F450720

General Info

Members Datasets Scaffolds Average Seq Length
472 267 944 250

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10089603|Ga0065715_100896034
Length 289
Sequence MLRYTYLEFVFCYLGFLISCRLEFAISKVYLALIRKLKPHRMGLLSGKTALITGASKGIGKSIAIRYAQEGANVAFTYLSSVEKGLAVEKELQALGIKAKGYRSDASKYTEAEELVNSVLADFGQLDIVVNNAGITKDGLLMRMSEEQWDTVIEVNLKSVFNLTKAALKPMMKAKAGSIINMTSVVGISGNAGQTNYAASKAGIIGFTKSVAQELGSRNIRSNAIAPGFIETEMTEVLDPKVKAEWENGIPLKRAGKSEDVANACVFLGSELSTYITGQVLQVDGGMLT

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
102 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
219 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
220 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
231 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
232 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
237 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
238 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
241 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
242 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
243 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
244 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
245 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
246 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
247 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
248 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
249 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
250 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
251 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
252 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
253 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
254 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
255 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
256 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
257 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
258 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
259 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
260 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
261 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
262 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
263 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
264 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
265 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
266 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
267 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.28
Metatranscriptomes 0
Isolates 5.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.72
Nodule 0
Rhizoplane 1.06
Rhizosphere 86.44
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10089603 3300005293 Bacteria 9274
2 SwRhRL2b_contig_1663676 2162886007 Bacteria 241831
3 JGI24736J21556_1001454 3300001904 Bacteria 4340
4 JGI24737J22298_10049366 3300001990 Bacteria 1280
5 JGI24744J21845_10006311 3300002077 Unclassified 2461
6 JGI24751J29686_10004180 3300002459 Bacteria 2927
7 JGI25159J45721_1028406 3300002987 Bacteria 934
8 rootH2_10168289 3300003320 Bacteria 1386
9 rootL2_10032704 3300003322 Bacteria 4049
10 rootL2_10054012 3300003322 Bacteria 2925
11 rootH1_10262240 3300003323 Bacteria 4204
12 JGI25160J50197_1018426 3300003354 Bacteria 2177
13 Ga0055535_1011085 3300003761 Bacteria 1445
14 Ga0055531_10000173 3300003794 Bacteria 72625
15 Ga0065165_1004393 3300005262 Bacteria 8791
16 Ga0065714_10064782 3300005288 Bacteria 19009
17 Ga0065714_10098281 3300005288 Bacteria 1714
18 Ga0065704_10070136 3300005289 Bacteria 560402
19 Ga0065704_10077198 3300005289 Bacteria 4823
20 Ga0065704_10088338 3300005289 Bacteria 2946
21 Ga0065712_10034132 3300005290 Bacteria 1125
22 Ga0065712_10114148 3300005290 Bacteria 1771
23 Ga0065712_10209252 3300005290 Bacteria 1079
24 Ga0065715_10230567 3300005293 Bacteria 1235
25 Ga0065707_10120212 3300005295 Bacteria 2140
26 Ga0065707_10196508 3300005295 Bacteria 1332
27 Ga0070658_10258100 3300005327 Unclassified 1480
28 Ga0070676_10026898 3300005328 Bacteria 3258
29 Ga0070683_100013501 3300005329 Bacteria 7125
30 Ga0070683_100014613 3300005329 Bacteria 6874
31 Ga0070683_100036567 3300005329 Bacteria 4493
32 Ga0070670_100033530 3300005331 Bacteria 4422
33 Ga0070677_10030009 3300005333 Unclassified 2066
34 Ga0068869_100010790 3300005334 Bacteria 5969
35 Ga0068869_100164332 3300005334 Bacteria 1730
36 Ga0068869_100460231 3300005334 Bacteria 1056
37 Ga0070682_100000012 3300005337 Bacteria 265658
38 Ga0068868_100102993 3300005338 Bacteria 2312
39 Ga0070689_100256813 3300005340 Bacteria 1443
40 Ga0070668_100537428 3300005347 Bacteria 1016
41 Ga0070669_100001547 3300005353 Bacteria 16634
42 Ga0070675_100556707 3300005354 Bacteria 1037
