 2403
105 Ga0068863_100077248 3300005841 Bacteria 3151
106 Ga0068863_100217723 3300005841 Bacteria 1839
107 Ga0068863_100499973 3300005841 Bacteria 1197
108 Ga0068863_100569301 3300005841 Bacteria 1120
109 Ga0068863_100739928 3300005841 Bacteria 979
110 Ga0068858_100002700 3300005842 Bacteria 17882
111 Ga0068860_100013981 3300005843 Bacteria 7871
112 Ga0068860_100072591 3300005843 Bacteria 3271
113 Ga0068860_100202985 3300005843 Bacteria 1921
114 Ga0068860_100475643 3300005843 Bacteria 1245
115 Ga0068862_100020926 3300005844 Bacteria 5465
116 Ga0075365_10042934 3300006038 Bacteria 2958
117 Ga0075365_10160366 3300006038 Bacteria 1567
118 Ga0075363_100302442 3300006048 Bacteria 928
119 Ga0075364_10110554 3300006051 Bacteria 1833
120 Ga0075362_10004098 3300006177 Bacteria 5195
121 Ga0075367_10024677 3300006178 Bacteria 3392
122 Ga0075366_10000139 3300006195 Bacteria 30628
123 Ga0075366_10003609 3300006195 Bacteria 8197
124 Ga0075366_10012833 3300006195 Bacteria 4762
125 Ga0075366_10018328 3300006195 Bacteria 4040
126 Ga0075366_10025054 3300006195 Bacteria 3481
127 Ga0075366_10037401 3300006195 Bacteria 2865
128 Ga0075366_10059196 3300006195 Bacteria 2275
129 Ga0075366_10075464 3300006195 Bacteria 2011
130 Ga0075366_10096570 3300006195 Bacteria 1772
131 Ga0075366_10099467 3300006195 Bacteria 1745
132 Ga0075366_10108887 3300006195 Bacteria 1666
133 Ga0075366_10206744 3300006195 Bacteria 1194
134 Ga0097621_100028612 3300006237 Bacteria 4393
135 Ga0097621_100178743 3300006237 Bacteria 1833
136 Ga0075370_10000112 3300006353 Bacteria 26323
137 Ga0075370_10001015 3300006353 Bacteria 11639
138 Ga0075370_10002597 3300006353 Bacteria 8417
139 Ga0075370_10007451 3300006353 Bacteria 5575
140 Ga0075370_10010483 3300006353 Bacteria 4845
141 Ga0075370_10027391 3300006353 Bacteria 3161
142 Ga0075370_10160836 3300006353 Bacteria 1318
143 Ga0068871_100017832 3300006358 Bacteria 5382
144 Ga0068871_100593520 3300006358 Bacteria 1007
145 Ga0075429_100031123 3300006880 Bacteria 4638
146 Ga0068865_100024100 3300006881 Bacteria 3989
147 Ga0097620_100120372 3300006931 Bacteria 2692
148 Ga0099823_1000021 3300006944 Bacteria 76133
149 Ga0079104_1000001 3300006946 Bacteria 521847
150 Ga0105245_10136994 3300009098 Bacteria 2302
151 Ga0105245_10167971 3300009098 Bacteria 2087
152 Ga0114129_10393015 3300009147 Bacteria 1829
153 Ga0105243_10002357 3300009148 Bacteria 15813
154 Ga0105243_10047607 3300009148 Bacteria 3377
155 Ga0105243_10140379 3300009148 Bacteria 2061
156 Ga0105248_10142373 3300009177 Bacteria 2705
157 Ga0105248_10636553 3300009177 Bacteria 1203
158 Ga0105237_10366241 3300009545 Bacteria 1446
159 Ga0105249_10015103 3300009553 Bacteria 6831
160 Ga0157319_1000027 3300012497 Bacteria 62955
161 Ga0157371_10125634 3300013102 Bacteria 1824
162 Ga0157374_10310651 3300013296 Bacteria 1561
163 Ga0157378_10059538 3300013297 Bacteria 3408
164 Ga0157378_10380191 3300013297 Bacteria 1386
165 Ga0163162_10004605 3300013306 Bacteria 13287
166 Ga0157375_10027080 3300013308 Bacteria 5354
167 Ga0157375_10316436 3300013308 Bacteria 1725
168 Ga0157375_10445752 3300013308 Bacteria 1460
169 Ga0163163_10398357 3300014325 Bacteria 1435
170 Ga0157380_10014744 3300014326 Bacteria 5723
171 Ga0157380_10235372 3300014326 Bacteria 1648
172 Ga0157377_10000088 3300014745 Bacteria 67719
173 Ga0157379_10027881 3300014968 Bacteria 5026
174 Ga0157379_10036220 3300014968 Bacteria 4400
175 Ga0157379_10724633 3300014968 Bacteria 935
176 Ga0157376_10036236 3300014969 Bacteria 3996
177 Ga0157376_10282507 3300014969 Bacteria 1564
178 Ga0163161_10015904 3300017792 Bacteria 5250
179 Ga0213872_10000469 3300021361 Bacteria 32732
180 Ga0213872_10000528 3300021361 Bacteria 29926
181 Ga0213872_10000566 3300021361 Bacteria 28609
