F450673

General Info

Members Datasets Scaffolds Average Seq Length
471 237 942 153

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0304565|Ga0496123_0304565_130_702
Length 190
Sequence MTEGVGRAVEAVGWLMVASSHMHLYSATQAGVTPMPKLDLEAIEQSNRTGYPPPYDGPVQGRWWRRLAPAVGLTAMGASHVVLKPGAWSSQRHWHDDEDELVVMIAGEAVLIEGRDGEAPTRTLLRPGDICAWAGGDGIAHHIVNESEADCSFVAIGAGNMDGDGGYSDIDMVFKGSGYFRKDGTPYPKR

Samples

Sample ID Description Type Environment
1 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
205 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
206 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
207 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
208 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
223 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
224 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
225 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
230 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
234 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
235 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
236 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
237 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0.21
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.34
Nodule 0
Rhizoplane 3.4
Rhizosphere 82.59
Stem 0
Stem Tuber 0.21
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496123_0304565 3300048926 Bacteria 759
2 MBSR1b_contig_5698931 2162886012 Bacteria 833
3 JGI24735J21928_10005689 3300002067 Bacteria 4122
4 Ga0055536_1012034 3300003781 Bacteria 3249
5 Ga0055531_10041867 3300003794 Bacteria 1319
6 Ga0065712_10080286 3300005290 Bacteria 3124
7 Ga0065715_10096065 3300005293 Bacteria 3944
8 Ga0065715_10132912 3300005293 Bacteria 1981
9 Ga0065715_10728451 3300005293 Bacteria 640
10 Ga0070658_10078934 3300005327 Bacteria 2703
11 Ga0070658_10172369 3300005327 Bacteria 1818
12 Ga0070658_10230371 3300005327 Bacteria 1568
13 Ga0070676_10421165 3300005328 Bacteria 933
14 Ga0070683_100246546 3300005329 Bacteria 1699
15 Ga0070670_100000422 3300005331 Bacteria 34896
16 Ga0070670_100018786 3300005331 Bacteria 5926
17 Ga0070670_100108728 3300005331 Bacteria 2389
18 Ga0070670_100230975 3300005331 Bacteria 1610
19 Ga0070670_100420970 3300005331 Bacteria 1181
20 Ga0070677_10805906 3300005333 Unclassified 537
21 Ga0068869_100390669 3300005334 Bacteria 1142
22 Ga0070666_10000551 3300005335 Bacteria 22656
23 Ga0070666_10033801 3300005335 Bacteria 3386
24 Ga0070680_100617583 3300005336 Bacteria 931
25 Ga0070660_100112158 3300005339 Bacteria 2170
26 Ga0070660_100172113 3300005339 Bacteria 1749
27 Ga0070687_100887959 3300005343 Unclassified 638
28 Ga0070661_100014544 3300005344 Bacteria 5545
29 Ga0070668_100000019 3300005347 Bacteria 98356
30 Ga0070668_100015808 3300005347 Bacteria 5646
31 Ga0070668_100077275 3300005347 Bacteria 2602
32 Ga0070668_100238356 3300005347 Bacteria 1506
33 Ga0070668_100291457 3300005347 Bacteria 1366
34 Ga0070668_100560363 3300005347 Bacteria 995
35 Ga0070668_100603983 3300005347 Bacteria 960
36 Ga0070669_100001898 3300005353 Bacteria 15089
37 Ga0070669_100004351 3300005353 Bacteria 10225
38 Ga0070669_100006102 3300005353 Bacteria 8695
39 Ga0070669_100045601 3300005353 Bacteria 3195
40 Ga0070669_100831642 3300005353 Bacteria 786
41 Ga0070675_100000860 3300005354 Bacteria 21601
42 Ga0070675_100004653 3300005354 Bacteria 10479
43 Ga0070671_100005286 3300005355 Bacteria 10299
44 Ga0070671_100007974 3300005355 Bacteria 8472
45 Ga0070671_100129887 3300005355 Bacteria 2122
46 Ga0070671_100219133 3300005355 Bacteria 1614
47 Ga0070673_100055589 3300005364 Bacteria 3119
48 Ga0070673_100298787 3300005364 Bacteria 1417
49 Ga0070659_100276362 3300005366 Bacteria 1397
50 Ga0070667_100000094 3300005367 Bacteria 111140
51 Ga0070667_100001365 3300005367 Bacteria 21897
52 Ga0070667_100003455 3300005367 Bacteria 13460
53 Ga0070667_100008691 3300005367 Bacteria 8419
54 Ga0070667_100023674 3300005367 Bacteria 5098
55 Ga0070667_100669689 3300005367 Bacteria 959
56 Ga0070701_10177501 3300005438 Bacteria 1244
57 Ga0070705_101327372 3300005440 Bacteria 597
58 Ga0070700_101188980 3300005441 Bacteria 636
59 Ga0070663_100006460 3300005455 Bacteria 7055
60 Ga0070663_100258293 3300005455 Bacteria 1381
61 Ga0070663_100282319 3300005455 Bacteria 1323
62 Ga0070679_100183277 3300005530 Bacteria 2065
63 Ga0070679_100589754 3300005530 Bacteria 1055
64 Ga0068853_100061230 3300005539 Bacteria 3255
65 Ga0068853_101423240 3300005539 Bacteria 671
66 Ga0070672_100003490 3300005543 Bacteria 10188
