F450730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 472 | 230 | 472 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100800299|Ga0068869_1008002992 |
| Length | 110 |
| Sequence | MESGTAPASTARIRVVLPQHLQTLARVADREIAVDVAGVVTQRAVLDAVEARFPQLRGTIRDQATAKRRPFLRFFACEEDWSHAAPDDPLPATVASGTEPFLVVGAMAGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 183 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 184 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 185 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 194 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 222 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 223 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 225 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.31 |
| Metatranscriptomes | 1.69 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.69 |
| Nodule | 0 |
| Rhizoplane | 1.48 |
| Rhizosphere | 96.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10002694 | 3300002239 | Bacteria | 2448 |
| 2 | Ga0065707_10099766 | 3300005295 | Bacteria | 2981 |
| 3 | Ga0070658_10000510 | 3300005327 | Bacteria | 33665 |
| 4 | Ga0070658_10191226 | 3300005327 | Bacteria | 1725 |
| 5 | Ga0070676_10514487 | 3300005328 | Bacteria | 852 |
| 6 | Ga0070683_100203880 | 3300005329 | Bacteria | 1878 |
| 7 | Ga0070683_100339155 | 3300005329 | Bacteria | 1431 |
| 8 | Ga0070690_100242299 | 3300005330 | Bacteria | 1272 |
| 9 | Ga0070690_101166651 | 3300005330 | Bacteria | 613 |
| 10 | Ga0068869_100014654 | 3300005334 | Bacteria | 5243 |
| 11 | Ga0068869_100800299 | 3300005334 | Bacteria | 810 |
| 12 | Ga0070666_10984254 | 3300005335 | Bacteria | 625 |
| 13 | Ga0070680_100000189 | 3300005336 | Bacteria | 39692 |
| 14 | Ga0070680_100056506 | 3300005336 | Bacteria | 3208 |
| 15 | Ga0070682_100140820 | 3300005337 | Bacteria | 1644 |
| 16 | Ga0070682_100265257 | 3300005337 | Bacteria | 1245 |
| 17 | Ga0070682_101040813 | 3300005337 | Bacteria | 682 |
| 18 | Ga0068868_100000178 | 3300005338 | Bacteria | 42328 |
| 19 | Ga0070660_100174837 | 3300005339 | Bacteria | 1736 |
| 20 | Ga0070689_100031982 | 3300005340 | Bacteria | 4000 |
| 21 | Ga0070689_101386453 | 3300005340 | Bacteria | 635 |
| 22 | Ga0070691_10227641 | 3300005341 | Bacteria | 991 |
| 23 | Ga0070691_10530635 | 3300005341 | Bacteria | 685 |
| 24 | Ga0070687_101315750 | 3300005343 | Unclassified | 537 |
| 25 | Ga0070661_100002573 | 3300005344 | Bacteria | 12433 |
| 26 | Ga0070661_100027267 | 3300005344 | Bacteria | 4112 |
| 27 | Ga0070661_100188093 | 3300005344 | Bacteria | 1574 |
| 28 | Ga0070661_100697135 | 3300005344 | Unclassified | 827 |
| 29 | Ga0070661_100918530 | 3300005344 | Unclassified | 723 |
| 30 | Ga0070668_100196095 | 3300005347 | Bacteria | 1656 |
| 31 | Ga0070668_100924177 | 3300005347 | Bacteria | 781 |
| 32 | Ga0070669_100981604 | 3300005353 | Bacteria | 724 |
| 33 | Ga0070669_101160920 | 3300005353 | Bacteria | 666 |
| 34 | Ga0070675_100041499 | 3300005354 | Bacteria | 3758 |
| 35 | Ga0070675_100471467 | 3300005354 | Bacteria | 1128 |
| 36 | Ga0070671_100001359 | 3300005355 | Bacteria | 18333 |
| 37 | Ga0070671_100027814 | 3300005355 | Bacteria | 4655 |
| 38 | Ga0070674_100523189 | 3300005356 | Bacteria | 991 |
| 39 | Ga0070688_100128573 | 3300005365 | Bacteria | 1706 |
| 40 | Ga0070688_100359582 | 3300005365 | Bacteria | 1068 |
| 41 | Ga0070667_100025250 | 3300005367 | Bacteria | 4939 |
| 42 | Ga0070667_101387892 | 3300005367 | Bacteria | 659 |
| 43 | Ga0070709_10523010 | 3300005434 | Bacteria | 904 |
| 44 | Ga0070714_100420677 | 3300005435 | Bacteria | 1266 |
| 45 | Ga0070714_100514111 | 3300005435 | Bacteria | 1143 |
| 46 | Ga0070713_100001436 | 3300005436 | Bacteria | 15282 |
| 47 | Ga0070713_100942945 | 3300005436 | Bacteria | 831 |
| 48 | Ga0070711_100006753 | 3300005439 | Bacteria | 6945 |
| 49 | Ga0070705_100071844 | 3300005440 | Bacteria | 2094 |
| 50 | Ga0070700_100549329 | 3300005441 | Unclassified | 897 |
| 51 | Ga0070694_100167912 | 3300005444 | Bacteria | 1615 |
| 52 | Ga0070694_100621553 | 3300005444 | Bacteria | 872 |
| 53 | Ga0070694_100675973 | 3300005444 | Bacteria | 838 |
| 54 | Ga0070694_101593598 | 3300005444 | Bacteria | 554 |
| 55 | Ga0070708_100216288 | 3300005445 | Bacteria | 1796 |
| 56 | Ga0070663_100351051 | 3300005455 | Bacteria | 1194 |
| 57 | Ga0070678_100145026 | 3300005456 | Bacteria | 1905 |
| 58 | Ga0070662_101318992 | 3300005457 | Bacteria | 621 |
| 59 | Ga0070681_10000937 | 3300005458 | Bacteria | 24562 |
| 60 | Ga0070681_10274849 | 3300005458 | Bacteria | 1596 |
| 61 | Ga0070681_10579654 | 3300005458 | Bacteria | 1036 |
| 62 | Ga0070681_10999405 | 3300005458 | Bacteria | 756 |
| 63 | Ga0068867_101118104 | 3300005459 | Bacteria | 720 |
| 64 | Ga0070706_100415187 | 3300005467 | Bacteria | 1253 |
| 65 | Ga0070707_100335337 | 3300005468 | Bacteria | 1469 |
| 66 | Ga0070707_101174983 | 3300005468 | Bacteria | 733 |
| 67 | Ga0070698_100009744 | 3300005471 | Bacteria | 10268 |
| 68 | Ga0070698_100105083 | 3300005471 | Bacteria | 2794 |
| 69 | Ga0070698_100293378 | 3300005471 | Bacteria | 1557 |
| 70 | Ga0070698_100630919 | 3300005471 | Unclassified | 1012 |
| 71 | Ga0070699_101455072 | 3300005518 | Bacteria | 628 |
| 72 | Ga0070699_101793529 | 3300005518 | Unclassified | 562 |
| 73 | Ga0070679_100008583 | 3300005530 | Bacteria | 9629 |
| 74 | Ga0070679_100220306 | 3300005530 | Bacteria | 1859 |
| 75 | Ga0070679_100415489 | 3300005530 | Bacteria | 1291 |
| 76 | Ga0070684_100008389 | 3300005535 | Bacteria | 8072 |
| 77 | Ga0070684_100067730 | 3300005535 | Bacteria | 3137 |
| 78 | Ga0070684_100099411 | 3300005535 | Bacteria | 2597 |
| 79 | Ga0070684_100107399 | 3300005535 | Bacteria | 2500 |
| 80 | Ga0070684_100180576 | 3300005535 | Bacteria | 1919 |
| 81 | Ga0070697_100007718 | 3300005536 | Bacteria | 8381 |
| 82 | Ga0070697_100045968 | 3300005536 | Bacteria | 3539 |
| 83 | Ga0070697_100110767 | 3300005536 | Bacteria | 2287 |
| 84 | Ga0070697_100430867 | 3300005536 | Bacteria | 1147 |
| 85 | Ga0068853_100000048 | 3300005539 | Bacteria | 93122 |
| 86 | Ga0068853_100340180 | 3300005539 | Bacteria | 1394 |
| 87 | Ga0068853_100606064 | 3300005539 | Bacteria | 1040 |
| 88 | Ga0068853_101200130 | 3300005539 | Unclassified | 732 |
| 89 | Ga0070672_100707937 | 3300005543 | Bacteria | 882 |
| 90 | Ga0070695_100006076 | 3300005545 | Bacteria | 7136 |
| 91 | Ga0070695_101384644 | 3300005545 | Unclassified | 583 |
| 92 | Ga0070696_100851093 | 3300005546 | Bacteria | 754 |
| 93 | Ga0070696_101037698 | 3300005546 | Bacteria | 686 |
| 94 | Ga0070693_100798938 | 3300005547 | Bacteria | 699 |
| 95 | Ga0070665_100000225 | 3300005548 | Bacteria | 94249 |
| 96 | Ga0070665_100022857 | 3300005548 | Bacteria | 6296 |
| 97 | Ga0070665_100841517 | 3300005548 | Bacteria | 931 |
| 98 | Ga0070665_101109004 | 3300005548 | Bacteria | 803 |
| 99 | Ga0068855_100003334 | 3300005563 | Bacteria | 19648 |
| 100 | Ga0068855_100013025 | 3300005563 | Bacteria | 10033 |
| 101 | Ga0068855_100022704 | 3300005563 | Bacteria | 7518 |
| 102 | Ga0068855_100663533 | 3300005563 | Bacteria | 1119 |
| 103 | Ga0068855_100757348 | 3300005563 | Bacteria | 1035 |
| 104 | Ga0070664_100137038 | 3300005564 | Bacteria | 2153 |
| 105 | Ga0070664_101590269 | 3300005564 | Unclassified | 619 |
| 106 | Ga0068857_100015300 | 3300005577 | Bacteria | 6697 |
| 107 | Ga0068857_100052095 | 3300005577 | Bacteria | 3632 |
| 108 | Ga0068857_100161237 | 3300005577 | Bacteria | 2035 |
| 109 | Ga0068857_100857696 | 3300005577 | Bacteria | 869 |
| 110 | Ga0068854_100039895 | 3300005578 | Bacteria | 3310 |
| 111 | Ga0068854_100098439 | 3300005578 | Bacteria | 2189 |
| 112 | Ga0068856_100001672 | 3300005614 | Bacteria | 23230 |
| 113 | Ga0068856_100024476 | 3300005614 | Bacteria | 5879 |
| 114 | Ga0068856_100049147 | 3300005614 | Bacteria | 4157 |
| 115 | Ga0068856_100105400 | 3300005614 | Bacteria | 2813 |
| 116 | Ga0068856_100202476 | 3300005614 | Bacteria | 1999 |
| 117 | Ga0068856_100256138 | 3300005614 | Bacteria | 1765 |
| 118 | Ga0070702_100299495 | 3300005615 | Bacteria | 1112 |