182 Ga0213872_10007772 3300021361 Bacteria 5241
183 Ga0209563_100013 3300025230 Bacteria 941463
184 Ga0209673_1007134 3300025273 Bacteria 5229
185 Ga0209675_1014267 3300025291 Bacteria 2428
186 Ga0209564_1000008 3300025295 Bacteria 953227
187 Ga0209050_1000934 3300025298 Bacteria 38215
188 Ga0209050_1003281 3300025298 Bacteria 12153
189 Ga0209050_1006974 3300025298 Bacteria 6508
190 Ga0209050_1019785 3300025298 Bacteria 2539
191 Ga0209256_1000015 3300025299 Bacteria 622953
192 Ga0209256_1000424 3300025299 Bacteria 66333
193 Ga0209256_1002394 3300025299 Bacteria 15451
194 Ga0209051_1000018 3300025303 Bacteria 527061
195 Ga0209051_1000469 3300025303 Bacteria 52936
196 Ga0209051_1012745 3300025303 Bacteria 4048
197 Ga0209257_1000021 3300025304 Bacteria 771986
198 Ga0209257_1000084 3300025304 Bacteria 291502
199 Ga0209257_1000946 3300025304 Bacteria 40063
200 Ga0209257_1002583 3300025304 Bacteria 17605
201 Ga0207697_10025515 3300025315 Bacteria 2415
202 Ga0207653_10098379 3300025885 Bacteria 1032
203 Ga0207682_10013513 3300025893 Bacteria 3181
204 Ga0207682_10038145 3300025893 Bacteria 1948
205 Ga0207642_10262576 3300025899 Bacteria 985
206 Ga0207680_10087234 3300025903 Bacteria 1975
207 Ga0207645_10017617 3300025907 Bacteria 4710
208 Ga0207645_10026576 3300025907 Bacteria 3740
209 Ga0207645_10166071 3300025907 Bacteria 1445
210 Ga0207645_10300587 3300025907 Bacteria 1068
211 Ga0207705_10271026 3300025909 Bacteria 1298
212 Ga0207657_10165210 3300025919 Bacteria 1796
213 Ga0207649_10000359 3300025920 Bacteria 34180
214 Ga0207649_10211697 3300025920 Bacteria 1375
215 Ga0207681_10000583 3300025923 Bacteria 24864
216 Ga0207650_10006944 3300025925 Bacteria 7719
217 Ga0207650_10079182 3300025925 Bacteria 2488
218 Ga0207650_10085747 3300025925 Bacteria 2396
219 Ga0207650_10106220 3300025925 Bacteria 2168
220 Ga0207650_10177173 3300025925 Bacteria 1697
221 Ga0207650_10236880 3300025925 Bacteria 1474
222 Ga0207659_10028405 3300025926 Bacteria 3802
223 Ga0207659_10072048 3300025926 Bacteria 2525
224 Ga0207659_10125242 3300025926 Bacteria 1975
225 Ga0207659_10291351 3300025926 Bacteria 1338
226 Ga0207687_10111201 3300025927 Bacteria 2033
227 Ga0207644_10018232 3300025931 Bacteria 4746
228 Ga0207690_10029235 3300025932 Bacteria 3502
229 Ga0207690_10091803 3300025932 Bacteria 2147
230 Ga0207706_10002836 3300025933 Bacteria 16816
231 Ga0207706_10054660 3300025933 Bacteria 3523
232 Ga0207706_10181137 3300025933 Bacteria 1850
233 Ga0207709_10006590 3300025935 Bacteria 6519
234 Ga0207709_10009377 3300025935 Bacteria 5385
235 Ga0207709_10131369 3300025935 Bacteria 1707
236 Ga0207669_10009613 3300025937 Bacteria 4618
237 Ga0207669_10067243 3300025937 Bacteria 2232
238 Ga0207669_10143810 3300025937 Bacteria 1660
239 Ga0207704_10016917 3300025938 Bacteria 3764
240 Ga0207691_10010405 3300025940 Bacteria 8923
241 Ga0207691_10067263 3300025940 Bacteria 3240
242 Ga0207691_10099815 3300025940 Bacteria 2592
243 Ga0207691_10135842 3300025940 Bacteria 2169
244 Ga0207691_10467939 3300025940 Bacteria 1072
245 Ga0207711_10061435 3300025941 Bacteria 3240
246 Ga0207711_10175973 3300025941 Bacteria 1944
247 Ga0207689_10009785 3300025942 Bacteria 8259
248 Ga0207689_10172831 3300025942 Bacteria 1781
249 Ga0207689_10205665 3300025942 Bacteria 1626
250 Ga0207679_10000047 3300025945 Bacteria 119891
251 Ga0207679_10015999 3300025945 Bacteria 4972
252 Ga0207679_10367854 3300025945 Bacteria 1258
253 Ga0207651_10200900 3300025960 Bacteria 1597
254 Ga0207712_10024758 3300025961 Bacteria 3980
255 Ga0207658_10001932 3300025986 Bacteria 15466
256 Ga0207658_10006803 3300025986 Bacteria 7790
257 Ga0207658_10123966 3300025986 Bacteria 2065
258 Ga0207658_10135184 3300025986 Bacteria 1987
259 Ga0207677_10114896 3300026023 Bacteria 2012