67 Ga0070672_100009319 3300005543 Bacteria 6765
68 Ga0070672_100143943 3300005543 Bacteria 1968
69 Ga0070665_100000070 3300005548 Bacteria 200681
70 Ga0070665_100057068 3300005548 Bacteria 3915
71 Ga0070665_100117850 3300005548 Bacteria 2658
72 Ga0070665_100314879 3300005548 Bacteria 1569
73 Ga0070664_100001636 3300005564 Bacteria 17924
74 Ga0070664_100162885 3300005564 Bacteria 1974
75 Ga0068854_100281937 3300005578 Bacteria 1338
76 Ga0068856_100318788 3300005614 Bacteria 1572
77 Ga0068852_100190010 3300005616 Bacteria 1937
78 Ga0068852_100697471 3300005616 Unclassified 1025
79 Ga0068852_101889448 3300005616 Unclassified 619
80 Ga0068859_100004738 3300005617 Bacteria 13820
81 Ga0068864_100111147 3300005618 Bacteria 2441
82 Ga0068864_100476817 3300005618 Bacteria 1197
83 Ga0068864_100623705 3300005618 Bacteria 1048
84 Ga0068861_101063382 3300005719 Bacteria 776
85 Ga0068851_10472460 3300005834 Unclassified 748
86 Ga0068870_10045864 3300005840 Bacteria 2290
87 Ga0068863_100000057 3300005841 Bacteria 123606
88 Ga0068863_100014090 3300005841 Bacteria 7703
89 Ga0068863_100018516 3300005841 Bacteria 6665
90 Ga0068858_100065627 3300005842 Bacteria 3359
91 Ga0068860_100018154 3300005843 Bacteria 6847
92 Ga0068860_100049386 3300005843 Bacteria 4007
93 Ga0068860_100070783 3300005843 Bacteria 3316
94 Ga0068860_100094548 3300005843 Bacteria 2849
95 Ga0068860_102086931 3300005843 Unclassified 588
96 Ga0068862_100005423 3300005844 Bacteria 10652
97 Ga0068862_100005443 3300005844 Bacteria 10639
98 Ga0068862_100208802 3300005844 Bacteria 1764
99 Ga0068862_100915733 3300005844 Bacteria 863
100 Ga0075368_10253444 3300006042 Bacteria 752
101 Ga0075363_100000751 3300006048 Bacteria 11082
102 Ga0075364_10009112 3300006051 Bacteria 5944
103 Ga0075364_10045967 3300006051 Bacteria 2842
104 Ga0075364_10377282 3300006051 Bacteria 967
105 Ga0075362_10000114 3300006177 Bacteria 22522
106 Ga0075369_10001348 3300006186 Bacteria 8343
107 Ga0075369_10088982 3300006186 Bacteria 1376
108 Ga0075366_10000415 3300006195 Bacteria 19942
109 Ga0075366_10217038 3300006195 Unclassified 1165
110 Ga0075370_10000048 3300006353 Bacteria 36696
111 Ga0075370_10019167 3300006353 Bacteria 3723
112 Ga0075370_10356755 3300006353 Bacteria 874
113 Ga0075433_10749474 3300006852 Bacteria 854
114 Ga0097620_100004738 3300006931 Bacteria 13820
115 Ga0097620_100382449 3300006931 Bacteria 1503
116 Ga0105251_10002813 3300009011 Bacteria 13190
117 Ga0105244_10313621 3300009036 Unclassified 725
118 Ga0111539_10031153 3300009094 Bacteria 6481
119 Ga0111539_10159233 3300009094 Bacteria 2641
120 Ga0114129_10094271 3300009147 Bacteria 4146
121 Ga0105243_10091751 3300009148 Bacteria 2502
122 Ga0105241_10213679 3300009174 Bacteria 1617
123 Ga0105248_10009679 3300009177 Bacteria 10620
124 Ga0105248_10061232 3300009177 Bacteria 4225
125 Ga0105248_10119684 3300009177 Bacteria 2970
126 Ga0105248_10257372 3300009177 Bacteria 1965
127 Ga0105148_123240 3300009978 Bacteria 500
128 Ga0157370_10240133 3300013104 Bacteria 1676
129 Ga0157370_10291284 3300013104 Bacteria 1508
130 Ga0157374_10187837 3300013296 Bacteria 2021
131 Ga0163162_10131308 3300013306 Bacteria 2613
132 Ga0163162_10353633 3300013306 Bacteria 1602
133 Ga0157375_10004348 3300013308 Bacteria 12300
134 Ga0157375_10644551 3300013308 Bacteria 1216
135 Ga0157375_10761090 3300013308 Bacteria 1119
136 Ga0163163_10298201 3300014325 Bacteria 1664
137 Ga0163163_10318793 3300014325 Bacteria 1608
138 Ga0163163_11416147 3300014325 Bacteria 757
139 Ga0157380_10005051 3300014326 Bacteria 9205
140 Ga0157380_10010241 3300014326 Bacteria 6737
141 Ga0157380_10027145 3300014326 Bacteria 4352
142 Ga0157380_11179209 3300014326 Bacteria 809
143 Ga0157380_11478720 3300014326 Bacteria 732
144 Ga0163161_10232557 3300017792 Bacteria 1431
145 Ga0163161_10436349 3300017792 Bacteria 1056
146 Ga0206353_11925673 3300020082 Bacteria 6402
147 Ga0209676_1042365 3300025292 Bacteria 1264
148 Ga0209257_1002572 3300025304 Bacteria 17649
149 Ga0207697_10005052 3300025315 Bacteria 6180
150 Ga0207656_10328319 3300025321 Unclassified 761
151 Ga0207713_1004925 3300025735 Bacteria 8535
152 Ga0207682_10001693 3300025893 Bacteria 10102
153 Ga0207682_10230854 3300025893 Bacteria 858
154 Ga0207688_10035693 3300025901 Bacteria 2755
155 Ga0207680_10004421 3300025903 Bacteria 6666
156 Ga0207680_10010051 3300025903 Bacteria 4719
157 Ga0207647_10155111 3300025904 Bacteria 1337
158 Ga0207645_10011685 3300025907 Bacteria 5986
159 Ga0207705_10022039 3300025909 Bacteria 4545