43 Ga0070671_100058222 3300005355 Bacteria 3217
44 Ga0070673_100113660 3300005364 Bacteria 2249
45 Ga0070673_100310393 3300005364 Bacteria 1391
46 Ga0070688_100004079 3300005365 Bacteria 7578
47 Ga0070688_100033873 3300005365 Bacteria 3090
48 Ga0070659_100004626 3300005366 Bacteria 9832
49 Ga0070667_100010126 3300005367 Bacteria 7799
50 Ga0070667_100010540 3300005367 Bacteria 7629
51 Ga0070667_100538779 3300005367 Bacteria 1072
52 Ga0070701_10035319 3300005438 Bacteria 2510
53 Ga0070700_100680674 3300005441 Bacteria 815
54 Ga0070678_100656743 3300005456 Bacteria 941
55 Ga0070662_100150351 3300005457 Unclassified 1812
56 Ga0070681_10148493 3300005458 Bacteria 2272
57 Ga0068867_100002786 3300005459 Bacteria 12292
58 Ga0068867_100053778 3300005459 Bacteria 2974
59 Ga0068867_100425034 3300005459 Bacteria 1126
60 Ga0068867_100571862 3300005459 Unclassified 982
61 Ga0070685_10003838 3300005466 Bacteria 7602
62 Ga0070685_10011167 3300005466 Bacteria 4696
63 Ga0070685_10389701 3300005466 Bacteria 962
64 Ga0070706_100342790 3300005467 Bacteria 1393
65 Ga0070698_100002783 3300005471 Bacteria 19250
66 Ga0070698_100010416 3300005471 Bacteria 9928
67 Ga0070699_100488058 3300005518 Bacteria 1118
68 Ga0070684_100185756 3300005535 Bacteria 1890
69 Ga0068853_100003660 3300005539 Bacteria 11790
70 Ga0068853_100084111 3300005539 Bacteria 2788
71 Ga0068853_100129594 3300005539 Bacteria 2257
72 Ga0068853_100188181 3300005539 Bacteria 1874
73 Ga0068853_100505698 3300005539 Bacteria 1141
74 Ga0070672_100288881 3300005543 Bacteria 1388
75 Ga0070686_100456761 3300005544 Unclassified 983
76 Ga0070704_100478877 3300005549 Bacteria 1077
77 Ga0070664_100001578 3300005564 Bacteria 18220
78 Ga0070664_100249856 3300005564 Bacteria 1594
79 Ga0068857_100042607 3300005577 Bacteria 4028
80 Ga0068857_100065211 3300005577 Bacteria 3238
81 Ga0068857_100205849 3300005577 Bacteria 1795
82 Ga0068857_100607848 3300005577 Bacteria 1034
83 Ga0068852_100000417 3300005616 Bacteria 28355
84 Ga0068852_100212472 3300005616 Bacteria 1836
85 Ga0068852_100223677 3300005616 Bacteria 1791
86 Ga0068852_100623573 3300005616 Bacteria 1084
87 Ga0068852_100847533 3300005616 Bacteria 929
88 Ga0068859_100000289 3300005617 Bacteria 49979
89 Ga0068859_100030120 3300005617 Bacteria 5445
90 Ga0068859_100427335 3300005617 Bacteria 1421
91 Ga0068859_100716819 3300005617 Bacteria 1090
92 Ga0068864_100011571 3300005618 Bacteria 7285
93 Ga0068864_100028898 3300005618 Bacteria 4692
94 Ga0068864_100048273 3300005618 Bacteria 3659
95 Ga0068864_100670233 3300005618 Bacteria 1011
96 Ga0068861_100006815 3300005719 Bacteria 7802
97 Ga0068861_100049622 3300005719 Bacteria 3179
98 Ga0068861_100120653 3300005719 Bacteria 2115
99 Ga0068861_100327306 3300005719 Bacteria 1336
100 Ga0068863_100014565 3300005841 Bacteria 7570
101 Ga0068863_100015407 3300005841 Bacteria 7350
102 Ga0068863_100026538 3300005841 Bacteria 5524
103 Ga0068858_100022818 3300005842 Bacteria 5837
104 Ga0068860_100105066 3300005843 Bacteria 2697
105 Ga0068860_100404946 3300005843 Bacteria 1350
106 Ga0070715_10122615 3300006163 Bacteria 1241
107 Ga0075366_10029001 3300006195 Bacteria 3249
108 Ga0075366_10294222 3300006195 Bacteria 993
109 Ga0097621_100003853 3300006237 Bacteria 10388
110 Ga0097621_100142044 3300006237 Bacteria 2052
111 Ga0097621_100798704 3300006237 Unclassified 874
112 Ga0068871_100001362 3300006358 Bacteria 16385
113 Ga0068871_100006256 3300006358 Bacteria 8397
114 Ga0068871_100034981 3300006358 Bacteria 3989
115 Ga0068871_100456376 3300006358 Unclassified 1146
116 Ga0075428_100025910 3300006844 Bacteria 6494
117 Ga0075430_100165932 3300006846 Unclassified 1837
118 Ga0075434_100123423 3300006871 Unclassified 2606
119 Ga0075429_100007833 3300006880 Bacteria 9278
120 Ga0068865_100143125 3300006881 Bacteria 1805
121 Ga0068865_100448872 3300006881 Bacteria 1066
122 Ga0097620_100000289 3300006931 Bacteria 49979
123 Ga0097620_100030115 3300006931 Bacteria 5445
124 Ga0097620_100427349 3300006931 Bacteria 1421
125 Ga0097620_100716773 3300006931 Bacteria 1090
126 Ga0105250_10023467 3300009092 Bacteria 2485
127 Ga0105240_10000736 3300009093 Bacteria 59883
128 Ga0105240_10086615 3300009093 Bacteria 3836
129 Ga0111539_10002241 3300009094 Bacteria 25812
130 Ga0111539_10474800 3300009094 Bacteria 1456
131 Ga0111539_10493637 3300009094 Unclassified 1426
132 Ga0105247_10004821 3300009101 Bacteria 8586
133 Ga0114129_10312346 3300009147 Bacteria 2092
134 Ga0114129_10385111 3300009147 Unclassified 1851
135 Ga0105243_10359034 3300009148 Bacteria 1340
136 Ga0105242_10004825 3300009176 Bacteria 10437
137 Ga0105242_10007012 3300009176 Bacteria 8700
138 Ga0105242_10040956 3300009176 Bacteria 3734