260 Ga0207677_10227531 3300026023 Bacteria 1500
261 Ga0207703_10002118 3300026035 Bacteria 17481
262 Ga0207639_10256461 3300026041 Bacteria 1527
263 Ga0207678_10001700 3300026067 Bacteria 20180
264 Ga0207678_10061843 3300026067 Bacteria 3220
265 Ga0207708_10175956 3300026075 Bacteria 1697
266 Ga0207641_10023122 3300026088 Bacteria 5121
267 Ga0207641_10290693 3300026088 Bacteria 1540
268 Ga0207648_10000019 3300026089 Bacteria 144209
269 Ga0207648_10033979 3300026089 Bacteria 4497
270 Ga0207648_10062829 3300026089 Bacteria 3237
271 Ga0207648_10173131 3300026089 Bacteria 1909
272 Ga0207648_10185326 3300026089 Bacteria 1843
273 Ga0207648_10565482 3300026089 Bacteria 1046
274 Ga0207676_10033397 3300026095 Bacteria 3887
275 Ga0207676_10103062 3300026095 Bacteria 2370
276 Ga0207675_100019848 3300026118 Bacteria 6272
277 Ga0207683_10070584 3300026121 Bacteria 3086
278 Ga0207683_10156692 3300026121 Bacteria 2057
279 Ga0207683_10159500 3300026121 Bacteria 2038
280 Ga0207683_10162431 3300026121 Bacteria 2020
281 Ga0207683_10163287 3300026121 Bacteria 2015
282 Ga0207683_10268442 3300026121 Bacteria 1558
283 Ga0207698_10046132 3300026142 Bacteria 3288
284 Ga0207698_10115158 3300026142 Bacteria 2263
285 Ga0207698_10144617 3300026142 Bacteria 2054
286 Ga0207698_10183743 3300026142 Bacteria 1855
287 Ga0209281_1000151 3300027111 Bacteria 167268
288 Ga0209389_1000341 3300027296 Bacteria 28381
289 Ga0209371_1015531 3300027312 Bacteria 2041
290 Ga0209371_1015850 3300027312 Bacteria 2008
291 Ga0209974_10000696 3300027876 Bacteria 11455
292 Ga0268266_10303481 3300028379 Bacteria 1490
293 Ga0268265_10069594 3300028380 Bacteria 2733
294 Ga0268264_10001636 3300028381 Bacteria 20687
295 Ga0268264_10125012 3300028381 Bacteria 2272
296 Ga0268264_10287364 3300028381 Bacteria 1543
297 Ga0307517_10000174 3300028786 Bacteria 105578
298 Ga0307515_10002251 3300028794 Bacteria 42303
299 Ga0307515_10004349 3300028794 Bacteria 29393
300 Ga0307515_10006229 3300028794 Bacteria 23956
301 Ga0307515_10012576 3300028794 Bacteria 15908
302 Ga0307515_10021819 3300028794 Bacteria 11327
303 Ga0307515_10298155 3300028794 Bacteria 1300
304 Ga0268256_1013251 3300030500 Bacteria 2510
305 Ga0307512_10207865 3300030522 Bacteria 1046
306 Ga0265331_10001541 3300031250 Bacteria 16945
307 Ga0265327_10000012 3300031251 Bacteria 530403
308 Ga0265327_10001086 3300031251 Bacteria 37884
309 Ga0265316_10000430 3300031344 Bacteria 47823
310 Ga0307513_10032159 3300031456 Bacteria 5921
311 Ga0307513_10042494 3300031456 Bacteria 5004
312 Ga0307513_10120650 3300031456 Bacteria 2590
313 Ga0307513_10190586 3300031456 Bacteria 1903
314 Ga0307513_10314430 3300031456 Bacteria 1327
315 Ga0307509_10008466 3300031507 Bacteria 13101
316 Ga0307509_10012377 3300031507 Bacteria 10208
317 Ga0307509_10034866 3300031507 Bacteria 5527
318 Ga0307509_10130971 3300031507 Bacteria 2464
319 Ga0307408_100000040 3300031548 Bacteria 175456
320 Ga0307408_100258867 3300031548 Bacteria 1439
321 Ga0307408_100399262 3300031548 Bacteria 1180
322 Ga0307408_100638499 3300031548 Bacteria 950
323 Ga0307508_10000123 3300031616 Bacteria 92439
324 Ga0307508_10007419 3300031616 Bacteria 10211
325 Ga0307508_10016592 3300031616 Bacteria 6702
326 Ga0307508_10055154 3300031616 Bacteria 3521
327 Ga0307514_10081062 3300031649 Bacteria 2399
328 Ga0307516_10004481 3300031730 Bacteria 17197
329 Ga0307516_10029903 3300031730 Bacteria 5503
330 Ga0307516_10373260 3300031730 Bacteria 1089
331 Ga0307416_100072987 3300032002 Bacteria 2859
332 Ga0307414_10025061 3300032004 Bacteria 3813
333 Ga0307414_10554357 3300032004 Bacteria 1025
334 Ga0307411_10028175 3300032005 Bacteria 3411
335 Ga0307507_10073510 3300033179 Bacteria 3073
336 Ga0307507_10123500 3300033179 Bacteria 2060
337 Ga0307510_10064818 3300033180 Bacteria 3706