160 Ga0207705_10059052 3300025909 Bacteria 2767
161 Ga0207705_10064907 3300025909 Bacteria 2639
162 Ga0207705_10079391 3300025909 Bacteria 2389
163 Ga0207705_10255450 3300025909 Bacteria 1337
164 Ga0207705_10266287 3300025909 Unclassified 1310
165 Ga0207657_10065273 3300025919 Bacteria 3104
166 Ga0207649_10036352 3300025920 Bacteria 2966
167 Ga0207652_10166515 3300025921 Bacteria 1977
168 Ga0207681_10000548 3300025923 Bacteria 25915
169 Ga0207681_10002127 3300025923 Bacteria 12647
170 Ga0207681_10006980 3300025923 Bacteria 6930
171 Ga0207681_10077627 3300025923 Bacteria 2335
172 Ga0207681_10759161 3300025923 Bacteria 809
173 Ga0207681_10825870 3300025923 Unclassified 775
174 Ga0207681_10897787 3300025923 Bacteria 742
175 Ga0207650_10003054 3300025925 Bacteria 11531
176 Ga0207650_10003693 3300025925 Bacteria 10467
177 Ga0207650_10129821 3300025925 Bacteria 1971
178 Ga0207650_10153465 3300025925 Bacteria 1819
179 Ga0207659_10000611 3300025926 Bacteria 21307
180 Ga0207659_10006673 3300025926 Bacteria 7092
181 Ga0207644_10000397 3300025931 Bacteria 28324
182 Ga0207644_10036805 3300025931 Bacteria 3438
183 Ga0207644_10063813 3300025931 Bacteria 2675
184 Ga0207690_10123028 3300025932 Bacteria 1887
185 Ga0207706_10000434 3300025933 Bacteria 44818
186 Ga0207706_10027517 3300025933 Bacteria 5083
187 Ga0207691_10000852 3300025940 Bacteria 30260
188 Ga0207691_10009889 3300025940 Bacteria 9156
189 Ga0207691_10029005 3300025940 Bacteria 5178
190 Ga0207711_10006931 3300025941 Bacteria 9511
191 Ga0207711_10012780 3300025941 Bacteria 6975
192 Ga0207711_10386239 3300025941 Bacteria 1299
193 Ga0207689_10314635 3300025942 Bacteria 1299
194 Ga0207679_10078491 3300025945 Bacteria 2515
195 Ga0207679_10165049 3300025945 Bacteria 1817
196 Ga0207667_10694147 3300025949 Bacteria 1021
197 Ga0207667_10895053 3300025949 Unclassified 880
198 Ga0207651_10038849 3300025960 Bacteria 3132
199 Ga0207651_10386054 3300025960 Bacteria 1188
200 Ga0207651_10435975 3300025960 Bacteria 1121
201 Ga0207712_11290544 3300025961 Bacteria 652
202 Ga0207668_10000296 3300025972 Bacteria 32653
203 Ga0207668_10002049 3300025972 Bacteria 11759
204 Ga0207668_10007027 3300025972 Bacteria 6677
205 Ga0207668_10397557 3300025972 Bacteria 1164
206 Ga0207668_11041577 3300025972 Bacteria 732
207 Ga0207640_10471771 3300025981 Bacteria 1039
208 Ga0207658_10000072 3300025986 Bacteria 112469
209 Ga0207658_10002373 3300025986 Bacteria 13816
210 Ga0207658_10009672 3300025986 Bacteria 6540
211 Ga0207658_10042455 3300025986 Bacteria 3299
212 Ga0207658_10569088 3300025986 Bacteria 1015
213 Ga0207703_10040674 3300026035 Bacteria 3721
214 Ga0207703_11469931 3300026035 Bacteria 656
215 Ga0207678_10131746 3300026067 Bacteria 2133
216 Ga0207678_10173852 3300026067 Bacteria 1839
217 Ga0207678_10439973 3300026067 Bacteria 1132
218 Ga0207708_10028356 3300026075 Bacteria 4240
219 Ga0207702_10076026 3300026078 Bacteria 2902
220 Ga0207641_10000096 3300026088 Bacteria 123585
221 Ga0207641_10005328 3300026088 Bacteria 10985
222 Ga0207641_10012314 3300026088 Bacteria 7017
223 Ga0207648_10084779 3300026089 Bacteria 2764
224 Ga0207676_10045576 3300026095 Bacteria 3389
225 Ga0207676_10242414 3300026095 Bacteria 1618
226 Ga0207676_10583925 3300026095 Bacteria 1071
227 Ga0207674_10054756 3300026116 Bacteria 4060
228 Ga0207675_100006808 3300026118 Bacteria 10823
229 Ga0207683_10082453 3300026121 Bacteria 2857
230 Ga0207698_10008192 3300026142 Bacteria 6591
231 Ga0207698_11850085 3300026142 Unclassified 619
232 Ga0210000_1068898 3300027462 Bacteria 576
233 Ga0209971_1013363 3300027682 Bacteria 1945
234 Ga0209813_10248527 3300027866 Bacteria 675
235 Ga0209974_10002001 3300027876 Bacteria 7437
236 Ga0209974_10074493 3300027876 Bacteria 1162
237 Ga0207428_10087291 3300027907 Bacteria 2427
238 Ga0268266_10000202 3300028379 Bacteria 104100
239 Ga0268266_10267794 3300028379 Bacteria 1585
240 Ga0268266_10362640 3300028379 Bacteria 1364
241 Ga0268265_10004795 3300028380 Bacteria 9321
242 Ga0268265_10006418 3300028380 Bacteria 7973
243 Ga0268265_10450344 3300028380 Bacteria 1202
244 Ga0268265_10843079 3300028380 Bacteria 896
245 Ga0268264_10001653 3300028381 Bacteria 20594
246 Ga0268264_10012832 3300028381 Bacteria 6896
247 Ga0268264_10058557 3300028381 Bacteria 3227
248 Ga0268264_10142360 3300028381 Bacteria 2140
249 Ga0307408_100017368 3300031548 Bacteria 4814
250 Ga0307408_100099756 3300031548 Bacteria 2210
251 Ga0307408_100359680 3300031548 Bacteria 1238
252 Ga0307408_100486769 3300031548 Bacteria 1077