| 119 | Ga0068852_100000076 | 3300005616 | Bacteria | 69262 |
| 120 | Ga0068852_100000105 | 3300005616 | Bacteria | 55996 |
| 121 | Ga0068852_100179738 | 3300005616 | Bacteria | 1989 |
| 122 | Ga0068852_100503771 | 3300005616 | Bacteria | 1206 |
| 123 | Ga0068852_101015400 | 3300005616 | Bacteria | 848 |
| 124 | Ga0068852_102302405 | 3300005616 | Unclassified | 560 |
| 125 | Ga0068859_100013866 | 3300005617 | Bacteria | 8082 |
| 126 | Ga0068859_100055512 | 3300005617 | Bacteria | 3986 |
| 127 | Ga0068859_100103018 | 3300005617 | Bacteria | 2912 |
| 128 | Ga0068859_100620489 | 3300005617 | Bacteria | 1174 |
| 129 | Ga0068864_100004282 | 3300005618 | Bacteria | 11732 |
| 130 | Ga0068864_100347716 | 3300005618 | Bacteria | 1398 |
| 131 | Ga0068864_101694478 | 3300005618 | Bacteria | 637 |
| 132 | Ga0068866_11122098 | 3300005718 | Unclassified | 564 |
| 133 | Ga0068861_100124569 | 3300005719 | Bacteria | 2083 |
| 134 | Ga0068861_100267758 | 3300005719 | Bacteria | 1466 |
| 135 | Ga0068861_102334398 | 3300005719 | Bacteria | 537 |
| 136 | Ga0068851_10027451 | 3300005834 | Bacteria | 2806 |
| 137 | Ga0068851_10069932 | 3300005834 | Bacteria | 1814 |
| 138 | Ga0068851_10096340 | 3300005834 | Bacteria | 1564 |
| 139 | Ga0068851_11013098 | 3300005834 | Bacteria | 524 |
| 140 | Ga0068863_100016745 | 3300005841 | Bacteria | 7033 |
| 141 | Ga0068863_100395463 | 3300005841 | Bacteria | 1351 |
| 142 | Ga0068858_100001937 | 3300005842 | Bacteria | 21103 |
| 143 | Ga0068858_100020173 | 3300005842 | Bacteria | 6232 |
| 144 | Ga0068858_100478143 | 3300005842 | Bacteria | 1202 |
| 145 | Ga0068860_100000881 | 3300005843 | Bacteria | 33318 |
| 146 | Ga0068860_100037368 | 3300005843 | Bacteria | 4648 |
| 147 | Ga0068862_100064479 | 3300005844 | Bacteria | 3154 |
| 148 | Ga0068862_100295050 | 3300005844 | Bacteria | 1490 |
| 149 | Ga0068862_101125094 | 3300005844 | Bacteria | 781 |
| 150 | Ga0068862_101718169 | 3300005844 | Bacteria | 636 |
| 151 | Ga0068862_102160495 | 3300005844 | Bacteria | 568 |
| 152 | Ga0070717_10004374 | 3300006028 | Bacteria | 10195 |
| 153 | Ga0070717_10804803 | 3300006028 | Unclassified | 855 |
| 154 | Ga0075364_10035047 | 3300006051 | Bacteria | 3242 |
| 155 | Ga0070715_10156335 | 3300006163 | Bacteria | 1122 |
| 156 | Ga0070712_100001546 | 3300006175 | Bacteria | 14064 |
| 157 | Ga0075367_10027442 | 3300006178 | Bacteria | 3239 |
| 158 | Ga0075366_10066576 | 3300006195 | Bacteria | 2143 |
| 159 | Ga0097621_100000984 | 3300006237 | Bacteria | 20000 |
| 160 | Ga0097621_100113675 | 3300006237 | Bacteria | 2290 |
| 161 | Ga0068871_100023304 | 3300006358 | Bacteria | 4786 |
| 162 | Ga0068871_100026825 | 3300006358 | Bacteria | 4499 |
| 163 | Ga0068871_100667720 | 3300006358 | Bacteria | 950 |
| 164 | Ga0068871_100791674 | 3300006358 | Unclassified | 873 |
| 165 | Ga0075428_100002950 | 3300006844 | Bacteria | 18546 |
| 166 | Ga0075428_100237595 | 3300006844 | Bacteria | 1966 |
| 167 | Ga0075428_102751321 | 3300006844 | Unclassified | 501 |
| 168 | Ga0075430_100166509 | 3300006846 | Bacteria | 1834 |
| 169 | Ga0075431_101210681 | 3300006847 | Unclassified | 718 |
| 170 | Ga0075433_10144376 | 3300006852 | Bacteria | 2115 |
| 171 | Ga0075433_10254073 | 3300006852 | Bacteria | 1559 |
| 172 | Ga0075434_100334938 | 3300006871 | Bacteria | 1534 |
| 173 | Ga0075434_101191117 | 3300006871 | Bacteria | 774 |
| 174 | Ga0075429_100043852 | 3300006880 | Bacteria | 3891 |
| 175 | Ga0075429_100528541 | 3300006880 | Bacteria | 1034 |
| 176 | Ga0075436_100009826 | 3300006914 | Bacteria | 6544 |
| 177 | Ga0075436_100177670 | 3300006914 | Bacteria | 1504 |
| 178 | Ga0097620_100013866 | 3300006931 | Bacteria | 8082 |
| 179 | Ga0097620_100055512 | 3300006931 | Bacteria | 3986 |
| 180 | Ga0097620_100103016 | 3300006931 | Bacteria | 2912 |
| 181 | Ga0097620_100620508 | 3300006931 | Bacteria | 1174 |
| 182 | Ga0097620_101281058 | 3300006931 | Unclassified | 808 |
| 183 | Ga0075435_100160615 | 3300007076 | Bacteria | 1893 |
| 184 | Ga0075435_100383708 | 3300007076 | Bacteria | 1207 |
| 185 | Ga0105240_10001620 | 3300009093 | Bacteria | 38182 |
| 186 | Ga0105240_10006110 | 3300009093 | Bacteria | 17764 |
| 187 | Ga0105240_10006333 | 3300009093 | Bacteria | 17422 |
| 188 | Ga0105240_10006426 | 3300009093 | Bacteria | 17277 |
| 189 | Ga0105240_10007803 | 3300009093 | Bacteria | 15461 |
| 190 | Ga0105240_10014714 | 3300009093 | Bacteria | 10672 |
| 191 | Ga0105240_10095116 | 3300009093 | Bacteria | 3633 |
| 192 | Ga0105240_11686033 | 3300009093 | Bacteria | 662 |
| 193 | Ga0105240_12440338 | 3300009093 | Bacteria | 541 |
| 194 | Ga0111539_10036972 | 3300009094 | Bacteria | 5900 |
| 195 | Ga0111539_10045535 | 3300009094 | Bacteria | 5251 |
| 196 | Ga0111539_10049852 | 3300009094 | Bacteria | 4990 |
| 197 | Ga0111539_10057337 | 3300009094 | Bacteria | 4626 |
| 198 | Ga0111539_11125732 | 3300009094 | Bacteria | 912 |
| 199 | Ga0111539_13165711 | 3300009094 | Bacteria | 531 |
| 200 | Ga0105245_10000274 | 3300009098 | Bacteria | 48955 |
| 201 | Ga0105245_10009530 | 3300009098 | Bacteria | 8467 |
| 202 | Ga0105245_10083880 | 3300009098 | Unclassified | 2918 |
| 203 | Ga0105247_10001592 | 3300009101 | Bacteria | 16074 |
| 204 | Ga0105247_10677957 | 3300009101 | Bacteria | 773 |
| 205 | Ga0105247_11213089 | 3300009101 | Bacteria | 601 |
| 206 | Ga0114129_10034866 | 3300009147 | Bacteria | 7109 |
| 207 | Ga0114129_10154935 | 3300009147 | Bacteria | 3134 |
| 208 | Ga0114129_10441059 | 3300009147 | Bacteria | 1709 |
| 209 | Ga0114129_10890246 | 3300009147 | Bacteria | 1129 |
| 210 | Ga0105243_12266686 | 3300009148 | Bacteria | 580 |
| 211 | Ga0105243_12758120 | 3300009148 | Bacteria | 532 |
| 212 | Ga0105241_10000150 | 3300009174 | Bacteria | 49793 |
| 213 | Ga0105241_10002039 | 3300009174 | Bacteria | 15278 |
| 214 | Ga0105241_10310876 | 3300009174 | Bacteria | 1356 |
| 215 | Ga0105242_12439116 | 3300009176 | Bacteria | 571 |
| 216 | Ga0105248_10019971 | 3300009177 | Bacteria | 7417 |
| 217 | Ga0105248_10150676 | 3300009177 | Bacteria | 2624 |
| 218 | Ga0105237_10020861 | 3300009545 | Bacteria | 6746 |
| 219 | Ga0105237_10317668 | 3300009545 | Bacteria | 1561 |
| 220 | Ga0105237_10929731 | 3300009545 | Bacteria | 877 |
| 221 | Ga0105237_11046406 | 3300009545 | Unclassified | 823 |
| 222 | Ga0105237_11403481 | 3300009545 | Bacteria | 705 |
| 223 | Ga0105237_11929263 | 3300009545 | Unclassified | 599 |
| 224 | Ga0105237_12370521 | 3300009545 | Bacteria | 541 |
| 225 | Ga0105238_10000251 | 3300009551 | Bacteria | 59944 |
| 226 | Ga0105238_10000626 | 3300009551 | Bacteria | 37164 |
| 227 | Ga0105238_10003911 | 3300009551 | Bacteria | 14796 |
| 228 | Ga0105238_10154354 | 3300009551 | Bacteria | 2271 |
| 229 | Ga0105238_10228224 | 3300009551 | Bacteria | 1839 |
| 230 | Ga0105238_10489767 | 3300009551 | Unclassified | 1229 |
| 231 | Ga0105238_10494532 | 3300009551 | Bacteria | 1223 |
| 232 | Ga0105249_10017760 | 3300009553 | Bacteria | 6319 |
| 233 | Ga0105249_10850989 | 3300009553 | Bacteria | 977 |
| 234 | Ga0105249_11033377 | 3300009553 | Bacteria | 891 |
| 235 | Ga0105249_11459441 | 3300009553 | Bacteria | 756 |
| 236 | Ga0105239_10000725 | 3300010375 | Bacteria | 46872 |
| 237 | Ga0105239_10005068 | 3300010375 | Bacteria | 15560 |
| 238 | Ga0105239_10045106 | 3300010375 | Bacteria | 4831 |
| 239 | Ga0105239_10197665 | 3300010375 | Bacteria | 2252 |
| 240 | Ga0105246_10001271 | 3300011119 | Bacteria | 14813 |
| 241 | Ga0105246_11657276 | 3300011119 | Bacteria | 606 |
| 242 | Ga0157370_10000128 | 3300013104 | Bacteria | 90605 |
| 243 | Ga0157370_10560195 | 3300013104 | Bacteria | 1047 |
| 244 | Ga0157370_10740003 | 3300013104 | Bacteria | 896 |
| 245 | Ga0157370_11879530 | 3300013104 | Bacteria | 537 |
| 246 | Ga0157370_12127384 | 3300013104 | Bacteria | 503 |
| 247 | Ga0157369_10000175 | 3300013105 | Bacteria | 90148 |
| 248 | Ga0157369_10000369 | 3300013105 | Bacteria | 59934 |
| 249 | Ga0157369_10004534 | 3300013105 | Bacteria | 16345 |
| 250 | Ga0157369_10007975 | 3300013105 | Bacteria | 12168 |