338 Ga0307510_10065087 3300033180 Bacteria 3696
339 Ga0373950_0004687 3300034818 Bacteria 2012
340 Ga0373959_0012860 3300034820 Bacteria 1501
341 Ga0373940_0003862 3300035088 Bacteria 3110
342 Ga0373939_0000020 3300035114 Bacteria 58845
343 Ga0373939_0040288 3300035114 Bacteria 1402
344 Ga0373939_0045924 3300035114 Bacteria 1335
345 Ga0373960_0001589 3300035121 Bacteria 5070
346 Ga0373943_0026299 3300035170 Bacteria 2726
347 Ga0373924_0006075 3300035410 Bacteria 4312
348 Ga0373931_0000293 3300035691 Bacteria 21036
349 Ga0373931_0028022 3300035691 Bacteria 2880
350 Ga0373927_0101872 3300035695 Bacteria 1868
351 Ga0373937_0604915 3300036401 Bacteria 1040
352 Ga0373925_0054353 3300037068 Bacteria 2995
353 Ga0373925_0229789 3300037068 Bacteria 1483
354 Ga0395905_0001227 3300037471 Bacteria 31961
355 Ga0395905_0002152 3300037471 Bacteria 22342
356 Ga0395905_0005995 3300037471 Bacteria 12311
357 Ga0395905_0013875 3300037471 Bacteria 7709
358 Ga0395905_0053998 3300037471 Bacteria 3760
359 Ga0395905_0418207 3300037471 Bacteria 1236
360 Ga0436365_0104771 3300039437 Bacteria 1371
361 Ga0436361_0162124 3300039447 Bacteria 22005
362 Ga0436361_0487065 3300039447 Bacteria 63556
363 Ga0436361_0587802 3300039447 Bacteria 5607
364 Ga0436361_1117053 3300039447 Bacteria 8349
365 Ga0451797_0780207 3300041453 Bacteria 763
366 Ga0451853_2928907 3300041512 Bacteria 1639
367 Ga0439431_0046161 3300041997 Bacteria 1120
368 Ga0450919_000263 3300042121 Bacteria 6073
369 Ga0450920_006884 3300042122 Bacteria 2050
370 Ga0450888_001195 3300042126 Bacteria 2479
371 Ga0450892_000133 3300042130 Bacteria 8508
372 Ga0450889_002052 3300042144 Bacteria 2019
373 Ga0439459_0000026 3300042438 Bacteria 12841
374 Ga0450918_002926 3300042531 Bacteria 3209
375 Ga0466969_0020472 3300044656 Bacteria 3425
376 Ga0466965_0060016 3300044683 Bacteria 1899
377 Ga0466966_0115382 3300044684 Bacteria 1653
378 Ga0466961_0046262 3300044693 Bacteria 2783
379 Ga0466963_0144364 3300044694 Bacteria 1650
380 Ga0466964_0000349 3300044706 Bacteria 13843
381 Ga0453684_0001396 3300044712 Bacteria 69884
382 Ga0453684_0456312 3300044712 Bacteria 1422
383 Ga0466971_0105877 3300044719 Bacteria 1295
384 Ga0466957_0053761 3300044842 Bacteria 2456
385 Ga0466957_0124894 3300044842 Bacteria 1643
386 Ga0466959_0000920 3300045049 Bacteria 17440
387 Ga0466959_0065265 3300045049 Bacteria 2641
388 Ga0451576_0045916 3300045051 Bacteria 4600
389 Ga0451576_0260827 3300045051 Bacteria 1811
390 Ga0466958_0000143 3300045836 Bacteria 24574
391 Ga0466967_0012414 3300045976 Bacteria 6513
392 Ga0495592_0147759 3300046454 Bacteria 1628
393 Ga0495590_0033701 3300046457 Bacteria 1790
394 Ga0495650_0001962 3300046471 Bacteria 18166
395 Ga0495610_0016022 3300046512 Bacteria 4333
396 Ga0495632_0008447 3300046519 Bacteria 6321
397 Ga0495632_0016713 3300046519 Bacteria 4071
398 Ga0495643_0016473 3300046522 Bacteria 4341
399 Ga0495643_0148673 3300046522 Bacteria 1162
400 Ga0495586_0127198 3300046535 Bacteria 1426
401 Ga0495622_0093585 3300046557 Bacteria 1380
402 Ga0495668_0079465 3300046616 Bacteria 1800
403 Ga0495625_0000929 3300046660 Bacteria 39380
404 Ga0495625_0010060 3300046660 Bacteria 7861
405 Ga0495635_0375328 3300046663 Bacteria 947
406 Ga0495647_0042250 3300046681 Bacteria 1740
407 Ga0495671_0310878 3300046692 Bacteria 757
408 Ga0495649_0019487 3300046694 Bacteria 3811
409 Ga0495600_0282282 3300046809 Bacteria 1051
410 Ga0495660_0016858 3300046810 Bacteria 4209
411 Ga0495687_000327 3300047443 Bacteria 61677
412 Ga0495687_000615 3300047443 Bacteria 41337
413 Ga0495687_000811 3300047443 Bacteria 33635
414 Ga0495686_0056504 3300047472 Bacteria 2452
415 Ga0495626_0024554 3300048091 Bacteria 2954
416 Ga0496100_0173439 3300048903 Bacteria 1555
417 Ga0496102_0002833 3300048905 Bacteria 14745