253 Ga0307408_101886533 3300031548 Unclassified 573
254 Ga0307508_10015523 3300031616 Bacteria 6939
255 Ga0307405_10037986 3300031731 Bacteria 2899
256 Ga0307405_10136458 3300031731 Bacteria 1704
257 Ga0307405_10247418 3300031731 Bacteria 1324
258 Ga0307405_10324870 3300031731 Bacteria 1177
259 Ga0307405_11654397 3300031731 Unclassified 566
260 Ga0307413_10019285 3300031824 Bacteria 3599
261 Ga0307413_10026416 3300031824 Bacteria 3199
262 Ga0307413_10027051 3300031824 Bacteria 3172
263 Ga0307413_10115650 3300031824 Bacteria 1805
264 Ga0307413_10495968 3300031824 Bacteria 979
265 Ga0307413_10631295 3300031824 Bacteria 881
266 Ga0307410_10006157 3300031852 Bacteria 6442
267 Ga0307410_10020965 3300031852 Bacteria 4011
268 Ga0307410_10059077 3300031852 Bacteria 2617
269 Ga0307410_10061332 3300031852 Bacteria 2573
270 Ga0307410_10126499 3300031852 Bacteria 1871
271 Ga0307410_10348479 3300031852 Bacteria 1183
272 Ga0307406_10012739 3300031901 Bacteria 4798
273 Ga0307406_10050160 3300031901 Bacteria 2644
274 Ga0307406_10464602 3300031901 Bacteria 1018
275 Ga0307407_10004679 3300031903 Bacteria 5844
276 Ga0307407_10009456 3300031903 Bacteria 4541
277 Ga0307407_10370741 3300031903 Bacteria 1019
278 Ga0307407_10417568 3300031903 Bacteria 966
279 Ga0307412_10012148 3300031911 Bacteria 5007
280 Ga0307412_10012513 3300031911 Bacteria 4950
281 Ga0307412_10105954 3300031911 Bacteria 1998
282 Ga0307412_10118493 3300031911 Bacteria 1902
283 Ga0307412_10151425 3300031911 Bacteria 1712
284 Ga0307412_10484553 3300031911 Bacteria 1026
285 Ga0307412_10941066 3300031911 Bacteria 760
286 Ga0307409_100008792 3300031995 Bacteria 6156
287 Ga0307409_100012141 3300031995 Bacteria 5473
288 Ga0307409_100142986 3300031995 Bacteria 2064
289 Ga0307409_100470254 3300031995 Bacteria 1217
290 Ga0307409_102535795 3300031995 Bacteria 541
291 Ga0307416_100001604 3300032002 Bacteria 12428
292 Ga0307416_100021727 3300032002 Bacteria 4614
293 Ga0307416_100873858 3300032002 Bacteria 998
294 Ga0307416_101608031 3300032002 Bacteria 755
295 Ga0307416_101743248 3300032002 Bacteria 727
296 Ga0307416_102670315 3300032002 Bacteria 596
297 Ga0307414_10026152 3300032004 Bacteria 3751
298 Ga0307414_10149513 3300032004 Bacteria 1840
299 Ga0307414_10185940 3300032004 Bacteria 1676
300 Ga0307414_10518684 3300032004 Bacteria 1057
301 Ga0307414_10748737 3300032004 Bacteria 888
302 Ga0307411_10018454 3300032005 Bacteria 4002
303 Ga0307411_10064522 3300032005 Bacteria 2452
304 Ga0307411_10184834 3300032005 Bacteria 1585
305 Ga0307411_10766460 3300032005 Bacteria 847
306 Ga0307415_100001928 3300032126 Bacteria 10210
307 Ga0307415_100002975 3300032126 Bacteria 8519
308 Ga0307415_100031841 3300032126 Bacteria 3403
309 Ga0307415_100305221 3300032126 Bacteria 1320
310 Ga0307415_101348783 3300032126 Bacteria 677
311 Ga0307415_101621985 3300032126 Bacteria 622
312 Ga0373962_0026457 3300035242 Bacteria 1564
313 Ga0373931_0117170 3300035691 Bacteria 1518
314 Ga0395899_0172011 3300037312 Bacteria 1525
315 Ga0395899_0382360 3300037312 Bacteria 935
316 Ga0395899_0764144 3300037312 Unclassified 600
317 Ga0395900_0000995 3300037418 Bacteria 36856
318 Ga0395900_0104718 3300037418 Bacteria 2907
319 Ga0395900_0396418 3300037418 Bacteria 1345
320 Ga0395900_0508909 3300037418 Bacteria 1153
321 Ga0395898_0088294 3300037466 Bacteria 2985
322 Ga0395898_0262885 3300037466 Bacteria 1646
323 Ga0395905_0000538 3300037471 Bacteria 51665
324 Ga0395905_0035114 3300037471 Bacteria 4707
325 Ga0395905_0142162 3300037471 Bacteria 2257
326 Ga0395905_0230407 3300037471 Bacteria 1732
327 Ga0436364_0052178 3300037853 Bacteria 669
328 Ga0395901_0002926 3300038443 Bacteria 17249
329 Ga0395901_0020998 3300038443 Bacteria 6689
330 Ga0395901_0240012 3300038443 Bacteria 1890
331 Ga0439465_0055246 3300041413 Bacteria 1307
332 Ga0439465_0297660 3300041413 Bacteria 603
333 Ga0439445_0072066 3300042004 Bacteria 957
334 Ga0439460_0038729 3300042461 Bacteria 1391
335 Ga0466957_0353895 3300044842 Bacteria 997
336 Ga0466967_0288901 3300045976 Bacteria 1575
337 Ga0495638_0024601 3300046460 Bacteria 3925
338 Ga0495650_0001110 3300046471 Bacteria 29443
339 Ga0495596_0003991 3300046500 Bacteria 7280
340 Ga0495607_0020224 3300046501 Bacteria 4213
341 Ga0495607_0066096 3300046501 Bacteria 2036
342 Ga0495583_0041616 3300046506 Bacteria 2151
343 Ga0495606_0013497 3300046507 Bacteria 6445
344 Ga0495606_0016850 3300046507 Bacteria 5551
345 Ga0495610_0000116 3300046512 Bacteria 90702
346 Ga0495610_0001391 3300046512 Bacteria 21493