139 Ga0105242_10090674 3300009176 Bacteria 2572
140 Ga0105242_10148757 3300009176 Bacteria 2040
141 Ga0105242_10171782 3300009176 Unclassified 1906
142 Ga0105248_10012442 3300009177 Bacteria 9387
143 Ga0105237_10655868 3300009545 Bacteria 1056
144 Ga0105249_10002125 3300009553 Bacteria 17191
145 Ga0105249_10015556 3300009553 Bacteria 6737
146 Ga0105249_10020768 3300009553 Bacteria 5873
147 Ga0105249_10022815 3300009553 Bacteria 5611
148 Ga0105249_10244085 3300009553 Bacteria 1777
149 Ga0105249_10251679 3300009553 Bacteria 1752
150 Ga0105249_10258348 3300009553 Unclassified 1730
151 Ga0105239_10001466 3300010375 Bacteria 31358
152 Ga0105239_11207894 3300010375 Bacteria 871
153 Ga0157373_10004933 3300013100 Bacteria 10041
154 Ga0157373_10012873 3300013100 Bacteria 6144
155 Ga0157371_10000259 3300013102 Bacteria 72716
156 Ga0157371_10000662 3300013102 Bacteria 40921
157 Ga0157371_10007523 3300013102 Bacteria 8813
158 Ga0157371_10010648 3300013102 Bacteria 7145
159 Ga0157371_10011660 3300013102 Bacteria 6755
160 Ga0157371_10015587 3300013102 Bacteria 5697
161 Ga0157371_10204334 3300013102 Bacteria 1417
162 Ga0157370_10002098 3300013104 Bacteria 24348
163 Ga0157370_10005549 3300013104 Bacteria 14145
164 Ga0157370_10054037 3300013104 Bacteria 3829
165 Ga0157370_10170060 3300013104 Bacteria 2026
166 Ga0157370_10263681 3300013104 Bacteria 1592
167 Ga0157370_10276103 3300013104 Bacteria 1553
168 Ga0157370_10284979 3300013104 Bacteria 1526
169 Ga0157370_10670860 3300013104 Bacteria 947
170 Ga0157370_10804459 3300013104 Unclassified 855
171 Ga0157369_10000019 3300013105 Bacteria 243437
172 Ga0157369_10061688 3300013105 Bacteria 4041
173 Ga0157369_10123173 3300013105 Bacteria 2750
174 Ga0157369_10201620 3300013105 Unclassified 2088
175 Ga0157374_10000013 3300013296 Bacteria 461240
176 Ga0157374_10002178 3300013296 Bacteria 16512
177 Ga0157374_10187990 3300013296 Bacteria 2020
178 Ga0157374_10717277 3300013296 Bacteria 1014
179 Ga0157378_10007311 3300013297 Bacteria 9643
180 Ga0157378_10007480 3300013297 Bacteria 9541
181 Ga0157378_10171399 3300013297 Bacteria 2035
182 Ga0157378_10222268 3300013297 Bacteria 1796
183 Ga0157378_10246397 3300013297 Bacteria 1709
184 Ga0163162_10007125 3300013306 Bacteria 10851
185 Ga0163162_10131007 3300013306 Bacteria 2616
186 Ga0163162_10131140 3300013306 Bacteria 2615
187 Ga0163162_10151780 3300013306 Bacteria 2435
188 Ga0163162_10157442 3300013306 Bacteria 2392
189 Ga0163162_10212299 3300013306 Bacteria 2065
190 Ga0157372_10062544 3300013307 Bacteria 4171
191 Ga0157372_10573467 3300013307 Bacteria 1315
192 Ga0157372_10676598 3300013307 Bacteria 1201
193 Ga0157375_10000684 3300013308 Bacteria 30041
194 Ga0157375_10004252 3300013308 Bacteria 12418
195 Ga0157375_10279785 3300013308 Bacteria 1832
196 Ga0157375_10465275 3300013308 Bacteria 1430
197 Ga0157375_10649919 3300013308 Bacteria 1211
198 Ga0157375_10676623 3300013308 Bacteria 1187
199 Ga0163163_10000952 3300014325 Bacteria 24583
200 Ga0163163_10020646 3300014325 Bacteria 6207
201 Ga0157380_10005348 3300014326 Bacteria 8972
202 Ga0157380_10006312 3300014326 Bacteria 8330
203 Ga0157380_10134472 3300014326 Bacteria 2114
204 Ga0157380_10409625 3300014326 Bacteria 1289
205 Ga0157380_10409840 3300014326 Bacteria 1289
206 Ga0182008_10000005 3300014497 Bacteria 386556
207 Ga0157377_10011036 3300014745 Bacteria 4494
208 Ga0157377_10110077 3300014745 Bacteria 1654
209 Ga0157379_10054368 3300014968 Bacteria 3577
210 Ga0157379_10116047 3300014968 Bacteria 2407
211 Ga0157376_10000762 3300014969 Bacteria 21000
212 Ga0157376_10009911 3300014969 Bacteria 6949
213 Ga0157376_10284396 3300014969 Bacteria 1559
214 Ga0182006_1000001 3300015261 Bacteria 1091090
215 Ga0182005_1000043 3300015265 Bacteria 140285
216 Ga0163161_10006070 3300017792 Bacteria 8373
217 Ga0163161_10006402 3300017792 Bacteria 8155
218 Ga0163161_10047669 3300017792 Bacteria 3094
219 Ga0163161_10150905 3300017792 Bacteria 1766
220 Ga0163161_10191984 3300017792 Bacteria 1571
221 Ga0213876_10000389 3300021384 Bacteria 36929
222 Ga0213876_10058276 3300021384 Bacteria 2038
223 Ga0213875_10243027 3300021388 Bacteria 848
224 Ga0213871_10008095 3300021441 Bacteria 2303
225 Ga0209436_102020 3300025208 Bacteria 6418
226 Ga0209258_100032 3300025242 Bacteria 452764
227 Ga0209148_1000131 3300025254 Bacteria 174079
228 Ga0209130_1001352 3300025284 Bacteria 16585
229 Ga0207426_1000033 3300025302 Bacteria 455976
230 Ga0207426_1004474 3300025302 Bacteria 6789
231 Ga0209257_1000070 3300025304 Bacteria 336454
232 Ga0207656_10043164 3300025321 Bacteria 1922
233 Ga0207656_10098652 3300025321 Bacteria 1336
234 Ga0207642_10036988 3300025899 Bacteria 2100
235 Ga0207710_10013604 3300025900 Bacteria 3423
236 Ga0207647_10000025 3300025904 Bacteria 112150