418 Ga0496109_0055399 3300048912 Bacteria 3618
419 Ga0496109_0157585 3300048912 Bacteria 2127
420 Ga0496110_0106737 3300048913 Bacteria 2513
421 Ga0496114_0023523 3300048917 Bacteria 5028
422 Ga0496124_0000596 3300048927 Bacteria 60853
423 Ga0496124_0008511 3300048927 Bacteria 10717
424 Ga0496125_0008584 3300048928 Bacteria 10671
425 Ga0501211_000441 3300049658 Bacteria 4006
426 Ga0501235_039124 3300049669 Bacteria 1082
427 Ga0501229_000532 3300049706 Bacteria 4318
428 nmdc:mga03683_7461_c1 3300050489 Bacteria 3797
429 nmdc:mga0k408_110229_c1 3300050493 Bacteria 1627
430 nmdc:mga0k408_1196_c1 3300050493 Bacteria 14189
431 nmdc:mga0k408_130826_c1 3300050493 Bacteria 1490
432 nmdc:mga0k408_23091_c1 3300050493 Bacteria 3506
433 nmdc:mga0k408_2867_c1 3300050493 Bacteria 9153
434 nmdc:mga0k408_308_c1 3300050493 Bacteria 26541
435 nmdc:mga0k408_3464_c2 3300050493 Bacteria 6291
436 nmdc:mga0k408_61620_c1 3300050493 Bacteria 1854
437 nmdc:mga0k408_6803_c1 3300050493 Bacteria 6097
438 nmdc:mga0k408_74649_c1 3300050493 Bacteria 1981
439 nmdc:mga06z11_1592_c1 3300050494 Bacteria 8460
440 nmdc:mga06z11_27602_c1 3300050494 Bacteria 2715
441 nmdc:mga04h51_20014_c1 3300050495 Bacteria 1992
442 nmdc:mga07m45_10651_c1 3300050496 Bacteria 4810
443 nmdc:mga07m45_124_c1 3300050496 Bacteria 30492
444 nmdc:mga07m45_131726_c1 3300050496 Bacteria 1447
445 nmdc:mga07m45_170_c1 3300050496 Bacteria 26138
446 nmdc:mga07m45_1972_c1 3300050496 Bacteria 9502
447 nmdc:mga07m45_205015_c1 3300050496 Bacteria 1147
448 nmdc:mga07m45_27852_c1 3300050496 Bacteria 3117
449 nmdc:mga07m45_62040_c1 3300050496 Bacteria 2118
450 nmdc:mga07m45_64179_c1 3300050496 Bacteria 1759
451 nmdc:mga07m45_72014_c1 3300050496 Bacteria 1967
452 nmdc:mga07m45_996_c1 3300050496 Bacteria 12505
453 nmdc:mga05p37_335284_c1 3300050507 Bacteria 1785
454 Ga0495601_0031491 3300053077 Bacteria 3297
455 Ga0495595_0155508 3300053084 Bacteria 1126
456 Ga0500644_0170817 3300053088 Bacteria 884
457 Ga0500593_014225 3300053117 Bacteria 3409
458 Ga0500658_0002462 3300053134 Bacteria 7159
459 Ga0500658_0030106 3300053134 Bacteria 2115
460 Ga0500568_0023945 3300053139 Bacteria 2590
461 Ga0500590_002719 3300053148 Bacteria 7962
462 Ga0500619_000016 3300053154 Bacteria 54289
463 Ga0500587_004355 3300053739 Bacteria 1946
464 2587759325 2585428062 Bacteria 6842168
465 2643744946 2643221544 Bacteria 5886209
466 2643937349 2643221585 Bacteria 5812563
467 2644222859 2643221639 Bacteria 6649903
468 2644246537 2643221644 Bacteria 6865017
469 2644260733 2643221646 Bacteria 6433402
470 2644302894 2643221654 Bacteria 5273570
471 2644318514 2643221656 Bacteria 5809961
472 2739058883 2738541337 Bacteria 6183410
473 2831869327 2831864461 Bacteria 6502356
474 2886851221 2886848708 Bacteria 5632523
475 Ga0265328_10051771
476 rootH1_10008969
477 rootH1_10016292
478 rootL2_10004981
479 rootL2_10027282
480 rootL2_10031835
481 rootH1_10022507
482 rootH1_10030030
483 rootH1_10046719
484 Ga0055525_1000004
485 Ga0055524_1000121
486 Ga0055524_1001224
487 Ga0055524_1002725
488 Ga0055530_10003903
489 Ga0055530_10035106
490 Ga0055540_1000001
491 Ga0055531_10000007
492 Ga0055531_10001660
493 Ga0055531_10005441
494 Ga0055531_10007705
495 Ga0055543_1002116
496 Ga0065165_1000016
497 Ga0070658_10149037
498 Ga0070658_10228879
499 Ga0070658_10261865
500 Ga0070676_10003277
501 Ga0070676_10267371
502 Ga0070683_100087166
503 Ga0070690_100018361
504 Ga0070670_100011243
505 Ga0070670_100124087
506 Ga0070670_100484384
507 Ga0070677_10012600
508 Ga0070677_10063304
509 Ga0068869_100014800
510 Ga0068869_100032980
511 Ga0068869_100306482
512 Ga0070666_10035660
513 Ga0070682_100043043
514 Ga0068868_100065876
515 Ga0068868_100131718
516 Ga0070660_100240931
517 Ga0070661_100003258