| 251 | Ga0157369_10009288 | 3300013105 | Bacteria | 11248 |
| 252 | Ga0157369_10337976 | 3300013105 | Bacteria | 1564 |
| 253 | Ga0157369_10715925 | 3300013105 | Unclassified | 1030 |
| 254 | Ga0157369_10807325 | 3300013105 | Bacteria | 964 |
| 255 | Ga0157369_11266024 | 3300013105 | Bacteria | 752 |
| 256 | Ga0157369_11372148 | 3300013105 | Archaea | 720 |
| 257 | Ga0157374_10014614 | 3300013296 | Bacteria | 6871 |
| 258 | Ga0157374_10124646 | 3300013296 | Bacteria | 2489 |
| 259 | Ga0157378_10003951 | 3300013297 | Bacteria | 13100 |
| 260 | Ga0157378_10005796 | 3300013297 | Bacteria | 10827 |
| 261 | Ga0157378_10032477 | 3300013297 | Bacteria | 4612 |
| 262 | Ga0157378_10066009 | 3300013297 | Bacteria | 3240 |
| 263 | Ga0157378_10154126 | 3300013297 | Bacteria | 2143 |
| 264 | Ga0157378_11509199 | 3300013297 | Unclassified | 717 |
| 265 | Ga0163162_10189956 | 3300013306 | Bacteria | 2181 |
| 266 | Ga0163162_10513298 | 3300013306 | Bacteria | 1328 |
| 267 | Ga0157372_10000098 | 3300013307 | Bacteria | 90215 |
| 268 | Ga0157372_10000659 | 3300013307 | Bacteria | 37935 |
| 269 | Ga0157372_10036378 | 3300013307 | Bacteria | 5426 |
| 270 | Ga0157372_10073287 | 3300013307 | Bacteria | 3860 |
| 271 | Ga0157372_10695319 | 3300013307 | Bacteria | 1183 |
| 272 | Ga0157372_11065445 | 3300013307 | Bacteria | 936 |
| 273 | Ga0157372_11338167 | 3300013307 | Bacteria | 826 |
| 274 | Ga0157372_11746263 | 3300013307 | Bacteria | 716 |
| 275 | Ga0157375_10017534 | 3300013308 | Bacteria | 6465 |
| 276 | Ga0157375_10602291 | 3300013308 | Bacteria | 1258 |
| 277 | Ga0157375_10951427 | 3300013308 | Bacteria | 1001 |
| 278 | Ga0157375_11097088 | 3300013308 | Bacteria | 931 |
| 279 | Ga0157375_11529008 | 3300013308 | Bacteria | 788 |
| 280 | Ga0157375_12618595 | 3300013308 | Unclassified | 603 |
| 281 | Ga0163163_10000308 | 3300014325 | Bacteria | 48146 |
| 282 | Ga0163163_11100083 | 3300014325 | Unclassified | 858 |
| 283 | Ga0157380_11163865 | 3300014326 | Bacteria | 813 |
| 284 | Ga0157380_11178741 | 3300014326 | Bacteria | 809 |
| 285 | Ga0157380_12079418 | 3300014326 | Bacteria | 630 |
| 286 | Ga0157377_10010640 | 3300014745 | Bacteria | 4559 |
| 287 | Ga0157377_10737440 | 3300014745 | Bacteria | 719 |
| 288 | Ga0157379_10107913 | 3300014968 | Bacteria | 2499 |
| 289 | Ga0157376_10410269 | 3300014969 | Bacteria | 1312 |
| 290 | Ga0197907_10572396 | 3300020069 | Bacteria | 631 |
| 291 | Ga0206356_10296919 | 3300020070 | Bacteria | 662 |
| 292 | Ga0206352_10254630 | 3300020078 | Bacteria | 1769 |
| 293 | Ga0206354_10052765 | 3300020081 | Bacteria | 606 |
| 294 | Ga0207656_10220552 | 3300025321 | Bacteria | 922 |
| 295 | Ga0207710_10001603 | 3300025900 | Bacteria | 11070 |
| 296 | Ga0207710_10366931 | 3300025900 | Bacteria | 735 |
| 297 | Ga0207699_10001136 | 3300025906 | Bacteria | 12600 |
| 298 | Ga0207705_10217026 | 3300025909 | Bacteria | 1452 |
| 299 | Ga0207705_10374132 | 3300025909 | Bacteria | 1100 |
| 300 | Ga0207654_10000180 | 3300025911 | Bacteria | 39043 |
| 301 | Ga0207654_10000548 | 3300025911 | Bacteria | 21477 |
| 302 | Ga0207654_10001207 | 3300025911 | Bacteria | 13830 |
| 303 | Ga0207654_10136042 | 3300025911 | Bacteria | 1561 |
| 304 | Ga0207654_10590601 | 3300025911 | Unclassified | 792 |
| 305 | Ga0207695_10000047 | 3300025913 | Bacteria | 422459 |
| 306 | Ga0207695_10000150 | 3300025913 | Bacteria | 207099 |
| 307 | Ga0207695_10000162 | 3300025913 | Bacteria | 198155 |
| 308 | Ga0207695_10001900 | 3300025913 | Bacteria | 32599 |
| 309 | Ga0207695_10009043 | 3300025913 | Bacteria | 12380 |
| 310 | Ga0207695_10125451 | 3300025913 | Bacteria | 2530 |
| 311 | Ga0207695_10275581 | 3300025913 | Bacteria | 1577 |
| 312 | Ga0207671_10000155 | 3300025914 | Bacteria | 106931 |
| 313 | Ga0207671_10001417 | 3300025914 | Bacteria | 27842 |
| 314 | Ga0207671_10191132 | 3300025914 | Bacteria | 1596 |
| 315 | Ga0207671_10238251 | 3300025914 | Bacteria | 1429 |
| 316 | Ga0207693_10000065 | 3300025915 | Bacteria | 91476 |
| 317 | Ga0207663_10004470 | 3300025916 | Bacteria | 6956 |
| 318 | Ga0207649_10001760 | 3300025920 | Bacteria | 12425 |
| 319 | Ga0207649_10098958 | 3300025920 | Bacteria | 1926 |
| 320 | Ga0207649_10173556 | 3300025920 | Bacteria | 1504 |
| 321 | Ga0207649_10486240 | 3300025920 | Unclassified | 937 |
| 322 | Ga0207652_11112179 | 3300025921 | Unclassified | 691 |
| 323 | Ga0207694_10000142 | 3300025924 | Bacteria | 74189 |
| 324 | Ga0207694_10000146 | 3300025924 | Bacteria | 72706 |
| 325 | Ga0207694_10001885 | 3300025924 | Bacteria | 17384 |
| 326 | Ga0207694_10009282 | 3300025924 | Bacteria | 7422 |
| 327 | Ga0207694_11399037 | 3300025924 | Unclassified | 591 |
| 328 | Ga0207687_10005869 | 3300025927 | Bacteria | 8120 |
| 329 | Ga0207687_11095246 | 3300025927 | Unclassified | 684 |
| 330 | Ga0207700_10887307 | 3300025928 | Bacteria | 798 |
| 331 | Ga0207664_10044194 | 3300025929 | Bacteria | 3488 |
| 332 | Ga0207664_11624562 | 3300025929 | Unclassified | 568 |
| 333 | Ga0207644_10047216 | 3300025931 | Bacteria | 3071 |
| 334 | Ga0207644_10064928 | 3300025931 | Bacteria | 2653 |
| 335 | Ga0207665_10018887 | 3300025939 | Bacteria | 4530 |
| 336 | Ga0207711_10035299 | 3300025941 | Bacteria | 4238 |
| 337 | Ga0207711_10095993 | 3300025941 | Bacteria | 2616 |
| 338 | Ga0207689_10025128 | 3300025942 | Bacteria | 4993 |
| 339 | Ga0207689_10703481 | 3300025942 | Bacteria | 852 |
| 340 | Ga0207679_10159169 | 3300025945 | Bacteria | 1847 |
| 341 | Ga0207679_10335838 | 3300025945 | Bacteria | 1313 |
| 342 | Ga0207667_10003680 | 3300025949 | Bacteria | 18901 |
| 343 | Ga0207667_10020778 | 3300025949 | Bacteria | 7293 |
| 344 | Ga0207667_10028534 | 3300025949 | Bacteria | 6061 |
| 345 | Ga0207712_10051495 | 3300025961 | Bacteria | 2880 |
| 346 | Ga0207640_10018350 | 3300025981 | Bacteria | 4110 |
| 347 | Ga0207640_10391384 | 3300025981 | Bacteria | 1129 |
| 348 | Ga0207658_10021723 | 3300025986 | Bacteria | 4459 |
| 349 | Ga0207677_10000782 | 3300026023 | Bacteria | 18219 |
| 350 | Ga0207703_10003901 | 3300026035 | Bacteria | 12382 |
| 351 | Ga0207639_10000098 | 3300026041 | Bacteria | 73865 |
| 352 | Ga0207678_10297511 | 3300026067 | Bacteria | 1387 |
| 353 | Ga0207702_10003868 | 3300026078 | Bacteria | 13498 |
| 354 | Ga0207702_10004419 | 3300026078 | Bacteria | 12499 |
| 355 | Ga0207702_10104551 | 3300026078 | Bacteria | 2506 |
| 356 | Ga0207641_10003181 | 3300026088 | Bacteria | 14697 |
| 357 | Ga0207676_10005538 | 3300026095 | Bacteria | 8938 |
| 358 | Ga0207676_10941002 | 3300026095 | Bacteria | 849 |
| 359 | Ga0207676_11509892 | 3300026095 | Unclassified | 669 |
| 360 | Ga0207674_10001977 | 3300026116 | Bacteria | 25960 |
| 361 | Ga0207674_10003452 | 3300026116 | Bacteria | 19332 |
| 362 | Ga0207674_10839456 | 3300026116 | Bacteria | 886 |
| 363 | Ga0207675_100222696 | 3300026118 | Bacteria | 1818 |
| 364 | Ga0207675_101189314 | 3300026118 | Bacteria | 783 |
| 365 | Ga0207698_10000031 | 3300026142 | Bacteria | 113280 |
| 366 | Ga0207698_10000241 | 3300026142 | Bacteria | 33787 |
| 367 | Ga0207698_10134745 | 3300026142 | Bacteria | 2117 |
| 368 | Ga0207698_10255710 | 3300026142 | Bacteria | 1606 |
| 369 | Ga0207698_10902135 | 3300026142 | Bacteria | 891 |
| 370 | Ga0207698_10905284 | 3300026142 | Bacteria | 889 |
| 371 | Ga0209813_10192801 | 3300027866 | Bacteria | 751 |
| 372 | Ga0207428_10081579 | 3300027907 | Bacteria | 2525 |
| 373 | Ga0268266_10013494 | 3300028379 | Bacteria | 7033 |
| 374 | Ga0268265_10901251 | 3300028380 | Bacteria | 868 |
| 375 | Ga0268264_10002705 | 3300028381 | Bacteria | 15468 |
| 376 | Ga0265319_1008416 | 3300028563 | Bacteria | 4521 |
| 377 | Ga0265334_10171414 | 3300028573 | Bacteria | 760 |
| 378 | Ga0265318_10000563 | 3300028577 | Bacteria | 26166 |
| 379 | Ga0265338_10061471 | 3300028800 | Bacteria | 3292 |
| 380 | Ga0265338_10230759 | 3300028800 | Bacteria | 1377 |
| 381 | Ga0265330_10065382 | 3300031235 | Bacteria | 1579 |
| 382 | Ga0265330_10067886 | 3300031235 | Bacteria | 1545 |