237 Ga0207645_10027598 3300025907 Bacteria 3664
238 Ga0207645_10067428 3300025907 Bacteria 2287
239 Ga0207645_10163724 3300025907 Unclassified 1456
240 Ga0207643_10022025 3300025908 Bacteria 3506
241 Ga0207643_10025183 3300025908 Bacteria 3287
242 Ga0207705_10274964 3300025909 Unclassified 1288
243 Ga0207695_10000010 3300025913 Bacteria 981919
244 Ga0207695_10080791 3300025913 Bacteria 3291
245 Ga0207662_10112057 3300025918 Bacteria 1702
246 Ga0207662_10228899 3300025918 Bacteria 1213
247 Ga0207657_10207600 3300025919 Bacteria 1573
248 Ga0207649_10031264 3300025920 Bacteria 3163
249 Ga0207649_10033031 3300025920 Bacteria 3089
250 Ga0207649_10040436 3300025920 Bacteria 2834
251 Ga0207652_10084317 3300025921 Bacteria 2784
252 Ga0207646_10500899 3300025922 Bacteria 1094
253 Ga0207681_10122698 3300025923 Bacteria 1908
254 Ga0207650_10001384 3300025925 Bacteria 17494
255 Ga0207650_10369052 3300025925 Bacteria 1184
256 Ga0207644_10320835 3300025931 Bacteria 1252
257 Ga0207644_10547141 3300025931 Bacteria 958
258 Ga0207690_10008989 3300025932 Bacteria 5929
259 Ga0207706_10039659 3300025933 Bacteria 4175
260 Ga0207706_10265769 3300025933 Bacteria 1497
261 Ga0207686_10002599 3300025934 Bacteria 9795
262 Ga0207686_10053195 3300025934 Bacteria 2530
263 Ga0207686_10073436 3300025934 Unclassified 2207
264 Ga0207704_10142742 3300025938 Bacteria 1678
265 Ga0207704_10457473 3300025938 Bacteria 1020
266 Ga0207691_10023513 3300025940 Bacteria 5803
267 Ga0207691_10180973 3300025940 Unclassified 1842
268 Ga0207691_10305037 3300025940 Bacteria 1367
269 Ga0207691_10359916 3300025940 Bacteria 1244
270 Ga0207711_10148555 3300025941 Bacteria 2113
271 Ga0207689_10094435 3300025942 Bacteria 2456
272 Ga0207689_10177087 3300025942 Bacteria 1759
273 Ga0207689_10196877 3300025942 Unclassified 1663
274 Ga0207689_10315060 3300025942 Unclassified 1298
275 Ga0207661_10055000 3300025944 Bacteria 3190
276 Ga0207661_10091897 3300025944 Bacteria 2529
277 Ga0207679_10115486 3300025945 Bacteria 2127
278 Ga0207679_10217247 3300025945 Bacteria 1607
279 Ga0207679_10220609 3300025945 Bacteria 1595
280 Ga0207651_10047203 3300025960 Bacteria 2902
281 Ga0207651_10163223 3300025960 Bacteria 1749
282 Ga0207712_10004285 3300025961 Bacteria 9002
283 Ga0207712_10006820 3300025961 Bacteria 7206
284 Ga0207712_10026089 3300025961 Bacteria 3890
285 Ga0207712_10028418 3300025961 Bacteria 3741
286 Ga0207712_10082848 3300025961 Bacteria 2339
287 Ga0207712_10159409 3300025961 Bacteria 1752
288 Ga0207712_10173121 3300025961 Bacteria 1689
289 Ga0207712_10488200 3300025961 Bacteria 1051
290 Ga0207668_10051184 3300025972 Bacteria 2851
291 Ga0207668_10310106 3300025972 Bacteria 1306
292 Ga0207658_10243639 3300025986 Bacteria 1524
293 Ga0207658_10283664 3300025986 Bacteria 1421
294 Ga0207658_10291640 3300025986 Bacteria 1402
295 Ga0207658_10331957 3300025986 Bacteria 1319
296 Ga0207658_10378493 3300025986 Bacteria 1239
297 Ga0207677_10183817 3300026023 Bacteria 1647
298 Ga0207677_10194351 3300026023 Bacteria 1607
299 Ga0207703_10019247 3300026035 Bacteria 5332
300 Ga0207703_10298139 3300026035 Bacteria 1469
301 Ga0207639_10005493 3300026041 Bacteria 8570
302 Ga0207639_10023235 3300026041 Bacteria 4476
303 Ga0207639_10103280 3300026041 Bacteria 2309
304 Ga0207639_10471542 3300026041 Bacteria 1143
305 Ga0207639_10475683 3300026041 Bacteria 1138
306 Ga0207708_10061005 3300026075 Bacteria 2879
307 Ga0207641_10001198 3300026088 Bacteria 25980
308 Ga0207641_10017464 3300026088 Bacteria 5875
309 Ga0207641_10056899 3300026088 Bacteria 3325
310 Ga0207641_10833972 3300026088 Bacteria 913
311 Ga0207648_10009134 3300026089 Bacteria 9529
312 Ga0207648_10030518 3300026089 Bacteria 4773
313 Ga0207648_10034587 3300026089 Bacteria 4453
314 Ga0207648_10437341 3300026089 Bacteria 1189
315 Ga0207676_10008331 3300026095 Bacteria 7369
316 Ga0207676_10016005 3300026095 Bacteria 5427
317 Ga0207676_10347620 3300026095 Unclassified 1370
318 Ga0207676_10414594 3300026095 Bacteria 1262
319 Ga0207674_10252203 3300026116 Bacteria 1712
320 Ga0207675_100000144 3300026118 Bacteria 61517
321 Ga0207675_100017325 3300026118 Bacteria 6725
322 Ga0207675_100055992 3300026118 Bacteria 3679
323 Ga0207683_10339075 3300026121 Bacteria 1378
324 Ga0207698_10028041 3300026142 Bacteria 4009
325 Ga0207698_10058496 3300026142 Bacteria 2988
326 Ga0207698_10443443 3300026142 Bacteria 1251
327 Ga0207698_10540926 3300026142 Bacteria 1140
328 Ga0209968_1014838 3300027526 Bacteria 1228
329 Ga0268265_10090303 3300028380 Unclassified 2447
330 Ga0268264_10072297 3300028381 Unclassified 2925
331 Ga0268264_10170716 3300028381 Bacteria 1967
332 Ga0307515_10000001 3300028794 Bacteria 4259510