518 Ga0070661_100261733
519 Ga0070668_100002286
520 Ga0070669_100001842
521 Ga0070675_100011141
522 Ga0070675_100038928
523 Ga0070675_100041985
524 Ga0070671_100019170
525 Ga0070671_100053922
526 Ga0070671_100139210
527 Ga0070674_100022459
528 Ga0070674_100086152
529 Ga0070673_100023530
530 Ga0070673_100153569
531 Ga0070673_100462496
532 Ga0070659_100044882
533 Ga0070659_100081375
534 Ga0070667_100000606
535 Ga0070667_100011188
536 Ga0070667_100196641
537 Ga0070703_10074125
538 Ga0070701_10094831
539 Ga0070700_100035802
540 Ga0070663_100000279
541 Ga0070663_100102106
542 Ga0070678_100057896
543 Ga0070678_100102688
544 Ga0070678_100159388
545 Ga0070662_100006467
546 Ga0070662_100034953
547 Ga0070662_100072639
548 Ga0068867_100000453
549 Ga0068867_100024108
550 Ga0068867_100036925
551 Ga0068867_100071565
552 Ga0068867_100084974
553 Ga0068867_100329259
554 Ga0068853_100733400
555 Ga0070672_100001113
556 Ga0070672_100127278
557 Ga0070672_100134731
558 Ga0070672_100182061
559 Ga0070665_100365619
560 Ga0070665_100820516
561 Ga0070664_100011508
562 Ga0070664_100070590
563 Ga0070664_100093819
564 Ga0070664_100182097
565 Ga0068852_100089152
566 Ga0068852_100146984
567 Ga0068852_100168080
568 Ga0068852_100305184
569 Ga0068852_100311791
570 Ga0068859_100120373
571 Ga0068864_100043110
572 Ga0068864_100492106
573 Ga0068866_10007428
574 Ga0068861_100002727
575 Ga0068851_10038362
576 Ga0068863_100077248
577 Ga0068863_100217723
578 Ga0068863_100499973
579 Ga0068863_100569301
580 Ga0068863_100739928
581 Ga0068858_100002700
582 Ga0068860_100013981
583 Ga0068860_100072591
584 Ga0068860_100202985
585 Ga0068860_100475643
586 Ga0068862_100020926
587 Ga0075365_10042934
588 Ga0075365_10160366
589 Ga0075363_100302442
590 Ga0075364_10110554
591 Ga0075362_10004098
592 Ga0075367_10024677
593 Ga0075366_10000139
594 Ga0075366_10003609
595 Ga0075366_10012833
596 Ga0075366_10018328
597 Ga0075366_10025054
598 Ga0075366_10037401
599 Ga0075366_10059196
600 Ga0075366_10075464
601 Ga0075366_10096570
602 Ga0075366_10099467
603 Ga0075366_10108887
604 Ga0075366_10206744
605 Ga0097621_100028612
606 Ga0097621_100178743
607 Ga0075370_10000112
608 Ga0075370_10001015
609 Ga0075370_10002597
610 Ga0075370_10007451
611 Ga0075370_10010483
612 Ga0075370_10027391
613 Ga0075370_10160836
614 Ga0068871_100017832
615 Ga0068871_100593520
616 Ga0075429_100031123
617 Ga0068865_100024100
618 Ga0097620_100120372
619 Ga0099823_1000021
620 Ga0079104_1000001
621 Ga0105245_10136994
622 Ga0105245_10167971
623 Ga0114129_10393015
624 Ga0105243_10002357
625 Ga0105243_10047607
626 Ga0105243_10140379
627 Ga0105248_10142373
628 Ga0105248_10636553
629 Ga0105237_10366241
630 Ga0105249_10015103
631 Ga0157319_1000027
632 Ga0157371_10125634
633 Ga0157374_10310651
634 Ga0157378_10059538
635 Ga0157378_10380191
636 Ga0163162_10004605
637 Ga0157375_10027080
638 Ga0157375_10316436
639 Ga0157375_10445752
640 Ga0163163_10398357
641 Ga0157380_10014744
642 Ga0157380_10235372
643 Ga0157377_10000088
644 Ga0157379_10027881
645 Ga0157379_10036220
646 Ga0157379_10724633
647 Ga0157376_10036236
648 Ga0157376_10282507
649 Ga0163161_10015904
650 Ga0213872_10000469
651 Ga0213872_10000528
652 Ga0213872_10000566
653 Ga0213872_10007772
654 Ga0209563_100013
655 Ga0209673_1007134
656 Ga0209675_1014267
657 Ga0209564_1000008
658 Ga0209050_1000934
659 Ga0209050_1003281
660 Ga0209050_1006974
661 Ga0209050_1019785
662 Ga0209256_1000015
663 Ga0209256_1000424
664 Ga0209256_1002394
665 Ga0209051_1000018
666 Ga0209051_1000469
667 Ga0209051_1012745
668 Ga0209257_1000021
669 Ga0209257_1000084
670 Ga0209257_1000946
671 Ga0209257_1002583
672 Ga0207697_10025515
673 Ga0207653_10098379
674 Ga0207682_10013513
675 Ga0207682_10038145
676 Ga0207642_10262576
677 Ga0207680_10087234
678 Ga0207645_10017617