347 Ga0495610_0053850 3300046512 Bacteria 1947
348 Ga0495632_0015455 3300046519 Bacteria 4279
349 Ga0495643_0000048 3300046522 Bacteria 212788
350 Ga0495643_0002195 3300046522 Bacteria 15959
351 Ga0495643_0089419 3300046522 Bacteria 1590
352 Ga0495663_0002538 3300046525 Bacteria 5468
353 Ga0495663_0087045 3300046525 Bacteria 1013
354 Ga0495663_0097191 3300046525 Bacteria 966
355 Ga0495654_0045118 3300046530 Bacteria 2176
356 Ga0495598_0000845 3300046537 Bacteria 5871
357 Ga0495598_0007691 3300046537 Bacteria 2482
358 Ga0495598_0022981 3300046537 Bacteria 1674
359 Ga0495609_0008753 3300046538 Bacteria 4930
360 Ga0495621_0001328 3300046539 Bacteria 6390
361 Ga0495621_0001615 3300046539 Bacteria 5887
362 Ga0495621_0002046 3300046539 Bacteria 5331
363 Ga0495621_0056436 3300046539 Bacteria 1416
364 Ga0495633_0002984 3300046558 Bacteria 11573
365 Ga0495668_0000015 3300046616 Bacteria 441932
366 Ga0495625_0005849 3300046660 Bacteria 11088
367 Ga0495669_0003927 3300046684 Bacteria 6123
368 Ga0495669_0093940 3300046684 Bacteria 1388
369 Ga0495669_0242421 3300046684 Bacteria 865
370 Ga0495670_0049251 3300046691 Bacteria 2107
371 Ga0495670_0050139 3300046691 Bacteria 2089
372 Ga0495671_0079050 3300046692 Bacteria 1612
373 Ga0495649_0359388 3300046694 Bacteria 735
374 Ga0495677_0005059 3300047445 Bacteria 5024
375 Ga0495677_0014244 3300047445 Bacteria 2896
376 Ga0495677_0123735 3300047445 Bacteria 987
377 Ga0495677_0149378 3300047445 Bacteria 899
378 Ga0495673_0175002 3300047469 Bacteria 816
379 Ga0495681_0045333 3300047470 Bacteria 2105
380 Ga0495615_0000067 3300048090 Bacteria 33324
381 Ga0495626_0001105 3300048091 Bacteria 22816
382 Ga0496100_1266754 3300048903 Bacteria 582
383 Ga0496101_0741814 3300048904 Bacteria 775
384 Ga0496103_0004528 3300048906 Bacteria 8421
385 Ga0496103_0710654 3300048906 Bacteria 637
386 Ga0496105_0900236 3300048908 Bacteria 667
387 Ga0496107_0034141 3300048910 Bacteria 3642
388 Ga0496108_0110995 3300048911 Bacteria 2345
389 Ga0496108_0323206 3300048911 Bacteria 1345
390 Ga0496108_1079740 3300048911 Bacteria 683
391 Ga0496109_0191820 3300048912 Bacteria 1920
392 Ga0496109_0351382 3300048912 Bacteria 1393
393 Ga0496110_0001641 3300048913 Bacteria 16416
394 Ga0496110_0437143 3300048913 Bacteria 1192
395 Ga0496111_0063481 3300048914 Bacteria 2678
396 Ga0496111_0290466 3300048914 Bacteria 1212
397 Ga0496114_0055145 3300048917 Bacteria 3315
398 Ga0496116_0157462 3300048919 Bacteria 1251
399 Ga0496117_0012926 3300048920 Bacteria 7315
400 Ga0496118_0102584 3300048921 Bacteria 1927
401 Ga0496121_0003483 3300048924 Bacteria 22408
402 Ga0496121_0015523 3300048924 Bacteria 7969
403 Ga0496122_0001992 3300048925 Bacteria 30435
404 Ga0496123_0004408 3300048926 Bacteria 14829
405 Ga0496124_0114357 3300048927 Bacteria 2167
406 Ga0496124_0141684 3300048927 Bacteria 1896
407 Ga0496124_0545689 3300048927 Bacteria 766
408 Ga0496125_0011040 3300048928 Bacteria 9065
409 Ga0496125_0012677 3300048928 Bacteria 8344
410 Ga0496125_0300568 3300048928 Bacteria 983
411 Ga0496126_0180428 3300048929 Bacteria 1794
412 Ga0496126_0375998 3300048929 Bacteria 1157
413 Ga0496126_0524311 3300048929 Bacteria 944
414 Ga0501031_0449464 3300049568 Bacteria 832
415 Ga0501032_0013025 3300049569 Bacteria 5923
416 Ga0501033_0029293 3300049570 Bacteria 4137
417 Ga0501034_0075887 3300049571 Bacteria 3368
418 Ga0501036_0024042 3300049572 Bacteria 5135
419 Ga0501036_0347630 3300049572 Bacteria 1238
420 Ga0501037_0048685 3300049573 Bacteria 3104
421 Ga0501038_0003571 3300049574 Bacteria 14469
422 Ga0501039_0156091 3300049575 Bacteria 1793
423 Ga0501043_0027738 3300049579 Bacteria 4445
424 Ga0501043_0220013 3300049579 Bacteria 1469
425 Ga0501046_0183838 3300049580 Bacteria 1562
426 Ga0501047_0212421 3300049581 Bacteria 1793
427 Ga0501048_0052070 3300049582 Bacteria 2913
428 Ga0501074_1295741 3300049590 Bacteria 511
429 Ga0501216_109975 3300049660 Bacteria 618
430 Ga0501217_093200 3300049661 Bacteria 848
431 Ga0501249_075316 3300049679 Bacteria 790
432 Ga0501251_073602 3300049681 Bacteria 587
433 Ga0501283_017128 3300049779 Bacteria 1131
434 Ga0501035_0021319 3300049822 Bacteria 5956
435 Ga0501212_018938 3300049851 Bacteria 1052
436 nmdc:mga03683_10210_c2 3300050489 Bacteria 1759
437 nmdc:mga03683_17_c1 3300050489 Bacteria 91111
438 nmdc:mga03n38_973_c1 3300050490 Bacteria 7791
439 nmdc:mga00v17_37643_c1 3300050491 Bacteria 2890
440 nmdc:mga00v17_382_c1 3300050491 Bacteria 25073
441 nmdc:mga00v17_734692_c1 3300050491 Bacteria 631