333 Ga0265338_10001033 3300028800 Bacteria 46557
334 Ga0265332_10084839 3300031238 Bacteria 1342
335 Ga0265325_10000198 3300031241 Bacteria 42643
336 Ga0265339_10013697 3300031249 Bacteria 4911
337 Ga0265327_10000022 3300031251 Bacteria 402724
338 Ga0265327_10000024 3300031251 Bacteria 382499
339 Ga0265327_10079112 3300031251 Bacteria 1628
340 Ga0265327_10171958 3300031251 Unclassified 995
341 Ga0265316_10046202 3300031344 Bacteria 3452
342 Ga0307509_10189895 3300031507 Bacteria 1906
343 Ga0307408_100000561 3300031548 Bacteria 32112
344 Ga0265313_10000067 3300031595 Bacteria 101468
345 Ga0265314_10000747 3300031711 Bacteria 38942
346 Ga0265314_10056015 3300031711 Bacteria 2717
347 Ga0265342_10008640 3300031712 Bacteria 7281
348 Ga0307516_10214953 3300031730 Bacteria 1635
349 Ga0307413_10300924 3300031824 Unclassified 1216
350 Ga0307410_10056805 3300031852 Bacteria 2663
351 Ga0307410_10058271 3300031852 Bacteria 2633
352 Ga0307406_10183954 3300031901 Bacteria 1524
353 Ga0307406_10418371 3300031901 Unclassified 1067
354 Ga0307412_10000940 3300031911 Bacteria 16662
355 Ga0307414_10000025 3300032004 Bacteria 199049
356 Ga0307414_10239594 3300032004 Unclassified 1501
357 Ga0307414_10267137 3300032004 Bacteria 1431
358 Ga0307411_10135499 3300032005 Unclassified 1807
359 Ga0373937_0639355 3300036401 Bacteria 1009
360 Ga0395899_0000159 3300037312 Bacteria 102831
361 Ga0395900_0042209 3300037418 Bacteria 4699
362 Ga0395905_0030145 3300037471 Bacteria 5113
363 Ga0395905_0076894 3300037471 Bacteria 3128
364 Ga0395905_0307631 3300037471 Bacteria 1473
365 Ga0436364_0149929 3300037853 Bacteria 5756
366 Ga0436365_1933142 3300039437 Bacteria 64226
367 Ga0436360_0859625 3300039438 Bacteria 2537
368 Ga0436360_1080886 3300039438 Unclassified 1950
369 Ga0436360_1365212 3300039438 Bacteria 1071
370 Ga0436363_0802353 3300039450 Bacteria 1175
371 Ga0436362_0813726 3300039453 Bacteria 3478
372 Ga0436362_0907640 3300039453 Bacteria 3708
373 Ga0439466_0107356 3300041411 Bacteria 867
374 Ga0439465_0000064 3300041413 Bacteria 22977
375 Ga0439441_002825 3300042001 Bacteria 2486
376 Ga0439444_0018970 3300042437 Bacteria 1196
377 Ga0439444_0034885 3300042437 Bacteria 962
378 Ga0451577_0002492 3300042876 Bacteria 21860
379 Ga0451577_0187532 3300042876 Bacteria 1865
380 Ga0451577_0635371 3300042876 Bacteria 968
381 Ga0453684_0077237 3300044712 Bacteria 4176
382 Ga0466968_0265582 3300044735 Bacteria 818
383 Ga0466970_0375450 3300044765 Bacteria 809
384 Ga0466957_0530479 3300044842 Bacteria 819
385 Ga0466959_0242346 3300045049 Bacteria 1245
386 Ga0495627_001596 3300046453 Bacteria 12710
387 Ga0495590_0000609 3300046457 Bacteria 16704
388 Ga0495650_0023122 3300046471 Bacteria 2965
389 Ga0495580_0000222 3300046472 Bacteria 44042
390 Ga0495582_0005026 3300046473 Bacteria 7414
391 Ga0495594_0005429 3300046499 Bacteria 6550
392 Ga0495606_0004494 3300046507 Bacteria 13905
393 Ga0495606_0036037 3300046507 Bacteria 3376
394 Ga0495663_0000018 3300046525 Bacteria 131320
395 Ga0495663_0002881 3300046525 Bacteria 5084
396 Ga0495666_0051261 3300046526 Unclassified 1983
397 Ga0495609_0000003 3300046538 Bacteria 711547
398 Ga0495633_0000133 3300046558 Bacteria 100207
399 Ga0495668_0000082 3300046616 Bacteria 154982
400 Ga0495658_0291989 3300046683 Unclassified 1030
401 Ga0495670_0083629 3300046691 Bacteria 1628
402 Ga0495636_0000624 3300047318 Bacteria 12986
403 Ga0495636_0148530 3300047318 Unclassified 1050
404 Ga0495672_0015364 3300047320 Bacteria 5201
405 Ga0495672_0020228 3300047320 Bacteria 4367
406 Ga0496100_0045899 3300048903 Bacteria 2806
407 Ga0496108_0351043 3300048911 Bacteria 1287
408 Ga0496109_0790571 3300048912 Bacteria 887
409 Ga0496110_0346283 3300048913 Bacteria 1354
410 Ga0496114_0168417 3300048917 Bacteria 1908
411 Ga0496121_0000086 3300048924 Bacteria 223703
412 Ga0496125_0046656 3300048928 Bacteria 3633
413 Ga0496126_0079092 3300048929 Bacteria 2912
414 Ga0501031_0013534 3300049568 Bacteria 5316
415 Ga0501032_0048356 3300049569 Bacteria 2872
416 Ga0501034_0022823 3300049571 Bacteria 6374
417 Ga0501037_0007206 3300049573 Bacteria 8126
418 Ga0501046_0070538 3300049580 Bacteria 2717
419 Ga0501251_001967 3300049681 Bacteria 1952
420 Ga0501251_015321 3300049681 Bacteria 962
421 Ga0501241_000483 3300049758 Bacteria 8643
422 Ga0501269_000071 3300049766 Bacteria 31699
423 Ga0501035_0104588 3300049822 Bacteria 2483
424 Ga0501035_0230002 3300049822 Bacteria 1580
425 nmdc:mga0k408_188791_c1 3300050493 Bacteria 1229
426 nmdc:mga05p37_35535_c2 3300050507 Unclassified 2605
427 nmdc:mga09592_4183_c1 3300050508 Bacteria 11657
428 nmdc:mga06r32_163845_c1 3300050510 Bacteria 2206
429 nmdc:mga08y16_346974_c1 3300050511 Unclassified 1525
430 nmdc:mga08y16_598256_c1 3300050511 Unclassified 1112