679 Ga0207645_10026576
680 Ga0207645_10166071
681 Ga0207645_10300587
682 Ga0207705_10271026
683 Ga0207657_10165210
684 Ga0207649_10000359
685 Ga0207649_10211697
686 Ga0207681_10000583
687 Ga0207650_10006944
688 Ga0207650_10079182
689 Ga0207650_10085747
690 Ga0207650_10106220
691 Ga0207650_10177173
692 Ga0207650_10236880
693 Ga0207659_10028405
694 Ga0207659_10072048
695 Ga0207659_10125242
696 Ga0207659_10291351
697 Ga0207687_10111201
698 Ga0207644_10018232
699 Ga0207690_10029235
700 Ga0207690_10091803
701 Ga0207706_10002836
702 Ga0207706_10054660
703 Ga0207706_10181137
704 Ga0207709_10006590
705 Ga0207709_10009377
706 Ga0207709_10131369
707 Ga0207669_10009613
708 Ga0207669_10067243
709 Ga0207669_10143810
710 Ga0207704_10016917
711 Ga0207691_10010405
712 Ga0207691_10067263
713 Ga0207691_10099815
714 Ga0207691_10135842
715 Ga0207691_10467939
716 Ga0207711_10061435
717 Ga0207711_10175973
718 Ga0207689_10009785
719 Ga0207689_10172831
720 Ga0207689_10205665
721 Ga0207679_10000047
722 Ga0207679_10015999
723 Ga0207679_10367854
724 Ga0207651_10200900
725 Ga0207712_10024758
726 Ga0207658_10001932
727 Ga0207658_10006803
728 Ga0207658_10123966
729 Ga0207658_10135184
730 Ga0207677_10114896
731 Ga0207677_10227531
732 Ga0207703_10002118
733 Ga0207639_10256461
734 Ga0207678_10001700
735 Ga0207678_10061843
736 Ga0207708_10175956
737 Ga0207641_10023122
738 Ga0207641_10290693
739 Ga0207648_10000019
740 Ga0207648_10033979
741 Ga0207648_10062829
742 Ga0207648_10173131
743 Ga0207648_10185326
744 Ga0207648_10565482
745 Ga0207676_10033397
746 Ga0207676_10103062
747 Ga0207675_100019848
748 Ga0207683_10070584
749 Ga0207683_10156692
750 Ga0207683_10159500
751 Ga0207683_10162431
752 Ga0207683_10163287
753 Ga0207683_10268442
754 Ga0207698_10046132
755 Ga0207698_10115158
756 Ga0207698_10144617
757 Ga0207698_10183743
758 Ga0209281_1000151
759 Ga0209389_1000341
760 Ga0209371_1015531
761 Ga0209371_1015850
762 Ga0209974_10000696
763 Ga0268266_10303481
764 Ga0268265_10069594
765 Ga0268264_10001636
766 Ga0268264_10125012
767 Ga0268264_10287364
768 Ga0307517_10000174
769 Ga0307515_10002251
770 Ga0307515_10004349
771 Ga0307515_10006229
772 Ga0307515_10012576
773 Ga0307515_10021819
774 Ga0307515_10298155
775 Ga0268256_1013251
776 Ga0307512_10207865
777 Ga0265331_10001541
778 Ga0265327_10000012
779 Ga0265327_10001086
780 Ga0265316_10000430
781 Ga0307513_10032159
782 Ga0307513_10042494
783 Ga0307513_10120650
784 Ga0307513_10190586
785 Ga0307513_10314430
786 Ga0307509_10008466
787 Ga0307509_10012377
788 Ga0307509_10034866
789 Ga0307509_10130971
790 Ga0307408_100000040
791 Ga0307408_100258867
792 Ga0307408_100399262
793 Ga0307408_100638499
794 Ga0307508_10000123
795 Ga0307508_10007419
796 Ga0307508_10016592
797 Ga0307508_10055154
798 Ga0307514_10081062
799 Ga0307516_10004481
800 Ga0307516_10029903
801 Ga0307516_10373260
802 Ga0307416_100072987
803 Ga0307414_10025061
804 Ga0307414_10554357
805 Ga0307411_10028175
806 Ga0307507_10073510
807 Ga0307507_10123500
808 Ga0307510_10064818
809 Ga0307510_10065087
810 Ga0373950_0004687
811 Ga0373959_0012860
812 Ga0373940_0003862
813 Ga0373939_0000020
814 Ga0373939_0040288
815 Ga0373939_0045924
816 Ga0373960_0001589
817 Ga0373943_0026299
818 Ga0373924_0006075
819 Ga0373931_0000293
820 Ga0373931_0028022
821 Ga0373927_0101872
822 Ga0373937_0604915
823 Ga0373925_0054353
824 Ga0373925_0229789
825 Ga0395905_0001227
826 Ga0395905_0002152
827 Ga0395905_0005995
828 Ga0395905_0013875
829 Ga0395905_0053998
830 Ga0395905_0418207
831 Ga0436365_0104771
832 Ga0436361_0162124
833 Ga0436361_0487065
834 Ga0436361_0587802
835 Ga0436361_1117053
836 Ga0451797_0780207
837 Ga0451853_2928907
838 Ga0439431_0046161
839 Ga0450919_000263
840 Ga0450920_006884
841 Ga0450888_001195
842 Ga0450892_000133
843 Ga0450889_002052