442 nmdc:mga00v17_845615_c1 3300050491 Bacteria 581
443 nmdc:mga0k408_12_c1 3300050493 Bacteria 125427
444 nmdc:mga06z11_686975_c1 3300050494 Bacteria 623
445 nmdc:mga04h51_279896_c1 3300050495 Bacteria 675
446 nmdc:mga07m45_11_c1 3300050496 Bacteria 163532
447 nmdc:mga07m45_15252_c1 3300050496 Bacteria 3501
448 nmdc:mga07m45_216818_c1 3300050496 Bacteria 1113
449 nmdc:mga05p37_143632_c1 3300050507 Bacteria 2923
450 nmdc:mga08y16_375062_c1 3300050511 Bacteria 1459
451 nmdc:mga08y16_39427_c1 3300050511 Bacteria 4956
452 nmdc:mga08y16_887092_c1 3300050511 Bacteria 879
453 nmdc:mga0sz30_666_c2 3300050516 Bacteria 11850
454 Ga0500566_0137847 3300053094 Bacteria 1298
455 Ga0500555_025022 3300053103 Bacteria 1709
456 Ga0500592_009184 3300053116 Bacteria 1570
457 Ga0500607_000763 3300053121 Bacteria 30989
458 Ga0500608_133064 3300053122 Bacteria 1112
459 Ga0500559_0002508 3300053136 Bacteria 9437
460 Ga0500590_045525 3300053148 Bacteria 2246
461 Ga0500604_0049206 3300053151 Bacteria 1296
462 Ga0500627_0000028 3300053158 Bacteria 99118
463 Ga0500627_0069216 3300053158 Bacteria 1561
464 Ga0500637_0001265 3300053178 Bacteria 10581
465 Ga0500645_101046 3300053730 Bacteria 814
466 Ga0501082_0515726 3300060353 Bacteria 1045
467 2643820291 2643221560 Bacteria 4801179
468 2819554705 2818991438 Bacteria 5793701
469 2852656184 2852653556 Bacteria 4050083
470 2885428023 2885427238 Bacteria 2291351
471 8054305077 8054302542 Bacteria 5698134
472 Ga0496123_0304565
473 MBSR1b_contig_5698931
474 JGI24735J21928_10005689
475 Ga0055536_1012034
476 Ga0055531_10041867
477 Ga0065712_10080286
478 Ga0065715_10096065
479 Ga0065715_10132912
480 Ga0065715_10728451
481 Ga0070658_10078934
482 Ga0070658_10172369
483 Ga0070658_10230371
484 Ga0070676_10421165
485 Ga0070683_100246546
486 Ga0070670_100000422
487 Ga0070670_100018786
488 Ga0070670_100108728
489 Ga0070670_100230975
490 Ga0070670_100420970
491 Ga0070677_10805906
492 Ga0068869_100390669
493 Ga0070666_10000551
494 Ga0070666_10033801
495 Ga0070680_100617583
496 Ga0070660_100112158
497 Ga0070660_100172113
498 Ga0070687_100887959
499 Ga0070661_100014544
500 Ga0070668_100000019
501 Ga0070668_100015808
502 Ga0070668_100077275
503 Ga0070668_100238356
504 Ga0070668_100291457
505 Ga0070668_100560363
506 Ga0070668_100603983
507 Ga0070669_100001898
508 Ga0070669_100004351
509 Ga0070669_100006102
510 Ga0070669_100045601
511 Ga0070669_100831642
512 Ga0070675_100000860
513 Ga0070675_100004653
514 Ga0070671_100005286
515 Ga0070671_100007974
516 Ga0070671_100129887
517 Ga0070671_100219133
518 Ga0070673_100055589
519 Ga0070673_100298787
520 Ga0070659_100276362
521 Ga0070667_100000094
522 Ga0070667_100001365
523 Ga0070667_100003455
524 Ga0070667_100008691
525 Ga0070667_100023674
526 Ga0070667_100669689
527 Ga0070701_10177501
528 Ga0070705_101327372
529 Ga0070700_101188980
530 Ga0070663_100006460
531 Ga0070663_100258293
532 Ga0070663_100282319
533 Ga0070679_100183277
534 Ga0070679_100589754
535 Ga0068853_100061230
536 Ga0068853_101423240
537 Ga0070672_100003490
538 Ga0070672_100009319
539 Ga0070672_100143943
540 Ga0070665_100000070
541 Ga0070665_100057068
542 Ga0070665_100117850
543 Ga0070665_100314879
544 Ga0070664_100001636
545 Ga0070664_100162885
546 Ga0068854_100281937
547 Ga0068856_100318788
548 Ga0068852_100190010
549 Ga0068852_100697471
550 Ga0068852_101889448
551 Ga0068859_100004738
552 Ga0068864_100111147
553 Ga0068864_100476817
554 Ga0068864_100623705
555 Ga0068861_101063382
556 Ga0068851_10472460
557 Ga0068870_10045864
558 Ga0068863_100000057
559 Ga0068863_100014090
560 Ga0068863_100018516
561 Ga0068858_100065627
562 Ga0068860_100018154
563 Ga0068860_100049386
564 Ga0068860_100070783
565 Ga0068860_100094548
566 Ga0068860_102086931
567 Ga0068862_100005423
568 Ga0068862_100005443
569 Ga0068862_100208802
570 Ga0068862_100915733
571 Ga0075368_10253444
572 Ga0075363_100000751
573 Ga0075364_10009112
574 Ga0075364_10045967
575 Ga0075364_10377282
576 Ga0075362_10000114
577 Ga0075369_10001348
578 Ga0075369_10088982
579 Ga0075366_10000415
580 Ga0075366_10217038
581 Ga0075370_10000048
582 Ga0075370_10019167
583 Ga0075370_10356755
584 Ga0075433_10749474
585 Ga0097620_100004738
586 Ga0097620_100382449
587 Ga0105251_10002813
588 Ga0105244_10313621
589 Ga0111539_10031153
590 Ga0111539_10159233
591 Ga0114129_10094271
592 Ga0105243_10091751
593 Ga0105241_10213679
594 Ga0105248_10009679
595 Ga0105248_10061232
596 Ga0105248_10119684
597 Ga0105248_10257372
598 Ga0105148_123240
599 Ga0157370_10240133