431 nmdc:mga08y16_720415_c1 3300050511 Bacteria 996
432 nmdc:mga0n895_216302_c1 3300050512 Unclassified 1946
433 Ga0495601_0063795 3300053077 Bacteria 2342
434 Ga0500644_0000280 3300053088 Bacteria 28313
435 Ga0500581_105404 3300053089 Bacteria 1381
436 Ga0500646_0001598 3300053090 Bacteria 5977
437 Ga0500618_013173 3300053125 Bacteria 2146
438 Ga0500559_0068810 3300053136 Bacteria 1591
439 Ga0500568_0005058 3300053139 Bacteria 6907
440 Ga0500622_0000157 3300053156 Bacteria 71381
441 Ga0500634_0016596 3300053161 Bacteria 3931
442 Ga0500636_0020890 3300053177 Bacteria 3876
443 Ga0500611_000001 3300053727 Bacteria 385744
444 Ga0500645_039487 3300053730 Bacteria 1398
445 Ga0500661_011263 3300055283 Bacteria 1619
446 2524006467 2523533629 Bacteria 2982326
447 2585426749 2582581873 Bacteria 3032664
448 2587753049 2585428061 Bacteria 3939663
449 2587866143 2585428095 Bacteria 3789702
450 2590609707 2588254257 Bacteria 5436094
451 2729201290 2728369107 Bacteria 5082720
452 2738698725 2738541273 Bacteria 4048577
453 2739253051 2738543014 Bacteria 4048139
454 2740033642 2739367866 Bacteria 4215900
455 2740059993 2739367874 Bacteria 4872888
456 2819574834 2818991442 Bacteria 8318214
457 2819676761 2818991460 Bacteria 7595395
458 2821140933 2821136567 Bacteria 8080116
459 2840678931 2840677318 Bacteria 2664183
460 2881956477 2881955468 Bacteria 3545609
461 2884796617 2884791551 Bacteria 8511252
462 2890807359 2890804823 Bacteria 3717572
463 2896086745 2896085136 Bacteria 6129793
464 2896112916 2896109856 Bacteria 7140722
465 2904471433 2904467357 Bacteria 8057758
466 2905999466 2905999023 Bacteria 4591259
467 2919401729 2919399522 Bacteria 5164947
468 2929159267 2929154850 Bacteria 6753285
469 2929177860 2929177148 Bacteria 7883697
470 2929240213 2929239360 Bacteria 7745570
471 2945980209 2945977869 Bacteria 7777518
472 2946013927 2946013367 Bacteria 7766675
473 Ga0065715_10089603
474 SwRhRL2b_contig_1663676
475 JGI24736J21556_1001454
476 JGI24737J22298_10049366
477 JGI24744J21845_10006311
478 JGI24751J29686_10004180
479 JGI25159J45721_1028406
480 rootH2_10168289
481 rootL2_10032704
482 rootL2_10054012
483 rootH1_10262240
484 JGI25160J50197_1018426
485 Ga0055535_1011085
486 Ga0055531_10000173
487 Ga0065165_1004393
488 Ga0065714_10064782
489 Ga0065714_10098281
490 Ga0065704_10070136
491 Ga0065704_10077198
492 Ga0065704_10088338
493 Ga0065712_10034132
494 Ga0065712_10114148
495 Ga0065712_10209252
496 Ga0065715_10230567
497 Ga0065707_10120212
498 Ga0065707_10196508
499 Ga0070658_10258100
500 Ga0070676_10026898
501 Ga0070683_100013501
502 Ga0070683_100014613
503 Ga0070683_100036567
504 Ga0070670_100033530
505 Ga0070677_10030009
506 Ga0068869_100010790
507 Ga0068869_100164332
508 Ga0068869_100460231
509 Ga0070682_100000012
510 Ga0068868_100102993
511 Ga0070689_100256813
512 Ga0070668_100537428
513 Ga0070669_100001547
514 Ga0070675_100556707
515 Ga0070671_100058222
516 Ga0070673_100113660
517 Ga0070673_100310393
518 Ga0070688_100004079
519 Ga0070688_100033873
520 Ga0070659_100004626
521 Ga0070667_100010126
522 Ga0070667_100010540
523 Ga0070667_100538779
524 Ga0070701_10035319
525 Ga0070700_100680674
526 Ga0070678_100656743
527 Ga0070662_100150351
528 Ga0070681_10148493
529 Ga0068867_100002786
530 Ga0068867_100053778
531 Ga0068867_100425034
532 Ga0068867_100571862
533 Ga0070685_10003838
534 Ga0070685_10011167
535 Ga0070685_10389701
536 Ga0070706_100342790
537 Ga0070698_100002783
538 Ga0070698_100010416
539 Ga0070699_100488058
540 Ga0070684_100185756
541 Ga0068853_100003660
542 Ga0068853_100084111
543 Ga0068853_100129594
544 Ga0068853_100188181
545 Ga0068853_100505698
546 Ga0070672_100288881
547 Ga0070686_100456761
548 Ga0070704_100478877
549 Ga0070664_100001578
550 Ga0070664_100249856
551 Ga0068857_100042607
552 Ga0068857_100065211
553 Ga0068857_100205849
554 Ga0068857_100607848
555 Ga0068852_100000417
556 Ga0068852_100212472
557 Ga0068852_100223677
558 Ga0068852_100623573
559 Ga0068852_100847533
560 Ga0068859_100000289
561 Ga0068859_100030120
562 Ga0068859_100427335
563 Ga0068859_100716819
564 Ga0068864_100011571
565 Ga0068864_100028898
566 Ga0068864_100048273
567 Ga0068864_100670233
568 Ga0068861_100006815
569 Ga0068861_100049622
570 Ga0068861_100120653
571 Ga0068861_100327306
572 Ga0068863_100014565
573 Ga0068863_100015407
574 Ga0068863_100026538
575 Ga0068858_100022818
576 Ga0068860_100105066
577 Ga0068860_100404946
578 Ga0070715_10122615
579 Ga0075366_10029001
580 Ga0075366_10294222
581 Ga0097621_100003853
582 Ga0097621_100142044
583 Ga0097621_100798704
584 Ga0068871_100001362
585 Ga0068871_100006256
586 Ga0068871_100034981
587 Ga0068871_100456376
588 Ga0075428_100025910
589 Ga0075430_100165932