| 383 | Ga0265330_10285832 | 3300031235 | Unclassified | 695 |
| 384 | Ga0265332_10061018 | 3300031238 | Bacteria | 1612 |
| 385 | Ga0265332_10116918 | 3300031238 | Bacteria | 1121 |
| 386 | Ga0265328_10026108 | 3300031239 | Unclassified | 2198 |
| 387 | Ga0265320_10000328 | 3300031240 | Bacteria | 38910 |
| 388 | Ga0265320_10557485 | 3300031240 | Unclassified | 507 |
| 389 | Ga0265325_10003694 | 3300031241 | Bacteria | 9902 |
| 390 | Ga0265329_10000518 | 3300031242 | Bacteria | 19897 |
| 391 | Ga0265340_10011233 | 3300031247 | Bacteria | 4768 |
| 392 | Ga0265339_10002679 | 3300031249 | Bacteria | 12656 |
| 393 | Ga0265339_10021726 | 3300031249 | Bacteria | 3727 |
| 394 | Ga0265331_10000021 | 3300031250 | Bacteria | 242632 |
| 395 | Ga0265327_10151398 | 3300031251 | Bacteria | 1077 |
| 396 | Ga0265316_10000779 | 3300031344 | Bacteria | 35184 |
| 397 | Ga0265316_10003604 | 3300031344 | Bacteria | 15612 |
| 398 | Ga0265316_10077838 | 3300031344 | Bacteria | 2546 |
| 399 | Ga0265313_10000730 | 3300031595 | Bacteria | 33796 |
| 400 | Ga0265313_10025245 | 3300031595 | Bacteria | 3155 |
| 401 | Ga0265314_10012056 | 3300031711 | Bacteria | 7086 |
| 402 | Ga0265342_10000032 | 3300031712 | Bacteria | 150633 |
| 403 | Ga0265342_10001096 | 3300031712 | Bacteria | 26037 |
| 404 | Ga0265342_10457739 | 3300031712 | Bacteria | 654 |
| 405 | Ga0307413_10785578 | 3300031824 | Bacteria | 799 |
| 406 | Ga0307407_11205795 | 3300031903 | Bacteria | 591 |
| 407 | Ga0307411_10356352 | 3300032005 | Bacteria | 1195 |
| 408 | Ga0373956_0441635 | 3300035119 | Bacteria | 621 |
| 409 | Ga0373927_0014954 | 3300035695 | Bacteria | 5135 |
| 410 | Ga0373933_0896158 | 3300035724 | Bacteria | 584 |
| 411 | Ga0373925_1286443 | 3300037068 | Bacteria | 600 |
| 412 | Ga0436361_0552241 | 3300039447 | Bacteria | 1327 |
| 413 | Ga0466963_1180336 | 3300044694 | Bacteria | 538 |
| 414 | Ga0466970_0235832 | 3300044765 | Bacteria | 1023 |
| 415 | Ga0466957_0178300 | 3300044842 | Bacteria | 1387 |
| 416 | Ga0466959_0127456 | 3300045049 | Unclassified | 1806 |
| 417 | Ga0466959_0247119 | 3300045049 | Bacteria | 1231 |
| 418 | Ga0466959_0253329 | 3300045049 | Unclassified | 1214 |
| 419 | Ga0466959_0571018 | 3300045049 | Bacteria | 762 |
| 420 | Ga0451576_0481702 | 3300045051 | Bacteria | 1303 |
| 421 | Ga0466958_0160229 | 3300045836 | Bacteria | 1421 |
| 422 | Ga0466967_0003508 | 3300045976 | Bacteria | 10250 |
| 423 | Ga0466967_0213697 | 3300045976 | Bacteria | 1830 |
| 424 | Ga0495603_0793537 | 3300046455 | Bacteria | 540 |
| 425 | Ga0495586_0726746 | 3300046535 | Bacteria | 573 |
| 426 | Ga0495645_0571603 | 3300046543 | Bacteria | 698 |
| 427 | Ga0495599_0128220 | 3300046678 | Bacteria | 1576 |
| 428 | Ga0495658_0181181 | 3300046683 | Bacteria | 1307 |
| 429 | Ga0496100_0046213 | 3300048903 | Bacteria | 2798 |
| 430 | Ga0496101_0014201 | 3300048904 | Bacteria | 5350 |
| 431 | Ga0496102_0144225 | 3300048905 | Bacteria | 2234 |
| 432 | Ga0496104_0007687 | 3300048907 | Bacteria | 9543 |
| 433 | Ga0496105_0087624 | 3300048908 | Bacteria | 2572 |
| 434 | Ga0496107_0031116 | 3300048910 | Bacteria | 3806 |
| 435 | Ga0496114_0009291 | 3300048917 | Bacteria | 7802 |
| 436 | Ga0501031_0016623 | 3300049568 | Bacteria | 4777 |
| 437 | Ga0501032_0211664 | 3300049569 | Bacteria | 1263 |
| 438 | Ga0501033_0001552 | 3300049570 | Bacteria | 20297 |
| 439 | Ga0501034_0011943 | 3300049571 | Bacteria | 8976 |
| 440 | Ga0501034_0044404 | 3300049571 | Bacteria | 4495 |
| 441 | Ga0501036_0003777 | 3300049572 | Bacteria | 12139 |
| 442 | Ga0501037_0025670 | 3300049573 | Bacteria | 4352 |
| 443 | Ga0501038_0021002 | 3300049574 | Bacteria | 5866 |
| 444 | Ga0501039_0481511 | 3300049575 | Unclassified | 974 |
| 445 | Ga0501042_0319686 | 3300049578 | Bacteria | 1121 |
| 446 | Ga0501043_0030448 | 3300049579 | Bacteria | 4241 |
| 447 | Ga0501046_0020894 | 3300049580 | Bacteria | 5406 |
| 448 | Ga0501047_0135523 | 3300049581 | Bacteria | 2342 |
| 449 | Ga0501048_0108405 | 3300049582 | Bacteria | 1960 |
| 450 | Ga0501067_0023446 | 3300049583 | Bacteria | 3420 |
| 451 | Ga0501068_0015278 | 3300049584 | Bacteria | 4406 |
| 452 | Ga0501069_0295420 | 3300049585 | Bacteria | 949 |
| 453 | Ga0501070_0002988 | 3300049586 | Bacteria | 14711 |
| 454 | Ga0501070_0649599 | 3300049586 | Bacteria | 838 |
| 455 | Ga0501074_0017824 | 3300049590 | Bacteria | 5160 |
| 456 | Ga0501079_0201966 | 3300049741 | Bacteria | 1553 |
| 457 | Ga0501080_0058394 | 3300049742 | Bacteria | 3591 |
| 458 | Ga0501083_0014829 | 3300049744 | Bacteria | 5450 |
| 459 | Ga0501035_0610944 | 3300049822 | Bacteria | 887 |
| 460 | Ga0501044_0263693 | 3300049823 | Bacteria | 1660 |
| 461 | Ga0501045_0176870 | 3300049824 | Bacteria | 1589 |
| 462 | nmdc:mga00v17_67871_c1 | 3300050491 | Bacteria | 2204 |
| 463 | nmdc:mga0k408_177803_c1 | 3300050493 | Bacteria | 1269 |
| 464 | nmdc:mga06z11_166270_c1 | 3300050494 | Bacteria | 1264 |
| 465 | nmdc:mga07m45_87946_c1 | 3300050496 | Bacteria | 1778 |
| 466 | Ga0501084_0800820 | 3300054114 | Bacteria | 793 |
| 467 | Ga0587093_109338 | 3300059478 | Bacteria | 507 |
| 468 | Ga0587086_059289 | 3300059507 | Bacteria | 635 |
| 469 | Ga0587088_139826 | 3300059508 | Bacteria | 577 |
| 470 | Ga0587106_125862 | 3300059605 | Bacteria | 548 |
| 471 | Ga0501082_0000448 | 3300060353 | Bacteria | 36479 |
| 472 | Ga0501082_0042558 | 3300060353 | Bacteria | 3915 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006358 | Ga0068871_100026825 | Ga0068871_1000268252 | 95 |
| 2 | 3300013297 | Ga0157378_11509199 | Ga0157378_115091992 | 95 |
| 3 | 3300048903 | Ga0496100_0046213 | Ga0496100_0046213_142_471 | 95 |
| 4 | 3300048904 | Ga0496101_0014201 | Ga0496101_0014201_1810_2139 | 95 |
| 5 | 3300048905 | Ga0496102_0144225 | Ga0496102_0144225_20_349 | 95 |
| 6 | 3300048907 | Ga0496104_0007687 | Ga0496104_0007687_2695_3024 | 95 |
| 7 | 3300048910 | Ga0496107_0031116 | Ga0496107_0031116_305_634 | 95 |
| 8 | 3300048917 | Ga0496114_0009291 | Ga0496114_0009291_958_1287 | 95 |
| 9 | 3300002239 | JGI24034J26672_10002694 | JGI24034J26672_100026943 | 98 |
| 10 | 3300005295 | Ga0065707_10099766 | Ga0065707_100997662 | 98 |
| 11 | 3300005327 | Ga0070658_10000510 | Ga0070658_1000051016 | 98 |
| 12 | 3300005327 | Ga0070658_10191226 | Ga0070658_101912262 | 98 |
| 13 | 3300005328 | Ga0070676_10514487 | Ga0070676_105144871 | 98 |
| 14 | 3300005329 | Ga0070683_100203880 | Ga0070683_1002038802 | 98 |
| 15 | 3300005329 | Ga0070683_100339155 | Ga0070683_1003391552 | 98 |
| 16 | 3300005330 | Ga0070690_100242299 | Ga0070690_1002422991 | 98 |
| 17 | 3300005330 | Ga0070690_101166651 | Ga0070690_1011666511 | 98 |
| 18 | 3300005334 | Ga0068869_100014654 | Ga0068869_1000146545 | 98 |
| 19 | 3300005334 | Ga0068869_100800299 | Ga0068869_1008002992 | 98 |
| 20 | 3300005335 | Ga0070666_10984254 | Ga0070666_109842541 | 98 |
| 21 | 3300005336 | Ga0070680_100000189 | Ga0070680_10000018912 | 98 |
| 22 | 3300005336 | Ga0070680_100056506 | Ga0070680_1000565063 | 98 |
| 23 | 3300005337 | Ga0070682_100140820 | Ga0070682_1001408201 | 98 |
| 24 | 3300005337 | Ga0070682_100265257 | Ga0070682_1002652573 | 98 |
| 25 | 3300005337 | Ga0070682_101040813 | Ga0070682_1010408132 | 98 |
| 26 | 3300005338 | Ga0068868_100000178 | Ga0068868_10000017837 | 98 |
| 27 | 3300005339 | Ga0070660_100174837 | Ga0070660_1001748372 | 98 |
| 28 | 3300005340 | Ga0070689_100031982 | Ga0070689_1000319826 | 98 |
| 29 | 3300005340 | Ga0070689_101386453 | Ga0070689_1013864532 | 98 |
| 30 | 3300005341 | Ga0070691_10227641 | Ga0070691_102276412 | 98 |
| 31 | 3300005341 | Ga0070691_10530635 | Ga0070691_105306352 | 98 |
| 32 | 3300005343 | Ga0070687_101315750 | Ga0070687_1013157501 | 98 |
| 33 | 3300005344 | Ga0070661_100002573 | Ga0070661_1000025731 | 98 |
| 34 | 3300005344 | Ga0070661_100027267 | Ga0070661_1000272675 | 98 |
| 35 | 3300005344 | Ga0070661_100188093 | Ga0070661_1001880931 | 98 |
| 36 | 3300005344 | Ga0070661_100697135 | Ga0070661_1006971351 | 98 |
| 37 | 3300005344 | Ga0070661_100918530 | Ga0070661_1009185301 | 98 |