844 Ga0439459_0000026
845 Ga0450918_002926
846 Ga0466969_0020472
847 Ga0466965_0060016
848 Ga0466966_0115382
849 Ga0466961_0046262
850 Ga0466963_0144364
851 Ga0466964_0000349
852 Ga0453684_0001396
853 Ga0453684_0456312
854 Ga0466971_0105877
855 Ga0466957_0053761
856 Ga0466957_0124894
857 Ga0466959_0000920
858 Ga0466959_0065265
859 Ga0451576_0045916
860 Ga0451576_0260827
861 Ga0466958_0000143
862 Ga0466967_0012414
863 Ga0495592_0147759
864 Ga0495590_0033701
865 Ga0495650_0001962
866 Ga0495610_0016022
867 Ga0495632_0008447
868 Ga0495632_0016713
869 Ga0495643_0016473
870 Ga0495643_0148673
871 Ga0495586_0127198
872 Ga0495622_0093585
873 Ga0495668_0079465
874 Ga0495625_0000929
875 Ga0495625_0010060
876 Ga0495635_0375328
877 Ga0495647_0042250
878 Ga0495671_0310878
879 Ga0495649_0019487
880 Ga0495600_0282282
881 Ga0495660_0016858
882 Ga0495687_000327
883 Ga0495687_000615
884 Ga0495687_000811
885 Ga0495686_0056504
886 Ga0495626_0024554
887 Ga0496100_0173439
888 Ga0496102_0002833
889 Ga0496109_0055399
890 Ga0496109_0157585
891 Ga0496110_0106737
892 Ga0496114_0023523
893 Ga0496124_0000596
894 Ga0496124_0008511
895 Ga0496125_0008584
896 Ga0501211_000441
897 Ga0501235_039124
898 Ga0501229_000532
899 nmdc:mga03683_7461_c1
900 nmdc:mga0k408_110229_c1
901 nmdc:mga0k408_1196_c1
902 nmdc:mga0k408_130826_c1
903 nmdc:mga0k408_23091_c1
904 nmdc:mga0k408_2867_c1
905 nmdc:mga0k408_308_c1
906 nmdc:mga0k408_3464_c2
907 nmdc:mga0k408_61620_c1
908 nmdc:mga0k408_6803_c1
909 nmdc:mga0k408_74649_c1
910 nmdc:mga06z11_1592_c1
911 nmdc:mga06z11_27602_c1
912 nmdc:mga04h51_20014_c1
913 nmdc:mga07m45_10651_c1
914 nmdc:mga07m45_124_c1
915 nmdc:mga07m45_131726_c1
916 nmdc:mga07m45_170_c1
917 nmdc:mga07m45_1972_c1
918 nmdc:mga07m45_205015_c1
919 nmdc:mga07m45_27852_c1
920 nmdc:mga07m45_62040_c1
921 nmdc:mga07m45_64179_c1
922 nmdc:mga07m45_72014_c1
923 nmdc:mga07m45_996_c1
924 nmdc:mga05p37_335284_c1
925 Ga0495601_0031491
926 Ga0495595_0155508
927 Ga0500644_0170817
928 Ga0500593_014225
929 Ga0500658_0002462
930 Ga0500658_0030106
931 Ga0500568_0023945
932 Ga0500590_002719
933 Ga0500619_000016
934 Ga0500587_004355
935 2587759325
936 2643744946
937 2643937349
938 2644222859
939 2644246537
940 2644260733
941 2644302894
942 2644318514
943 2739058883
944 2831869327
945 2886851221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

74

261

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.8453 1 145
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.8384 1 145
3hh1-assembly1.cif.gz_B the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.767 3 146
3hh1-assembly1.cif.gz_B the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.7549 3 146
2ybq-assembly1.cif.gz_A-2 the x-ray structure of the sam-dependent uroporphyrinogen iii methyltransferase nire from pseudomonas aeruginosa in complex with sah and uroporphyrinogen iii 0.6861 2 146
ID Description Score Start End Superfamily
1wyzC01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8528 3 147 3.40.1010.10
1wyzC01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8455 3 147 3.40.1010.10
af_A0A0R4IGH3_135_264_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.767 176 214 3.40.630.30
af_P9WGW7_1_114_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.7424 1 145 3.40.1010.10
af_P9WGW7_1_114_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.7368 1 145 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A4Q3P893-F1-model_v4 deleted 0.9508 4 73
AF-A0A5C7P3D6-F1-model_v4 Ribosomal RNA small subunit methyltransferase I 0.8817 1 85 GO:0008168
GO:0032259
AF-A0A5C7P3D6-F1-model_v4 Ribosomal RNA small subunit methyltransferase I 0.8619 1 85 GO:0008168
GO:0032259
AF-A0A4Q3PYE0-F1-model_v4 deleted 0.8439 1 109
AF-A0A4Q3PYE0-F1-model_v4 deleted 0.8358 1 109

Map