590 Ga0075434_100123423
591 Ga0075429_100007833
592 Ga0068865_100143125
593 Ga0068865_100448872
594 Ga0097620_100000289
595 Ga0097620_100030115
596 Ga0097620_100427349
597 Ga0097620_100716773
598 Ga0105250_10023467
599 Ga0105240_10000736
600 Ga0105240_10086615
601 Ga0111539_10002241
602 Ga0111539_10474800
603 Ga0111539_10493637
604 Ga0105247_10004821
605 Ga0114129_10312346
606 Ga0114129_10385111
607 Ga0105243_10359034
608 Ga0105242_10004825
609 Ga0105242_10007012
610 Ga0105242_10040956
611 Ga0105242_10090674
612 Ga0105242_10148757
613 Ga0105242_10171782
614 Ga0105248_10012442
615 Ga0105237_10655868
616 Ga0105249_10002125
617 Ga0105249_10015556
618 Ga0105249_10020768
619 Ga0105249_10022815
620 Ga0105249_10244085
621 Ga0105249_10251679
622 Ga0105249_10258348
623 Ga0105239_10001466
624 Ga0105239_11207894
625 Ga0157373_10004933
626 Ga0157373_10012873
627 Ga0157371_10000259
628 Ga0157371_10000662
629 Ga0157371_10007523
630 Ga0157371_10010648
631 Ga0157371_10011660
632 Ga0157371_10015587
633 Ga0157371_10204334
634 Ga0157370_10002098
635 Ga0157370_10005549
636 Ga0157370_10054037
637 Ga0157370_10170060
638 Ga0157370_10263681
639 Ga0157370_10276103
640 Ga0157370_10284979
641 Ga0157370_10670860
642 Ga0157370_10804459
643 Ga0157369_10000019
644 Ga0157369_10061688
645 Ga0157369_10123173
646 Ga0157369_10201620
647 Ga0157374_10000013
648 Ga0157374_10002178
649 Ga0157374_10187990
650 Ga0157374_10717277
651 Ga0157378_10007311
652 Ga0157378_10007480
653 Ga0157378_10171399
654 Ga0157378_10222268
655 Ga0157378_10246397
656 Ga0163162_10007125
657 Ga0163162_10131007
658 Ga0163162_10131140
659 Ga0163162_10151780
660 Ga0163162_10157442
661 Ga0163162_10212299
662 Ga0157372_10062544
663 Ga0157372_10573467
664 Ga0157372_10676598
665 Ga0157375_10000684
666 Ga0157375_10004252
667 Ga0157375_10279785
668 Ga0157375_10465275
669 Ga0157375_10649919
670 Ga0157375_10676623
671 Ga0163163_10000952
672 Ga0163163_10020646
673 Ga0157380_10005348
674 Ga0157380_10006312
675 Ga0157380_10134472
676 Ga0157380_10409625
677 Ga0157380_10409840
678 Ga0182008_10000005
679 Ga0157377_10011036
680 Ga0157377_10110077
681 Ga0157379_10054368
682 Ga0157379_10116047
683 Ga0157376_10000762
684 Ga0157376_10009911
685 Ga0157376_10284396
686 Ga0182006_1000001
687 Ga0182005_1000043
688 Ga0163161_10006070
689 Ga0163161_10006402
690 Ga0163161_10047669
691 Ga0163161_10150905
692 Ga0163161_10191984
693 Ga0213876_10000389
694 Ga0213876_10058276
695 Ga0213875_10243027
696 Ga0213871_10008095
697 Ga0209436_102020
698 Ga0209258_100032
699 Ga0209148_1000131
700 Ga0209130_1001352
701 Ga0207426_1000033
702 Ga0207426_1004474
703 Ga0209257_1000070
704 Ga0207656_10043164
705 Ga0207656_10098652
706 Ga0207642_10036988
707 Ga0207710_10013604
708 Ga0207647_10000025
709 Ga0207645_10027598
710 Ga0207645_10067428
711 Ga0207645_10163724
712 Ga0207643_10022025
713 Ga0207643_10025183
714 Ga0207705_10274964
715 Ga0207695_10000010
716 Ga0207695_10080791
717 Ga0207662_10112057
718 Ga0207662_10228899
719 Ga0207657_10207600
720 Ga0207649_10031264
721 Ga0207649_10033031
722 Ga0207649_10040436
723 Ga0207652_10084317
724 Ga0207646_10500899
725 Ga0207681_10122698
726 Ga0207650_10001384
727 Ga0207650_10369052
728 Ga0207644_10320835
729 Ga0207644_10547141
730 Ga0207690_10008989
731 Ga0207706_10039659
732 Ga0207706_10265769
733 Ga0207686_10002599
734 Ga0207686_10053195
735 Ga0207686_10073436
736 Ga0207704_10142742
737 Ga0207704_10457473
738 Ga0207691_10023513
739 Ga0207691_10180973
740 Ga0207691_10305037
741 Ga0207691_10359916
742 Ga0207711_10148555
743 Ga0207689_10094435
744 Ga0207689_10177087
745 Ga0207689_10196877
746 Ga0207689_10315060
747 Ga0207661_10055000
748 Ga0207661_10091897
749 Ga0207679_10115486
750 Ga0207679_10217247
751 Ga0207679_10220609
752 Ga0207651_10047203
753 Ga0207651_10163223
754 Ga0207712_10004285
755 Ga0207712_10006820
756 Ga0207712_10026089
757 Ga0207712_10028418
758 Ga0207712_10082848
759 Ga0207712_10159409
760 Ga0207712_10173121
761 Ga0207712_10488200
762 Ga0207668_10051184
763 Ga0207668_10310106
764 Ga0207658_10243639
765 Ga0207658_10283664
766 Ga0207658_10291640
767 Ga0207658_10331957
768 Ga0207658_10378493
769 Ga0207677_10183817
770 Ga0207677_10194351
771 Ga0207703_10019247
772 Ga0207703_10298139
773 Ga0207639_10005493
774 Ga0207639_10023235
775 Ga0207639_10103280
776 Ga0207639_10471542
777 Ga0207639_10475683
778 Ga0207708_10061005
779 Ga0207641_10001198
780 Ga0207641_10017464
781 Ga0207641_10056899
782 Ga0207641_10833972
783 Ga0207648_10009134
784 Ga0207648_10030518
785 Ga0207648_10034587
786 Ga0207648_10437341
787 Ga0207676_10008331
788 Ga0207676_10016005
789 Ga0207676_10347620
790 Ga0207676_10414594
791 Ga0207674_10252203
792 Ga0207675_100000144
793 Ga0207675_100017325