| 38 | 3300005347 | Ga0070668_100196095 | Ga0070668_1001960953 | 98 |
| 39 | 3300005347 | Ga0070668_100924177 | Ga0070668_1009241772 | 98 |
| 40 | 3300005353 | Ga0070669_100981604 | Ga0070669_1009816042 | 98 |
| 41 | 3300005353 | Ga0070669_101160920 | Ga0070669_1011609202 | 98 |
| 42 | 3300005354 | Ga0070675_100041499 | Ga0070675_1000414993 | 98 |
| 43 | 3300005354 | Ga0070675_100471467 | Ga0070675_1004714672 | 98 |
| 44 | 3300005355 | Ga0070671_100001359 | Ga0070671_1000013593 | 98 |
| 45 | 3300005355 | Ga0070671_100027814 | Ga0070671_1000278143 | 98 |
| 46 | 3300005356 | Ga0070674_100523189 | Ga0070674_1005231892 | 98 |
| 47 | 3300005365 | Ga0070688_100128573 | Ga0070688_1001285732 | 98 |
| 48 | 3300005365 | Ga0070688_100359582 | Ga0070688_1003595822 | 98 |
| 49 | 3300005367 | Ga0070667_100025250 | Ga0070667_1000252502 | 98 |
| 50 | 3300005367 | Ga0070667_101387892 | Ga0070667_1013878922 | 98 |
| 51 | 3300005434 | Ga0070709_10523010 | Ga0070709_105230102 | 98 |
| 52 | 3300005435 | Ga0070714_100420677 | Ga0070714_1004206772 | 98 |
| 53 | 3300005435 | Ga0070714_100514111 | Ga0070714_1005141112 | 98 |
| 54 | 3300005436 | Ga0070713_100001436 | Ga0070713_10000143611 | 98 |
| 55 | 3300005436 | Ga0070713_100942945 | Ga0070713_1009429452 | 98 |
| 56 | 3300005439 | Ga0070711_100006753 | Ga0070711_1000067532 | 98 |
| 57 | 3300005440 | Ga0070705_100071844 | Ga0070705_1000718443 | 98 |
| 58 | 3300005441 | Ga0070700_100549329 | Ga0070700_1005493292 | 98 |
| 59 | 3300005444 | Ga0070694_100167912 | Ga0070694_1001679123 | 98 |
| 60 | 3300005444 | Ga0070694_100621553 | Ga0070694_1006215532 | 98 |
| 61 | 3300005444 | Ga0070694_100675973 | Ga0070694_1006759732 | 98 |
| 62 | 3300005444 | Ga0070694_101593598 | Ga0070694_1015935981 | 98 |
| 63 | 3300005445 | Ga0070708_100216288 | Ga0070708_1002162882 | 98 |
| 64 | 3300005455 | Ga0070663_100351051 | Ga0070663_1003510512 | 98 |
| 65 | 3300005456 | Ga0070678_100145026 | Ga0070678_1001450261 | 98 |
| 66 | 3300005457 | Ga0070662_101318992 | Ga0070662_1013189922 | 98 |
| 67 | 3300005458 | Ga0070681_10000937 | Ga0070681_1000093719 | 98 |
| 68 | 3300005458 | Ga0070681_10274849 | Ga0070681_102748492 | 98 |
| 69 | 3300005458 | Ga0070681_10579654 | Ga0070681_105796542 | 98 |
| 70 | 3300005458 | Ga0070681_10999405 | Ga0070681_109994052 | 98 |
| 71 | 3300005459 | Ga0068867_101118104 | Ga0068867_1011181042 | 98 |
| 72 | 3300005467 | Ga0070706_100415187 | Ga0070706_1004151872 | 98 |
| 73 | 3300005468 | Ga0070707_100335337 | Ga0070707_1003353372 | 98 |
| 74 | 3300005468 | Ga0070707_101174983 | Ga0070707_1011749832 | 98 |
| 75 | 3300005471 | Ga0070698_100009744 | Ga0070698_1000097449 | 98 |
| 76 | 3300005471 | Ga0070698_100105083 | Ga0070698_1001050832 | 98 |
| 77 | 3300005471 | Ga0070698_100293378 | Ga0070698_1002933781 | 98 |
| 78 | 3300005471 | Ga0070698_100630919 | Ga0070698_1006309192 | 98 |
| 79 | 3300005518 | Ga0070699_101455072 | Ga0070699_1014550721 | 98 |
| 80 | 3300005518 | Ga0070699_101793529 | Ga0070699_1017935292 | 98 |
| 81 | 3300005530 | Ga0070679_100008583 | Ga0070679_10000858311 | 98 |
| 82 | 3300005530 | Ga0070679_100220306 | Ga0070679_1002203062 | 98 |
| 83 | 3300005530 | Ga0070679_100415489 | Ga0070679_1004154892 | 98 |
| 84 | 3300005535 | Ga0070684_100008389 | Ga0070684_1000083895 | 98 |
| 85 | 3300005535 | Ga0070684_100067730 | Ga0070684_1000677303 | 98 |
| 86 | 3300005535 | Ga0070684_100099411 | Ga0070684_1000994114 | 98 |
| 87 | 3300005535 | Ga0070684_100107399 | Ga0070684_1001073992 | 98 |
| 88 | 3300005535 | Ga0070684_100180576 | Ga0070684_1001805763 | 98 |
| 89 | 3300005536 | Ga0070697_100007718 | Ga0070697_1000077183 | 98 |
| 90 | 3300005536 | Ga0070697_100045968 | Ga0070697_1000459684 | 98 |
| 91 | 3300005536 | Ga0070697_100110767 | Ga0070697_1001107671 | 98 |
| 92 | 3300005536 | Ga0070697_100430867 | Ga0070697_1004308671 | 98 |
| 93 | 3300005539 | Ga0068853_100000048 | Ga0068853_10000004888 | 98 |
| 94 | 3300005539 | Ga0068853_100340180 | Ga0068853_1003401802 | 98 |
| 95 | 3300005539 | Ga0068853_100606064 | Ga0068853_1006060643 | 98 |
| 96 | 3300005539 | Ga0068853_101200130 | Ga0068853_1012001302 | 98 |
| 97 | 3300005543 | Ga0070672_100707937 | Ga0070672_1007079372 | 98 |
| 98 | 3300005545 | Ga0070695_100006076 | Ga0070695_1000060767 | 98 |
| 99 | 3300005545 | Ga0070695_101384644 | Ga0070695_1013846441 | 98 |
| 100 | 3300005546 | Ga0070696_100851093 | Ga0070696_1008510932 | 98 |
| 101 | 3300005546 | Ga0070696_101037698 | Ga0070696_1010376981 | 98 |
| 102 | 3300005547 | Ga0070693_100798938 | Ga0070693_1007989381 | 98 |
| 103 | 3300005548 | Ga0070665_100000225 | Ga0070665_10000022525 | 98 |
| 104 | 3300005548 | Ga0070665_100022857 | Ga0070665_1000228577 | 98 |
| 105 | 3300005548 | Ga0070665_100841517 | Ga0070665_1008415172 | 98 |
| 106 | 3300005548 | Ga0070665_101109004 | Ga0070665_1011090042 | 98 |
| 107 | 3300005563 | Ga0068855_100003334 | Ga0068855_10000333418 | 98 |
| 108 | 3300005563 | Ga0068855_100013025 | Ga0068855_1000130252 | 98 |
| 109 | 3300005563 | Ga0068855_100022704 | Ga0068855_1000227049 | 98 |
| 110 | 3300005563 | Ga0068855_100663533 | Ga0068855_1006635332 | 98 |
| 111 | 3300005563 | Ga0068855_100757348 | Ga0068855_1007573482 | 98 |
| 112 | 3300005564 | Ga0070664_100137038 | Ga0070664_1001370382 | 98 |
| 113 | 3300005564 | Ga0070664_101590269 | Ga0070664_1015902691 | 98 |
| 114 | 3300005577 | Ga0068857_100015300 | Ga0068857_1000153009 | 98 |
| 115 | 3300005577 | Ga0068857_100052095 | Ga0068857_1000520954 | 98 |
| 116 | 3300005577 | Ga0068857_100161237 | Ga0068857_1001612373 | 98 |
| 117 | 3300005577 | Ga0068857_100857696 | Ga0068857_1008576962 | 98 |
| 118 | 3300005578 | Ga0068854_100039895 | Ga0068854_1000398954 | 98 |
| 119 | 3300005578 | Ga0068854_100098439 | Ga0068854_1000984393 | 98 |
| 120 | 3300005614 | Ga0068856_100001672 | Ga0068856_10000167214 | 98 |
| 121 | 3300005614 | Ga0068856_100024476 | Ga0068856_1000244764 | 98 |
| 122 | 3300005614 | Ga0068856_100049147 | Ga0068856_1000491472 | 98 |
| 123 | 3300005614 | Ga0068856_100105400 | Ga0068856_1001054004 | 98 |
| 124 | 3300005614 | Ga0068856_100202476 | Ga0068856_1002024763 | 98 |
| 125 | 3300005614 | Ga0068856_100256138 | Ga0068856_1002561382 | 98 |
| 126 | 3300005615 | Ga0070702_100299495 | Ga0070702_1002994952 | 98 |
| 127 | 3300005616 | Ga0068852_100000076 | Ga0068852_10000007665 | 98 |
| 128 | 3300005616 | Ga0068852_100000105 | Ga0068852_10000010545 | 98 |
| 129 | 3300005616 | Ga0068852_100179738 | Ga0068852_1001797382 | 98 |
| 130 | 3300005616 | Ga0068852_100503771 | Ga0068852_1005037712 | 98 |
| 131 | 3300005616 | Ga0068852_101015400 | Ga0068852_1010154002 | 98 |
| 132 | 3300005616 | Ga0068852_102302405 | Ga0068852_1023024051 | 98 |
| 133 | 3300005617 | Ga0068859_100013866 | Ga0068859_1000138665 | 98 |
| 134 | 3300005617 | Ga0068859_100055512 | Ga0068859_1000555123 | 98 |
| 135 | 3300005617 | Ga0068859_100103018 | Ga0068859_1001030181 | 98 |
| 136 | 3300005617 | Ga0068859_100620489 | Ga0068859_1006204892 | 98 |
| 137 | 3300005618 | Ga0068864_100004282 | Ga0068864_1000042822 | 98 |
| 138 | 3300005618 | Ga0068864_100347716 | Ga0068864_1003477161 | 98 |
| 139 | 3300005618 | Ga0068864_101694478 | Ga0068864_1016944782 | 98 |
| 140 | 3300005718 | Ga0068866_11122098 | Ga0068866_111220982 | 98 |
| 141 | 3300005719 | Ga0068861_100124569 | Ga0068861_1001245692 | 98 |
| 142 | 3300005719 | Ga0068861_100267758 | Ga0068861_1002677582 | 98 |
| 143 | 3300005719 | Ga0068861_102334398 | Ga0068861_1023343981 | 98 |
| 144 | 3300005834 | Ga0068851_10027451 | Ga0068851_100274512 | 98 |
| 145 | 3300005834 | Ga0068851_10069932 | Ga0068851_100699322 | 98 |
| 146 | 3300005834 | Ga0068851_10096340 | Ga0068851_100963402 | 98 |
| 147 | 3300005834 | Ga0068851_11013098 | Ga0068851_110130981 | 98 |
| 148 | 3300005841 | Ga0068863_100016745 | Ga0068863_1000167454 | 98 |
| 149 | 3300005841 | Ga0068863_100395463 | Ga0068863_1003954632 | 98 |
| 150 | 3300005842 | Ga0068858_100001937 | Ga0068858_1000019377 | 98 |
| 151 | 3300005842 | Ga0068858_100020173 | Ga0068858_1000201734 | 98 |