600 Ga0157370_10291284
601 Ga0157374_10187837
602 Ga0163162_10131308
603 Ga0163162_10353633
604 Ga0157375_10004348
605 Ga0157375_10644551
606 Ga0157375_10761090
607 Ga0163163_10298201
608 Ga0163163_10318793
609 Ga0163163_11416147
610 Ga0157380_10005051
611 Ga0157380_10010241
612 Ga0157380_10027145
613 Ga0157380_11179209
614 Ga0157380_11478720
615 Ga0163161_10232557
616 Ga0163161_10436349
617 Ga0206353_11925673
618 Ga0209676_1042365
619 Ga0209257_1002572
620 Ga0207697_10005052
621 Ga0207656_10328319
622 Ga0207713_1004925
623 Ga0207682_10001693
624 Ga0207682_10230854
625 Ga0207688_10035693
626 Ga0207680_10004421
627 Ga0207680_10010051
628 Ga0207647_10155111
629 Ga0207645_10011685
630 Ga0207705_10022039
631 Ga0207705_10059052
632 Ga0207705_10064907
633 Ga0207705_10079391
634 Ga0207705_10255450
635 Ga0207705_10266287
636 Ga0207657_10065273
637 Ga0207649_10036352
638 Ga0207652_10166515
639 Ga0207681_10000548
640 Ga0207681_10002127
641 Ga0207681_10006980
642 Ga0207681_10077627
643 Ga0207681_10759161
644 Ga0207681_10825870
645 Ga0207681_10897787
646 Ga0207650_10003054
647 Ga0207650_10003693
648 Ga0207650_10129821
649 Ga0207650_10153465
650 Ga0207659_10000611
651 Ga0207659_10006673
652 Ga0207644_10000397
653 Ga0207644_10036805
654 Ga0207644_10063813
655 Ga0207690_10123028
656 Ga0207706_10000434
657 Ga0207706_10027517
658 Ga0207691_10000852
659 Ga0207691_10009889
660 Ga0207691_10029005
661 Ga0207711_10006931
662 Ga0207711_10012780
663 Ga0207711_10386239
664 Ga0207689_10314635
665 Ga0207679_10078491
666 Ga0207679_10165049
667 Ga0207667_10694147
668 Ga0207667_10895053
669 Ga0207651_10038849
670 Ga0207651_10386054
671 Ga0207651_10435975
672 Ga0207712_11290544
673 Ga0207668_10000296
674 Ga0207668_10002049
675 Ga0207668_10007027
676 Ga0207668_10397557
677 Ga0207668_11041577
678 Ga0207640_10471771
679 Ga0207658_10000072
680 Ga0207658_10002373
681 Ga0207658_10009672
682 Ga0207658_10042455
683 Ga0207658_10569088
684 Ga0207703_10040674
685 Ga0207703_11469931
686 Ga0207678_10131746
687 Ga0207678_10173852
688 Ga0207678_10439973
689 Ga0207708_10028356
690 Ga0207702_10076026
691 Ga0207641_10000096
692 Ga0207641_10005328
693 Ga0207641_10012314
694 Ga0207648_10084779
695 Ga0207676_10045576
696 Ga0207676_10242414
697 Ga0207676_10583925
698 Ga0207674_10054756
699 Ga0207675_100006808
700 Ga0207683_10082453
701 Ga0207698_10008192
702 Ga0207698_11850085
703 Ga0210000_1068898
704 Ga0209971_1013363
705 Ga0209813_10248527
706 Ga0209974_10002001
707 Ga0209974_10074493
708 Ga0207428_10087291
709 Ga0268266_10000202
710 Ga0268266_10267794
711 Ga0268266_10362640
712 Ga0268265_10004795
713 Ga0268265_10006418
714 Ga0268265_10450344
715 Ga0268265_10843079
716 Ga0268264_10001653
717 Ga0268264_10012832
718 Ga0268264_10058557
719 Ga0268264_10142360
720 Ga0307408_100017368
721 Ga0307408_100099756
722 Ga0307408_100359680
723 Ga0307408_100486769
724 Ga0307408_101886533
725 Ga0307508_10015523
726 Ga0307405_10037986
727 Ga0307405_10136458
728 Ga0307405_10247418
729 Ga0307405_10324870
730 Ga0307405_11654397
731 Ga0307413_10019285
732 Ga0307413_10026416
733 Ga0307413_10027051
734 Ga0307413_10115650
735 Ga0307413_10495968
736 Ga0307413_10631295
737 Ga0307410_10006157
738 Ga0307410_10020965
739 Ga0307410_10059077
740 Ga0307410_10061332
741 Ga0307410_10126499
742 Ga0307410_10348479
743 Ga0307406_10012739
744 Ga0307406_10050160
745 Ga0307406_10464602
746 Ga0307407_10004679
747 Ga0307407_10009456
748 Ga0307407_10370741
749 Ga0307407_10417568
750 Ga0307412_10012148
751 Ga0307412_10012513
752 Ga0307412_10105954
753 Ga0307412_10118493
754 Ga0307412_10151425
755 Ga0307412_10484553
756 Ga0307412_10941066
757 Ga0307409_100008792
758 Ga0307409_100012141
759 Ga0307409_100142986
760 Ga0307409_100470254
761 Ga0307409_102535795
762 Ga0307416_100001604
763 Ga0307416_100021727
764 Ga0307416_100873858
765 Ga0307416_101608031
766 Ga0307416_101743248
767 Ga0307416_102670315
768 Ga0307414_10026152
769 Ga0307414_10149513
770 Ga0307414_10185940
771 Ga0307414_10518684
772 Ga0307414_10748737
773 Ga0307411_10018454
774 Ga0307411_10064522
775 Ga0307411_10184834
776 Ga0307411_10766460
777 Ga0307415_100001928
778 Ga0307415_100002975
779 Ga0307415_100031841
780 Ga0307415_100305221
781 Ga0307415_101348783
782 Ga0307415_101621985
783 Ga0373962_0026457
784 Ga0373931_0117170
785 Ga0395899_0172011
786 Ga0395899_0382360
787 Ga0395899_0764144
788 Ga0395900_0000995
789 Ga0395900_0104718
790 Ga0395900_0396418
791 Ga0395900_0508909
792 Ga0395898_0088294
793 Ga0395898_0262885
794 Ga0395905_0000538
795 Ga0395905_0035114
796 Ga0395905_0142162
797 Ga0395905_0230407
798 Ga0436364_0052178
799 Ga0395901_0002926
800 Ga0395901_0020998
801 Ga0395901_0240012
802 Ga0439465_0055246
803 Ga0439465_0297660
804 Ga0439445_0072066
805 Ga0439460_0038729
806 Ga0466957_0353895
807 Ga0466967_0288901
808 Ga0495638_0024601
809 Ga0495650_0001110
810 Ga0495596_0003991
811 Ga0495607_0020224
812 Ga0495607_0066096
813 Ga0495583_0041616
814 Ga0495606_0013497
815 Ga0495606_0016850
816 Ga0495610_0000116
817 Ga0495610_0001391
818 Ga0495610_0053850
819 Ga0495632_0015455
820 Ga0495643_0000048
821 Ga0495643_0002195
822 Ga0495643_0089419
823 Ga0495663_0002538
824 Ga0495663_0087045
825 Ga0495663_0097191
826 Ga0495654_0045118
827 Ga0495598_0000845
828 Ga0495598_0007691
829 Ga0495598_0022981
830 Ga0495609_0008753
831 Ga0495621_0001328
832 Ga0495621_0001615
833 Ga0495621_0002046
834 Ga0495621_0056436
835 Ga0495633_0002984
836 Ga0495668_0000015
837 Ga0495625_0005849
838 Ga0495669_0003927
839 Ga0495669_0093940
840 Ga0495669_0242421
841 Ga0495670_0049251
842 Ga0495670_0050139
843 Ga0495671_0079050
844 Ga0495649_0359388
845 Ga0495677_0005059
846 Ga0495677_0014244
847 Ga0495677_0123735
848 Ga0495677_0149378
849 Ga0495673_0175002
850 Ga0495681_0045333
851 Ga0495615_0000067
852 Ga0495626_0001105
853 Ga0496100_1266754
854 Ga0496101_0741814
855 Ga0496103_0004528
856 Ga0496103_0710654
857 Ga0496105_0900236
858 Ga0496107_0034141
859 Ga0496108_0110995
860 Ga0496108_0323206
861 Ga0496108_1079740
862 Ga0496109_0191820
863 Ga0496109_0351382
864 Ga0496110_0001641
865 Ga0496110_0437143
866 Ga0496111_0063481
867 Ga0496111_0290466
868 Ga0496114_0055145
869 Ga0496116_0157462
870 Ga0496117_0012926
871 Ga0496118_0102584
872 Ga0496121_0003483
873 Ga0496121_0015523
874 Ga0496122_0001992
875 Ga0496123_0004408
876 Ga0496124_0114357
877 Ga0496124_0141684
878 Ga0496124_0545689
879 Ga0496125_0011040
880 Ga0496125_0012677
881 Ga0496125_0300568
882 Ga0496126_0180428
883 Ga0496126_0375998
884 Ga0496126_0524311
885 Ga0501031_0449464
886 Ga0501032_0013025
887 Ga0501033_0029293
888 Ga0501034_0075887
889 Ga0501036_0024042
890 Ga0501036_0347630
891 Ga0501037_0048685
892 Ga0501038_0003571
893 Ga0501039_0156091
894 Ga0501043_0027738
895 Ga0501043_0220013
896 Ga0501046_0183838
897 Ga0501047_0212421
898 Ga0501048_0052070
899 Ga0501074_1295741
900 Ga0501216_109975
901 Ga0501217_093200
902 Ga0501249_075316
903 Ga0501251_073602
904 Ga0501283_017128
905 Ga0501035_0021319
906 Ga0501212_018938
907 nmdc:mga03683_10210_c2
908 nmdc:mga03683_17_c1
909 nmdc:mga03n38_973_c1
910 nmdc:mga00v17_37643_c1
911 nmdc:mga00v17_382_c1
912 nmdc:mga00v17_734692_c1
913 nmdc:mga00v17_845615_c1
914 nmdc:mga0k408_12_c1
915 nmdc:mga06z11_686975_c1
916 nmdc:mga04h51_279896_c1
917 nmdc:mga07m45_11_c1
918 nmdc:mga07m45_15252_c1
919 nmdc:mga07m45_216818_c1
920 nmdc:mga05p37_143632_c1
921 nmdc:mga08y16_375062_c1
922 nmdc:mga08y16_39427_c1
923 nmdc:mga08y16_887092_c1
924 nmdc:mga0sz30_666_c2
925 Ga0500566_0137847
926 Ga0500555_025022
927 Ga0500592_009184
928 Ga0500607_000763
929 Ga0500608_133064
930 Ga0500559_0002508
931 Ga0500590_045525
932 Ga0500604_0049206
933 Ga0500627_0000028
934 Ga0500627_0069216
935 Ga0500637_0001265
936 Ga0500645_101046
937 Ga0501082_0515726
938 2643820291
939 2819554705
940 2852656184
941 2885428023
942 8054305077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

79

157

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9261 2 149
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.8969 2 149
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8967 1 119
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8876 41 119
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.8873 1 119
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9169 41 120 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8877 41 119 2.60.120.10
3i7dB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8854 2 149 2.60.120.10
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8707 27 121 2.60.120.10
4rd7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8635 28 117 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q2YQ73-F1-model_v4 Cupin domain-containing protein 0.9941 1 121 GO:0005886
GO:0015171
AF-A0A7H0G819-F1-model_v4 deleted 0.9937 3 149
AF-A0A2T6KQ38-F1-model_v4 Cupin domain-containing protein 0.9885 44 119 GO:0046872
AF-A0A4Q2YMQ0-F1-model_v4 Cupin domain-containing protein 0.9853 1 126 GO:0046872
AF-A0A1G5TI38-F1-model_v4 Uncharacterized conserved protein, cupin superfamily 0.9826 43 149 GO:0046872

Map