794 Ga0207675_100055992
795 Ga0207683_10339075
796 Ga0207698_10028041
797 Ga0207698_10058496
798 Ga0207698_10443443
799 Ga0207698_10540926
800 Ga0209968_1014838
801 Ga0268265_10090303
802 Ga0268264_10072297
803 Ga0268264_10170716
804 Ga0307515_10000001
805 Ga0265338_10001033
806 Ga0265332_10084839
807 Ga0265325_10000198
808 Ga0265339_10013697
809 Ga0265327_10000022
810 Ga0265327_10000024
811 Ga0265327_10079112
812 Ga0265327_10171958
813 Ga0265316_10046202
814 Ga0307509_10189895
815 Ga0307408_100000561
816 Ga0265313_10000067
817 Ga0265314_10000747
818 Ga0265314_10056015
819 Ga0265342_10008640
820 Ga0307516_10214953
821 Ga0307413_10300924
822 Ga0307410_10056805
823 Ga0307410_10058271
824 Ga0307406_10183954
825 Ga0307406_10418371
826 Ga0307412_10000940
827 Ga0307414_10000025
828 Ga0307414_10239594
829 Ga0307414_10267137
830 Ga0307411_10135499
831 Ga0373937_0639355
832 Ga0395899_0000159
833 Ga0395900_0042209
834 Ga0395905_0030145
835 Ga0395905_0076894
836 Ga0395905_0307631
837 Ga0436364_0149929
838 Ga0436365_1933142
839 Ga0436360_0859625
840 Ga0436360_1080886
841 Ga0436360_1365212
842 Ga0436363_0802353
843 Ga0436362_0813726
844 Ga0436362_0907640
845 Ga0439466_0107356
846 Ga0439465_0000064
847 Ga0439441_002825
848 Ga0439444_0018970
849 Ga0439444_0034885
850 Ga0451577_0002492
851 Ga0451577_0187532
852 Ga0451577_0635371
853 Ga0453684_0077237
854 Ga0466968_0265582
855 Ga0466970_0375450
856 Ga0466957_0530479
857 Ga0466959_0242346
858 Ga0495627_001596
859 Ga0495590_0000609
860 Ga0495650_0023122
861 Ga0495580_0000222
862 Ga0495582_0005026
863 Ga0495594_0005429
864 Ga0495606_0004494
865 Ga0495606_0036037
866 Ga0495663_0000018
867 Ga0495663_0002881
868 Ga0495666_0051261
869 Ga0495609_0000003
870 Ga0495633_0000133
871 Ga0495668_0000082
872 Ga0495658_0291989
873 Ga0495670_0083629
874 Ga0495636_0000624
875 Ga0495636_0148530
876 Ga0495672_0015364
877 Ga0495672_0020228
878 Ga0496100_0045899
879 Ga0496108_0351043
880 Ga0496109_0790571
881 Ga0496110_0346283
882 Ga0496114_0168417
883 Ga0496121_0000086
884 Ga0496125_0046656
885 Ga0496126_0079092
886 Ga0501031_0013534
887 Ga0501032_0048356
888 Ga0501034_0022823
889 Ga0501037_0007206
890 Ga0501046_0070538
891 Ga0501251_001967
892 Ga0501251_015321
893 Ga0501241_000483
894 Ga0501269_000071
895 Ga0501035_0104588
896 Ga0501035_0230002
897 nmdc:mga0k408_188791_c1
898 nmdc:mga05p37_35535_c2
899 nmdc:mga09592_4183_c1
900 nmdc:mga06r32_163845_c1
901 nmdc:mga08y16_346974_c1
902 nmdc:mga08y16_598256_c1
903 nmdc:mga08y16_720415_c1
904 nmdc:mga0n895_216302_c1
905 Ga0495601_0063795
906 Ga0500644_0000280
907 Ga0500581_105404
908 Ga0500646_0001598
909 Ga0500618_013173
910 Ga0500559_0068810
911 Ga0500568_0005058
912 Ga0500622_0000157
913 Ga0500634_0016596
914 Ga0500636_0020890
915 Ga0500611_000001
916 Ga0500645_039487
917 Ga0500661_011263
918 2524006467
919 2585426749
920 2587753049
921 2587866143
922 2590609707
923 2729201290
924 2738698725
925 2739253051
926 2740033642
927 2740059993
928 2819574834
929 2819676761
930 2821140933
931 2840678931
932 2881956477
933 2884796617
934 2890807359
935 2896086745
936 2896112916
937 2904471433
938 2905999466
939 2919401729
940 2929159267
941 2929177860
942 2929240213
943 2945980209
944 2946013927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

48

243

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

54

288

0.97

PF08659

KR

KR domain

48

231

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ijk-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.976 7 246
4ijk-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9734 7 246
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9684 3 248
3sj7-assembly1.cif.gz_A-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.967 7 248
2hq1-assembly1.cif.gz_A crystal structure of orf 1438 a putative glucose/ribitol dehydrogenase from clostridium thermocellum 0.9663 3 245
ID Description Score Start End Superfamily
2hq1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9663 3 245 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9653 7 248 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.963 4 248 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 7 248 3.40.50.720
af_A0A1D6J5I0_53_326_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.958 4 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1F6PTA4-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9847 2 92 GO:0016614
AF-A0A2V7V9Y5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9764 4 94 GO:0016020
AF-A0A3M1YKC1-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9707 1 248 GO:0004316
GO:0006633
GO:0051287
AF-A0A059WPT5-F1-model_v4 Short chain dehydrogenase 0.9702 5 144
AF-A0A3C1QWH6-F1-model_v4 Oxidoreductase 0.9693 1 92

Map