| 152 | 3300005842 | Ga0068858_100478143 | Ga0068858_1004781432 | 98 |
| 153 | 3300005843 | Ga0068860_100000881 | Ga0068860_10000088123 | 98 |
| 154 | 3300005843 | Ga0068860_100037368 | Ga0068860_1000373684 | 98 |
| 155 | 3300005844 | Ga0068862_100064479 | Ga0068862_1000644792 | 98 |
| 156 | 3300005844 | Ga0068862_100295050 | Ga0068862_1002950502 | 98 |
| 157 | 3300005844 | Ga0068862_101125094 | Ga0068862_1011250942 | 98 |
| 158 | 3300005844 | Ga0068862_101718169 | Ga0068862_1017181691 | 98 |
| 159 | 3300005844 | Ga0068862_102160495 | Ga0068862_1021604951 | 98 |
| 160 | 3300006028 | Ga0070717_10004374 | Ga0070717_100043743 | 98 |
| 161 | 3300006028 | Ga0070717_10804803 | Ga0070717_108048032 | 98 |
| 162 | 3300006051 | Ga0075364_10035047 | Ga0075364_100350472 | 98 |
| 163 | 3300006163 | Ga0070715_10156335 | Ga0070715_101563352 | 98 |
| 164 | 3300006175 | Ga0070712_100001546 | Ga0070712_1000015469 | 98 |
| 165 | 3300006178 | Ga0075367_10027442 | Ga0075367_100274422 | 98 |
| 166 | 3300006195 | Ga0075366_10066576 | Ga0075366_100665762 | 98 |
| 167 | 3300006237 | Ga0097621_100000984 | Ga0097621_10000098416 | 98 |
| 168 | 3300006237 | Ga0097621_100113675 | Ga0097621_1001136753 | 98 |
| 169 | 3300006358 | Ga0068871_100023304 | Ga0068871_1000233042 | 98 |
| 170 | 3300006358 | Ga0068871_100667720 | Ga0068871_1006677202 | 98 |
| 171 | 3300006358 | Ga0068871_100791674 | Ga0068871_1007916742 | 98 |
| 172 | 3300006844 | Ga0075428_100002950 | Ga0075428_1000029505 | 98 |
| 173 | 3300006844 | Ga0075428_100237595 | Ga0075428_1002375954 | 98 |
| 174 | 3300006844 | Ga0075428_102751321 | Ga0075428_1027513212 | 98 |
| 175 | 3300006846 | Ga0075430_100166509 | Ga0075430_1001665092 | 98 |
| 176 | 3300006847 | Ga0075431_101210681 | Ga0075431_1012106813 | 98 |
| 177 | 3300006852 | Ga0075433_10144376 | Ga0075433_101443762 | 98 |
| 178 | 3300006852 | Ga0075433_10254073 | Ga0075433_102540732 | 98 |
| 179 | 3300006871 | Ga0075434_100334938 | Ga0075434_1003349382 | 98 |
| 180 | 3300006871 | Ga0075434_101191117 | Ga0075434_1011911172 | 98 |
| 181 | 3300006880 | Ga0075429_100043852 | Ga0075429_1000438522 | 98 |
| 182 | 3300006880 | Ga0075429_100528541 | Ga0075429_1005285412 | 98 |
| 183 | 3300006914 | Ga0075436_100009826 | Ga0075436_1000098265 | 98 |
| 184 | 3300006914 | Ga0075436_100177670 | Ga0075436_1001776702 | 98 |
| 185 | 3300006931 | Ga0097620_100013866 | Ga0097620_1000138665 | 98 |
| 186 | 3300006931 | Ga0097620_100055512 | Ga0097620_1000555123 | 98 |
| 187 | 3300006931 | Ga0097620_100103016 | Ga0097620_1001030161 | 98 |
| 188 | 3300006931 | Ga0097620_100620508 | Ga0097620_1006205082 | 98 |
| 189 | 3300006931 | Ga0097620_101281058 | Ga0097620_1012810582 | 98 |
| 190 | 3300007076 | Ga0075435_100160615 | Ga0075435_1001606152 | 98 |
| 191 | 3300007076 | Ga0075435_100383708 | Ga0075435_1003837081 | 98 |
| 192 | 3300009093 | Ga0105240_10001620 | Ga0105240_100016204 | 98 |
| 193 | 3300009093 | Ga0105240_10006110 | Ga0105240_100061109 | 98 |
| 194 | 3300009093 | Ga0105240_10006333 | Ga0105240_1000633318 | 98 |
| 195 | 3300009093 | Ga0105240_10006426 | Ga0105240_100064269 | 98 |
| 196 | 3300009093 | Ga0105240_10007803 | Ga0105240_100078039 | 98 |
| 197 | 3300009093 | Ga0105240_10014714 | Ga0105240_100147145 | 98 |
| 198 | 3300009093 | Ga0105240_10095116 | Ga0105240_100951164 | 98 |
| 199 | 3300009093 | Ga0105240_11686033 | Ga0105240_116860331 | 98 |
| 200 | 3300009093 | Ga0105240_12440338 | Ga0105240_124403382 | 98 |
| 201 | 3300009094 | Ga0111539_10036972 | Ga0111539_100369726 | 98 |
| 202 | 3300009094 | Ga0111539_10045535 | Ga0111539_100455352 | 98 |
| 203 | 3300009094 | Ga0111539_10049852 | Ga0111539_100498526 | 98 |
| 204 | 3300009094 | Ga0111539_10057337 | Ga0111539_100573372 | 98 |
| 205 | 3300009094 | Ga0111539_11125732 | Ga0111539_111257322 | 98 |
| 206 | 3300009094 | Ga0111539_13165711 | Ga0111539_131657112 | 98 |
| 207 | 3300009098 | Ga0105245_10000274 | Ga0105245_100002742 | 98 |
| 208 | 3300009098 | Ga0105245_10009530 | Ga0105245_100095309 | 98 |
| 209 | 3300009098 | Ga0105245_10083880 | Ga0105245_100838805 | 98 |
| 210 | 3300009101 | Ga0105247_10001592 | Ga0105247_100015926 | 98 |
| 211 | 3300009101 | Ga0105247_10677957 | Ga0105247_106779572 | 98 |
| 212 | 3300009101 | Ga0105247_11213089 | Ga0105247_112130891 | 98 |
| 213 | 3300009147 | Ga0114129_10034866 | Ga0114129_100348663 | 98 |
| 214 | 3300009147 | Ga0114129_10154935 | Ga0114129_101549352 | 98 |
| 215 | 3300009147 | Ga0114129_10441059 | Ga0114129_104410592 | 98 |
| 216 | 3300009147 | Ga0114129_10890246 | Ga0114129_108902461 | 98 |
| 217 | 3300009148 | Ga0105243_12266686 | Ga0105243_122666861 | 98 |
| 218 | 3300009148 | Ga0105243_12758120 | Ga0105243_127581201 | 98 |
| 219 | 3300009174 | Ga0105241_10000150 | Ga0105241_1000015040 | 98 |
| 220 | 3300009174 | Ga0105241_10002039 | Ga0105241_100020399 | 98 |
| 221 | 3300009174 | Ga0105241_10310876 | Ga0105241_103108762 | 98 |
| 222 | 3300009176 | Ga0105242_12439116 | Ga0105242_124391162 | 98 |
| 223 | 3300009177 | Ga0105248_10019971 | Ga0105248_100199719 | 98 |
| 224 | 3300009177 | Ga0105248_10150676 | Ga0105248_101506762 | 98 |
| 225 | 3300009545 | Ga0105237_10020861 | Ga0105237_100208618 | 98 |
| 226 | 3300009545 | Ga0105237_10317668 | Ga0105237_103176682 | 98 |
| 227 | 3300009545 | Ga0105237_10929731 | Ga0105237_109297313 | 98 |
| 228 | 3300009545 | Ga0105237_11046406 | Ga0105237_110464061 | 98 |
| 229 | 3300009545 | Ga0105237_11403481 | Ga0105237_114034812 | 98 |
| 230 | 3300009545 | Ga0105237_11929263 | Ga0105237_119292632 | 98 |
| 231 | 3300009545 | Ga0105237_12370521 | Ga0105237_123705212 | 98 |
| 232 | 3300009551 | Ga0105238_10000251 | Ga0105238_1000025155 | 98 |
| 233 | 3300009551 | Ga0105238_10000626 | Ga0105238_1000062621 | 98 |
| 234 | 3300009551 | Ga0105238_10003911 | Ga0105238_1000391116 | 98 |
| 235 | 3300009551 | Ga0105238_10154354 | Ga0105238_101543543 | 98 |
| 236 | 3300009551 | Ga0105238_10228224 | Ga0105238_102282242 | 98 |
| 237 | 3300009551 | Ga0105238_10489767 | Ga0105238_104897673 | 98 |
| 238 | 3300009551 | Ga0105238_10494532 | Ga0105238_104945322 | 98 |
| 239 | 3300009553 | Ga0105249_10017760 | Ga0105249_100177603 | 98 |
| 240 | 3300009553 | Ga0105249_10850989 | Ga0105249_108509892 | 98 |
| 241 | 3300009553 | Ga0105249_11033377 | Ga0105249_110333771 | 98 |
| 242 | 3300009553 | Ga0105249_11459441 | Ga0105249_114594411 | 98 |
| 243 | 3300010375 | Ga0105239_10000725 | Ga0105239_1000072511 | 98 |
| 244 | 3300010375 | Ga0105239_10005068 | Ga0105239_100050689 | 98 |
| 245 | 3300010375 | Ga0105239_10045106 | Ga0105239_100451062 | 98 |
| 246 | 3300010375 | Ga0105239_10197665 | Ga0105239_101976652 | 98 |
| 247 | 3300011119 | Ga0105246_10001271 | Ga0105246_100012718 | 98 |
| 248 | 3300011119 | Ga0105246_11657276 | Ga0105246_116572762 | 98 |
| 249 | 3300013104 | Ga0157370_10000128 | Ga0157370_100001284 | 98 |
| 250 | 3300013104 | Ga0157370_10560195 | Ga0157370_105601951 | 98 |
| 251 | 3300013104 | Ga0157370_10740003 | Ga0157370_107400032 | 98 |
| 252 | 3300013104 | Ga0157370_11879530 | Ga0157370_118795302 | 98 |
| 253 | 3300013104 | Ga0157370_12127384 | Ga0157370_121273842 | 98 |
| 254 | 3300013105 | Ga0157369_10000175 | Ga0157369_100001754 | 98 |
| 255 | 3300013105 | Ga0157369_10000369 | Ga0157369_1000036955 | 98 |
| 256 | 3300013105 | Ga0157369_10004534 | Ga0157369_1000453411 | 98 |
| 257 | 3300013105 | Ga0157369_10007975 | Ga0157369_1000797510 | 98 |
| 258 | 3300013105 | Ga0157369_10009288 | Ga0157369_100092883 | 98 |
| 259 | 3300013105 | Ga0157369_10337976 | Ga0157369_103379762 | 98 |
| 260 | 3300013105 | Ga0157369_10715925 | Ga0157369_107159252 | 98 |
| 261 | 3300013105 | Ga0157369_10807325 | Ga0157369_108073251 | 98 |
| 262 | 3300013105 | Ga0157369_11266024 | Ga0157369_112660242 | 98 |
| 263 | 3300013105 | Ga0157369_11372148 | Ga0157369_113721482 | 98 |
| 264 | 3300013296 | Ga0157374_10014614 | Ga0157374_100146148 | 98 |
| 265 | 3300013296 | Ga0157374_10124646 | Ga0157374_101246463 | 98 |
| 266 | 3300013297 | Ga0157378_10003951 | Ga0157378_100039519 | 98 |
| 267 | 3300013297 | Ga0157378_10005796 | Ga0157378_100057965 | 98 |
| 268 | 3300013297 | Ga0157378_10032477 | Ga0157378_100324774 | 98 |
| 269 | 3300013297 | Ga0157378_10066009 | Ga0157378_100660093 | 98 |
| 270 | 3300013297 | Ga0157378_10154126 | Ga0157378_101541263 | 98 |
| 271 | 3300013306 | Ga0163162_10189956 | Ga0163162_101899562 | 98 |
| 272 | 3300013306 | Ga0163162_10513298 | Ga0163162_105132982 | 98 |
| 273 | 3300013307 | Ga0157372_10000098 | Ga0157372_100000984 | 98 |
| 274 | 3300013307 | Ga0157372_10000659 | Ga0157372_1000065911 | 98 |
| 275 | 3300013307 | Ga0157372_10036378 | Ga0157372_100363784 | 98 |
| 276 | 3300013307 | Ga0157372_10073287 | Ga0157372_100732872 | 98 |
| 277 | 3300013307 | Ga0157372_10695319 | Ga0157372_106953192 | 98 |
| 278 | 3300013307 | Ga0157372_11065445 | Ga0157372_110654452 | 98 |
| 279 | 3300013307 | Ga0157372_11338167 | Ga0157372_113381671 | 98 |
| 280 | 3300013307 | Ga0157372_11746263 | Ga0157372_117462631 | 98 |
| 281 | 3300013308 | Ga0157375_10017534 | Ga0157375_100175346 | 98 |
| 282 | 3300013308 | Ga0157375_10602291 | Ga0157375_106022912 | 98 |
| 283 | 3300013308 | Ga0157375_10951427 | Ga0157375_109514272 | 98 |
| 284 | 3300013308 | Ga0157375_11097088 | Ga0157375_110970882 | 98 |
| 285 | 3300013308 | Ga0157375_11529008 | Ga0157375_115290082 | 98 |
| 286 | 3300013308 | Ga0157375_12618595 | Ga0157375_126185952 | 98 |
| 287 | 3300014325 | Ga0163163_10000308 | Ga0163163_1000030840 | 98 |
| 288 | 3300014325 | Ga0163163_11100083 | Ga0163163_111000832 | 98 |
| 289 | 3300014326 | Ga0157380_11163865 | Ga0157380_111638652 | 98 |
| 290 | 3300014326 | Ga0157380_11178741 | Ga0157380_111787412 | 98 |
| 291 | 3300014326 | Ga0157380_12079418 | Ga0157380_120794181 | 98 |
| 292 | 3300014745 | Ga0157377_10010640 | Ga0157377_100106403 | 98 |
| 293 | 3300014745 | Ga0157377_10737440 | Ga0157377_107374402 | 98 |
| 294 | 3300014968 | Ga0157379_10107913 | Ga0157379_101079132 | 98 |
| 295 | 3300014969 | Ga0157376_10410269 | Ga0157376_104102692 | 98 |
| 296 | 3300020069 | Ga0197907_10572396 | Ga0197907_105723962 | 98 |
| 297 | 3300020070 | Ga0206356_10296919 | Ga0206356_102969191 | 98 |
| 298 | 3300020078 | Ga0206352_10254630 | Ga0206352_102546301 | 98 |
| 299 | 3300020081 | Ga0206354_10052765 | Ga0206354_100527651 | 98 |
| 300 | 3300025321 | Ga0207656_10220552 | Ga0207656_102205522 | 98 |
| 301 | 3300025900 | Ga0207710_10001603 | Ga0207710_100016035 | 98 |
| 302 | 3300025900 | Ga0207710_10366931 | Ga0207710_103669311 | 98 |
| 303 | 3300025906 | Ga0207699_10001136 | Ga0207699_100011368 | 98 |
| 304 | 3300025909 | Ga0207705_10217026 | Ga0207705_102170262 | 98 |
| 305 | 3300025909 | Ga0207705_10374132 | Ga0207705_103741322 | 98 |
| 306 | 3300025911 | Ga0207654_10000180 | Ga0207654_1000018015 | 98 |
| 307 | 3300025911 | Ga0207654_10000548 | Ga0207654_1000054817 | 98 |
| 308 | 3300025911 | Ga0207654_10001207 | Ga0207654_100012077 | 98 |
| 309 | 3300025911 | Ga0207654_10136042 | Ga0207654_101360422 | 98 |
| 310 | 3300025911 | Ga0207654_10590601 | Ga0207654_105906013 | 98 |
| 311 | 3300025913 | Ga0207695_10000047 | Ga0207695_10000047117 | 98 |
| 312 | 3300025913 | Ga0207695_10000150 | Ga0207695_10000150180 | 98 |
| 313 | 3300025913 | Ga0207695_10000162 | Ga0207695_10000162182 | 98 |
| 314 | 3300025913 | Ga0207695_10001900 | Ga0207695_1000190022 | 98 |
| 315 | 3300025913 | Ga0207695_10009043 | Ga0207695_100090437 | 98 |
| 316 | 3300025913 | Ga0207695_10125451 | Ga0207695_101254513 | 98 |
| 317 | 3300025913 | Ga0207695_10275581 | Ga0207695_102755812 | 98 |
| 318 | 3300025914 | Ga0207671_10000155 | Ga0207671_1000015548 | 98 |
| 319 | 3300025914 | Ga0207671_10001417 | Ga0207671_100014178 | 98 |
| 320 | 3300025914 | Ga0207671_10191132 | Ga0207671_101911322 | 98 |
| 321 | 3300025914 | Ga0207671_10238251 | Ga0207671_102382512 | 98 |
| 322 | 3300025915 | Ga0207693_10000065 | Ga0207693_1000006533 | 98 |
| 323 | 3300025916 | Ga0207663_10004470 | Ga0207663_100044702 | 98 |
| 324 | 3300025920 | Ga0207649_10001760 | Ga0207649_100017601 | 98 |
| 325 | 3300025920 | Ga0207649_10098958 | Ga0207649_100989582 | 98 |
| 326 | 3300025920 | Ga0207649_10173556 | Ga0207649_101735562 | 98 |
| 327 | 3300025920 | Ga0207649_10486240 | Ga0207649_104862402 | 98 |
| 328 | 3300025921 | Ga0207652_11112179 | Ga0207652_111121792 | 98 |
| 329 | 3300025924 | Ga0207694_10000142 | Ga0207694_1000014244 | 98 |
| 330 | 3300025924 | Ga0207694_10000146 | Ga0207694_100001469 | 98 |
| 331 | 3300025924 | Ga0207694_10001885 | Ga0207694_100018852 | 98 |
| 332 | 3300025924 | Ga0207694_10009282 | Ga0207694_100092829 | 98 |
| 333 | 3300025924 | Ga0207694_11399037 | Ga0207694_113990371 | 98 |
| 334 | 3300025927 | Ga0207687_10005869 | Ga0207687_100058694 | 98 |
| 335 | 3300025927 | Ga0207687_11095246 | Ga0207687_110952461 | 98 |
| 336 | 3300025928 | Ga0207700_10887307 | Ga0207700_108873071 | 98 |
| 337 | 3300025929 | Ga0207664_10044194 | Ga0207664_100441945 | 98 |
| 338 | 3300025929 | Ga0207664_11624562 | Ga0207664_116245621 | 98 |
| 339 | 3300025931 | Ga0207644_10047216 | Ga0207644_100472162 | 98 |
| 340 | 3300025931 | Ga0207644_10064928 | Ga0207644_100649282 | 98 |
| 341 | 3300025939 | Ga0207665_10018887 | Ga0207665_100188873 | 98 |
| 342 | 3300025941 | Ga0207711_10035299 | Ga0207711_100352995 | 98 |
| 343 | 3300025941 | Ga0207711_10095993 | Ga0207711_100959932 | 98 |
| 344 | 3300025942 | Ga0207689_10025128 | Ga0207689_100251285 | 98 |
| 345 | 3300025942 | Ga0207689_10703481 | Ga0207689_107034812 | 98 |
| 346 | 3300025945 | Ga0207679_10159169 | Ga0207679_101591692 | 98 |
| 347 | 3300025945 | Ga0207679_10335838 | Ga0207679_103358382 | 98 |
| 348 | 3300025949 | Ga0207667_10003680 | Ga0207667_100036808 | 98 |
| 349 | 3300025949 | Ga0207667_10020778 | Ga0207667_100207782 | 98 |
| 350 | 3300025949 | Ga0207667_10028534 | Ga0207667_100285345 | 98 |
| 351 | 3300025961 | Ga0207712_10051495 | Ga0207712_100514953 | 98 |
| 352 | 3300025981 | Ga0207640_10018350 | Ga0207640_100183502 | 98 |
| 353 | 3300025981 | Ga0207640_10391384 | Ga0207640_103913842 | 98 |
| 354 | 3300025986 | Ga0207658_10021723 | Ga0207658_100217232 | 98 |
| 355 | 3300026023 | Ga0207677_10000782 | Ga0207677_100007829 | 98 |
| 356 | 3300026035 | Ga0207703_10003901 | Ga0207703_100039017 | 98 |
| 357 | 3300026041 | Ga0207639_10000098 | Ga0207639_1000009870 | 98 |
| 358 | 3300026067 | Ga0207678_10297511 | Ga0207678_102975112 | 98 |
| 359 | 3300026078 | Ga0207702_10003868 | Ga0207702_100038682 | 98 |
| 360 | 3300026078 | Ga0207702_10004419 | Ga0207702_100044193 | 98 |
| 361 | 3300026078 | Ga0207702_10104551 | Ga0207702_101045512 | 98 |
| 362 | 3300026088 | Ga0207641_10003181 | Ga0207641_100031819 | 98 |
| 363 | 3300026095 | Ga0207676_10005538 | Ga0207676_100055387 | 98 |
| 364 | 3300026095 | Ga0207676_10941002 | Ga0207676_109410021 | 98 |
| 365 | 3300026095 | Ga0207676_11509892 | Ga0207676_115098922 | 98 |
| 366 | 3300026116 | Ga0207674_10001977 | Ga0207674_100019779 | 98 |
| 367 | 3300026116 | Ga0207674_10003452 | Ga0207674_100034523 | 98 |
| 368 | 3300026116 | Ga0207674_10839456 | Ga0207674_108394562 | 98 |
| 369 | 3300026118 | Ga0207675_100222696 | Ga0207675_1002226962 | 98 |
| 370 | 3300026118 | Ga0207675_101189314 | Ga0207675_1011893142 | 98 |
| 371 | 3300026142 | Ga0207698_10000031 | Ga0207698_1000003195 | 98 |
| 372 | 3300026142 | Ga0207698_10000241 | Ga0207698_100002418 | 98 |
| 373 | 3300026142 | Ga0207698_10134745 | Ga0207698_101347452 | 98 |
| 374 | 3300026142 | Ga0207698_10255710 | Ga0207698_102557102 | 98 |
| 375 | 3300026142 | Ga0207698_10902135 | Ga0207698_109021352 | 98 |
| 376 | 3300026142 | Ga0207698_10905284 | Ga0207698_109052842 | 98 |
| 377 | 3300027866 | Ga0209813_10192801 | Ga0209813_101928012 | 98 |
| 378 | 3300027907 | Ga0207428_10081579 | Ga0207428_100815791 | 98 |
| 379 | 3300028379 | Ga0268266_10013494 | Ga0268266_100134948 | 98 |
| 380 | 3300028380 | Ga0268265_10901251 | Ga0268265_109012512 | 98 |
| 381 | 3300028381 | Ga0268264_10002705 | Ga0268264_100027057 | 98 |
| 382 | 3300028563 | Ga0265319_1008416 | Ga0265319_10084163 | 98 |
| 383 | 3300028573 | Ga0265334_10171414 | Ga0265334_101714142 | 98 |
| 384 | 3300028577 | Ga0265318_10000563 | Ga0265318_100005638 | 98 |
| 385 | 3300028800 | Ga0265338_10061471 | Ga0265338_100614712 | 98 |
| 386 | 3300028800 | Ga0265338_10230759 | Ga0265338_102307592 | 98 |
| 387 | 3300031235 | Ga0265330_10065382 | Ga0265330_100653822 | 98 |
| 388 | 3300031235 | Ga0265330_10067886 | Ga0265330_100678861 | 98 |
| 389 | 3300031235 | Ga0265330_10285832 | Ga0265330_102858321 | 98 |
| 390 | 3300031238 | Ga0265332_10061018 | Ga0265332_100610182 | 98 |
| 391 | 3300031238 | Ga0265332_10116918 | Ga0265332_101169181 | 98 |
| 392 | 3300031239 | Ga0265328_10026108 | Ga0265328_100261084 | 98 |
| 393 | 3300031240 | Ga0265320_10000328 | Ga0265320_1000032826 | 98 |
| 394 | 3300031240 | Ga0265320_10557485 | Ga0265320_105574851 | 98 |
| 395 | 3300031241 | Ga0265325_10003694 | Ga0265325_100036944 | 98 |
| 396 | 3300031242 | Ga0265329_10000518 | Ga0265329_1000051817 | 98 |
| 397 | 3300031247 | Ga0265340_10011233 | Ga0265340_100112332 | 98 |
| 398 | 3300031249 | Ga0265339_10002679 | Ga0265339_1000267915 | 98 |
| 399 | 3300031249 | Ga0265339_10021726 | Ga0265339_100217262 | 98 |
| 400 | 3300031250 | Ga0265331_10000021 | Ga0265331_10000021216 | 98 |
| 401 | 3300031251 | Ga0265327_10151398 | Ga0265327_101513982 | 98 |
| 402 | 3300031344 | Ga0265316_10000779 | Ga0265316_1000077921 | 98 |
| 403 | 3300031344 | Ga0265316_10003604 | Ga0265316_100036046 | 98 |
| 404 | 3300031344 | Ga0265316_10077838 | Ga0265316_100778382 | 98 |
| 405 | 3300031595 | Ga0265313_10000730 | Ga0265313_100007309 | 98 |
| 406 | 3300031595 | Ga0265313_10025245 | Ga0265313_100252453 | 98 |
| 407 | 3300031711 | Ga0265314_10012056 | Ga0265314_100120562 | 98 |
| 408 | 3300031712 | Ga0265342_10000032 | Ga0265342_10000032138 | 98 |
| 409 | 3300031712 | Ga0265342_10001096 | Ga0265342_1000109613 | 98 |
| 410 | 3300031712 | Ga0265342_10457739 | Ga0265342_104577391 | 98 |
| 411 | 3300031824 | Ga0307413_10785578 | Ga0307413_107855782 | 98 |
| 412 | 3300031903 | Ga0307407_11205795 | Ga0307407_112057951 | 98 |
| 413 | 3300032005 | Ga0307411_10356352 | Ga0307411_103563522 | 98 |
| 414 | 3300035119 | Ga0373956_0441635 | Ga0373956_0441635_128_451 | 98 |
| 415 | 3300035695 | Ga0373927_0014954 | Ga0373927_0014954_2232_2534 | 98 |
| 416 | 3300035724 | Ga0373933_0896158 | Ga0373933_0896158_16_351 | 98 |
| 417 | 3300037068 | Ga0373925_1286443 | Ga0373925_1286443_43_360 | 98 |
| 418 | 3300039447 | Ga0436361_0552241 | Ga0436361_0552241_664_963 | 98 |
| 419 | 3300044694 | Ga0466963_1180336 | Ga0466963_1180336_177_476 | 98 |
| 420 | 3300044765 | Ga0466970_0235832 | Ga0466970_0235832_383_685 | 98 |
| 421 | 3300044842 | Ga0466957_0178300 | Ga0466957_0178300_875_1177 | 98 |
| 422 | 3300045049 | Ga0466959_0127456 | Ga0466959_0127456_1334_1636 | 98 |
| 423 | 3300045049 | Ga0466959_0247119 | Ga0466959_0247119_266_568 | 98 |
| 424 | 3300045049 | Ga0466959_0253329 | Ga0466959_0253329_36_407 | 98 |
| 425 | 3300045049 | Ga0466959_0571018 | Ga0466959_0571018_363_665 | 98 |
| 426 | 3300045051 | Ga0451576_0481702 | Ga0451576_0481702_16_375 | 98 |
| 427 | 3300045836 | Ga0466958_0160229 | Ga0466958_0160229_622_924 | 98 |
| 428 | 3300045976 | Ga0466967_0003508 | Ga0466967_0003508_6350_6664 | 98 |
| 429 | 3300045976 | Ga0466967_0213697 | Ga0466967_0213697_1458_1760 | 98 |
| 430 | 3300046455 | Ga0495603_0793537 | Ga0495603_0793537_117_416 | 98 |
| 431 | 3300046535 | Ga0495586_0726746 | Ga0495586_0726746_248_547 | 98 |
| 432 | 3300046543 | Ga0495645_0571603 | Ga0495645_0571603_256_561 | 98 |
| 433 | 3300046678 | Ga0495599_0128220 | Ga0495599_0128220_814_1119 | 98 |
| 434 | 3300046683 | Ga0495658_0181181 | Ga0495658_0181181_333_632 | 98 |
| 435 | 3300048908 | Ga0496105_0087624 | Ga0496105_0087624_345_659 | 98 |
| 436 | 3300049568 | Ga0501031_0016623 | Ga0501031_0016623_2917_3216 | 98 |
| 437 | 3300049569 | Ga0501032_0211664 | Ga0501032_0211664_841_1140 | 98 |
| 438 | 3300049570 | Ga0501033_0001552 | Ga0501033_0001552_19900_20199 | 98 |
| 439 | 3300049571 | Ga0501034_0011943 | Ga0501034_0011943_8295_8603 | 98 |
| 440 | 3300049571 | Ga0501034_0044404 | Ga0501034_0044404_4073_4372 | 98 |
| 441 | 3300049572 | Ga0501036_0003777 | Ga0501036_0003777_2296_2595 | 98 |
| 442 | 3300049573 | Ga0501037_0025670 | Ga0501037_0025670_4019_4318 | 98 |
| 443 | 3300049574 | Ga0501038_0021002 | Ga0501038_0021002_535_834 | 98 |
| 444 | 3300049575 | Ga0501039_0481511 | Ga0501039_0481511_11_310 | 98 |
| 445 | 3300049578 | Ga0501042_0319686 | Ga0501042_0319686_522_821 | 98 |
| 446 | 3300049579 | Ga0501043_0030448 | Ga0501043_0030448_863_1162 | 98 |
| 447 | 3300049580 | Ga0501046_0020894 | Ga0501046_0020894_552_851 | 98 |
| 448 | 3300049581 | Ga0501047_0135523 | Ga0501047_0135523_1960_2259 | 98 |
| 449 | 3300049582 | Ga0501048_0108405 | Ga0501048_0108405_1563_1862 | 98 |
| 450 | 3300049583 | Ga0501067_0023446 | Ga0501067_0023446_1353_1652 | 98 |
| 451 | 3300049584 | Ga0501068_0015278 | Ga0501068_0015278_2546_2845 | 98 |
| 452 | 3300049585 | Ga0501069_0295420 | Ga0501069_0295420_606_905 | 98 |
| 453 | 3300049586 | Ga0501070_0002988 | Ga0501070_0002988_1563_1862 | 98 |
| 454 | 3300049586 | Ga0501070_0649599 | Ga0501070_0649599_257_565 | 98 |
| 455 | 3300049590 | Ga0501074_0017824 | Ga0501074_0017824_1979_2278 | 98 |
| 456 | 3300049741 | Ga0501079_0201966 | Ga0501079_0201966_539_838 | 98 |
| 457 | 3300049742 | Ga0501080_0058394 | Ga0501080_0058394_3041_3340 | 98 |
| 458 | 3300049744 | Ga0501083_0014829 | Ga0501083_0014829_3938_4237 | 98 |
| 459 | 3300049822 | Ga0501035_0610944 | Ga0501035_0610944_490_789 | 98 |
| 460 | 3300049823 | Ga0501044_0263693 | Ga0501044_0263693_842_1141 | 98 |
| 461 | 3300049824 | Ga0501045_0176870 | Ga0501045_0176870_449_748 | 98 |
| 462 | 3300050491 | nmdc:mga00v17_67871_c1 | nmdc:mga00v17_67871_c1_932_1264 | 98 |
| 463 | 3300050493 | nmdc:mga0k408_177803_c1 | nmdc:mga0k408_177803_c1_167_499 | 98 |
| 464 | 3300050494 | nmdc:mga06z11_166270_c1 | nmdc:mga06z11_166270_c1_666_998 | 98 |
| 465 | 3300050496 | nmdc:mga07m45_87946_c1 | nmdc:mga07m45_87946_c1_1191_1523 | 98 |
| 466 | 3300054114 | Ga0501084_0800820 | Ga0501084_0800820_376_675 | 98 |
| 467 | 3300059478 | Ga0587093_109338 | Ga0587093_109338_64_366 | 98 |
| 468 | 3300059507 | Ga0587086_059289 | Ga0587086_059289_160_462 | 98 |
| 469 | 3300059508 | Ga0587088_139826 | Ga0587088_139826_107_409 | 98 |
| 470 | 3300059605 | Ga0587106_125862 | Ga0587106_125862_110_412 | 98 |
| 471 | 3300060353 | Ga0501082_0000448 | Ga0501082_0000448_32249_32548 | 98 |
| 472 | 3300060353 | Ga0501082_0042558 | Ga0501082_0042558_2436_2735 | 98 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.8423 | 3 | 97 |
| 4hro-assembly1.cif.gz_A | crystal structure of h. volcanii small archaeal modifier protein 1 | 0.8187 | 3 | 94 |
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.8093 | 3 | 97 |
| 3dwm-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis cyso, an antigen | 0.8016 | 1 | 94 |
| 3dwm-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis cyso, an antigen | 0.7938 | 1 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8187 | 3 | 94 | 3.10.20.30 |
| af_Q54NM8_4_86_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.816 | 1 | 97 | 3.10.20.30 |
| af_Q54NM8_4_86_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8076 | 1 | 97 | 3.10.20.30 |
| 5mpoA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.7935 | 1 | 96 | 3.10.20.30 |
| af_A0A0B4J391_26_106_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.7905 | 3 | 97 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535NE45-F1-model_v4 | MoaD/ThiS family protein | 1.003 | 1 | 46 |
|
| AF-A0A517TT76-F1-model_v4 | MoaD/ThiS family protein | 0.9984 | 1 | 97 |
|
| AF-A0A1F8SIJ2-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9957 | 1 | 93 |
|
| AF-A0A7V6Z057-F1-model_v4 | MoaD/ThiS family protein | 0.9931 | 1 | 97 |
|
| AF-A0A1G0SXB6-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.992 | 1 | 84 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar