F450780

General Info

Members Datasets Scaffolds Average Seq Length
472 305 944 138

Family's Representative Sequence

Representative Sequence 3300006942|Ga0099824_1015795|Ga0099824_10157955
Length 132
Sequence MTSSTNPIEHSFELAAAACDDLTPLVYRRLFREHPEAQVMFRSEPVKGSMLSLTIEALLDFAGERTGHFRLIECEVSSHDAYGTPRDLFVAFFGVIAATLRELLGEQWSDEIDAAWHKLLCDLEAIVRQQPD

Samples

Sample ID Description Type Environment
1 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
132 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
133 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
134 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
265 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
266 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
271 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
272 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
273 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
274 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
277 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
278 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
279 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
280 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
281 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
282 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
283 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
284 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
285 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
286 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
287 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
288 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
289 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
290 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
291 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
292 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
293 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
294 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
295 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
296 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
297 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
298 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
299 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
300 2904699407
301 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
302 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
303 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
304 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
305 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 0
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.17
Nodule 4.03
Rhizoplane 2.97
Rhizosphere 76.91
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099824_1015795 3300006942 Bacteria 7031
2 JGI25404J52841_10041783 3300003659 Bacteria 970
3 Ga0065165_1115860 3300005262 Bacteria 655
4 Ga0070683_100022065 3300005329 Bacteria 5686
5 Ga0070683_102053884 3300005329 Bacteria 549
6 Ga0070690_100058425 3300005330 Bacteria 2477
7 Ga0070680_100009263 3300005336 Bacteria 7555
8 Ga0070660_100012305 3300005339 Bacteria 6106
9 Ga0070660_100672368 3300005339 Bacteria 867
10 Ga0070689_100086432 3300005340 Bacteria 2466
11 Ga0070689_101765199 3300005340 Bacteria 564
12 Ga0070661_100541460 3300005344 Bacteria 936
13 Ga0070668_100452996 3300005347 Bacteria 1103
14 Ga0070668_100794311 3300005347 Bacteria 840
15 Ga0070675_100813661 3300005354 Bacteria 854
16 Ga0070675_101057654 3300005354 Bacteria 746
17 Ga0070674_100126318 3300005356 Bacteria 1900
18 Ga0070674_100931546 3300005356 Bacteria 758
19 Ga0070688_100171288 3300005365 Bacteria 1499
20 Ga0070659_100141026 3300005366 Bacteria 1962
21 Ga0070659_100361497 3300005366 Bacteria 1219
22 Ga0070709_10475032 3300005434 Bacteria 946
23 Ga0070709_10741761 3300005434 Bacteria 767
24 Ga0070709_11251331 3300005434 Bacteria 597
25 Ga0070713_100824572 3300005436 Bacteria 890
26 Ga0070713_100835456 3300005436 Bacteria 884
27 Ga0070701_10081611 3300005438 Bacteria 1752
28 Ga0070701_10134755 3300005438 Bacteria 1406
29 Ga0070711_100712274 3300005439 Bacteria 846
30 Ga0070708_100130658 3300005445 Bacteria 2324
31 Ga0070663_101007333 3300005455 Bacteria 724
32 Ga0070678_100090216 3300005456 Bacteria 2348
33 Ga0070678_100176395 3300005456 Bacteria 1745
34 Ga0070678_100465257 3300005456 Bacteria 1110
35 Ga0070678_100510961 3300005456 Bacteria 1061
36 Ga0070678_100536012 3300005456 Bacteria 1037
37 Ga0070681_10158829 3300005458 Bacteria 2185
38 Ga0070681_10319064 3300005458 Bacteria 1463
39 Ga0070685_10710774 3300005466 Bacteria 733
40 Ga0070706_100493742 3300005467 Bacteria 1139
41 Ga0070707_101394943 3300005468 Bacteria 667
42 Ga0070698_100165645 3300005471 Bacteria 2153
43 Ga0070698_100431920 3300005471 Bacteria 1252
44 Ga0070679_100321207 3300005530 Bacteria 1497
45 Ga0070679_100472187 3300005530 Bacteria 1199
46 Ga0070679_100895597 3300005530 Bacteria 831
47 Ga0070684_100018135 3300005535 Bacteria 5791
48 Ga0070697_100561111 3300005536 Bacteria 1002
49 Ga0068853_100007871 3300005539 Bacteria 8547
50 Ga0070672_100072157 3300005543 Bacteria 2749
51 Ga0070672_100201915 3300005543 Bacteria 1663
52 Ga0070686_100279010 3300005544 Bacteria 1232
53 Ga0070686_101066826 3300005544 Bacteria 666
54 Ga0070695_100383905 3300005545 Bacteria 1061
55 Ga0070665_100115797 3300005548 Bacteria 2683
56 Ga0070665_100415172 3300005548 Bacteria 1354
57 Ga0068855_100069044 3300005563 Bacteria 4113
58 Ga0068855_100116894 3300005563 Bacteria 3056
59 Ga0068855_101186645 3300005563 Bacteria 794
60 Ga0070664_100512654 3300005564 Bacteria 1106
61 Ga0070664_101304818 3300005564 Bacteria 685
62 Ga0068857_100016728 3300005577 Bacteria 6425
63 Ga0068856_100290808 3300005614 Bacteria 1651
64 Ga0068852_100038827 3300005616 Bacteria 4004
65 Ga0068859_100477362 3300005617 Bacteria 1342
66 Ga0068866_10090737 3300005718 Bacteria 1663
67 Ga0068851_10228160 3300005834 Bacteria 1049
68 Ga0068851_10409266 3300005834 Bacteria 799
69 Ga0068870_10828506 3300005840 Bacteria 649
70 Ga0068863_100081398 3300005841 Bacteria 3067
71 Ga0068863_100198236 3300005841 Bacteria 1930
72 Ga0068858_100425889 3300005842 Bacteria 1276
73 Ga0068858_100897132 3300005842 Bacteria 867
74 Ga0068860_100000469 3300005843 Bacteria 50219
75 Ga0068860_100415599 3300005843 Bacteria 1332
76 Ga0068860_100498431 3300005843 Bacteria 1216
77 Ga0068862_100210791 3300005844 Bacteria 1755
78 Ga0081540_1008226 3300005983 Bacteria 7308
79 Ga0081540_1018032 3300005983 Bacteria 4346
80 Ga0075365_10037571 3300006038 Bacteria 3145
81 Ga0075365_10107814 3300006038 Bacteria 1912
82 Ga0075363_100129006 3300006048 Bacteria 1417
83 Ga0070715_10672136 3300006163 Bacteria 615
84 Ga0070716_100931004 3300006173 Bacteria 683
85 Ga0070712_100047343 3300006175 Bacteria 2976
86 Ga0070712_100237699 3300006175 Bacteria 1450
87 Ga0075367_10404434 3300006178 Bacteria 863
88 Ga0075366_10702273 3300006195 Bacteria 628
89 Ga0097621_100309268 3300006237 Bacteria 1398
90 Ga0068871_100057645 3300006358 Bacteria 3160
91 Ga0068871_100580478 3300006358 Bacteria 1018
92 Ga0068865_100010414 3300006881 Bacteria 5787
93 Ga0068865_100601204 3300006881 Bacteria 929
94 Ga0097620_100477323 3300006931 Bacteria 1342
95 Ga0099822_1009319 3300006943 Bacteria 12382
96 Ga0099794_10032149 3300007265 Bacteria 2461
97 Ga0099794_10033703 3300007265 Bacteria 2408
98 Ga0099795_10022065 3300007788 Bacteria 2097
99 Ga0105240_10051150 3300009093 Bacteria 5202
100 Ga0105240_10240744 3300009093 Bacteria 2097
101 Ga0105240_10502751 3300009093 Bacteria 1347
102 Ga0105247_10009434 3300009101 Bacteria 5924
103 Ga0105247_10069370 3300009101 Bacteria 2200
104 Ga0105247_10167731 3300009101 Bacteria 1458
105 Ga0105247_10417397 3300009101 Bacteria 960
106 Ga0105243_10100149 3300009148 Bacteria 2404
107 Ga0105241_11127967 3300009174 Bacteria 740
108 Ga0105248_10880219 3300009177 Bacteria 1011
109 Ga0105237_10084692 3300009545 Bacteria 3160
110 Ga0105237_10091247 3300009545 Bacteria 3036
111 Ga0105237_10424013 3300009545 Bacteria 1336
112 Ga0105237_11063797 3300009545 Unclassified 816
113 Ga0105237_11633753 3300009545 Bacteria 651
114 Ga0105238_10017117 3300009551 Bacteria 7358
115 Ga0105238_10679291 3300009551 Bacteria 1041
116 Ga0105249_10754043 3300009553 Bacteria 1036
117 Ga0099796_10033256 3300010159 Bacteria 1696
118 Ga0105239_10137327 3300010375 Bacteria 2722
119 Ga0105239_10144153 3300010375 Bacteria 2655
120 Ga0105239_10487658 3300010375 Bacteria 1400
121 Ga0105239_10574739 3300010375 Bacteria 1284
122 Ga0105239_12418124 3300010375 Bacteria 612
123 Ga0105246_10100140 3300011119 Bacteria 2108
124 Ga0105246_10861007 3300011119 Bacteria 809
125 Ga0157337_1013623 3300012483 Bacteria 671
126 Ga0157369_10082565 3300013105 Bacteria 3438
127 Ga0157369_11838967 3300013105 Bacteria 615
128 Ga0157374_10914462 3300013296 Bacteria 895
129 Ga0157374_11286653 3300013296 Bacteria 753
130 Ga0157374_12040832 3300013296 Bacteria 600
131 Ga0157378_10048156 3300013297 Bacteria 3790
132 Ga0157378_10274514 3300013297 Bacteria 1623
133 Ga0157378_11703937 3300013297 Bacteria 677
134 Ga0163162_10614388 3300013306 Bacteria 1212
135 Ga0163162_10706508 3300013306 Bacteria 1130
136 Ga0163162_10856644 3300013306 Bacteria 1024
137 Ga0157372_10191237 3300013307 Bacteria 2371
138 Ga0157375_10073807 3300013308 Bacteria 3431
139 Ga0163163_10855348 3300014325 Bacteria 973
140 Ga0157380_11123145 3300014326 Bacteria 826
141 Ga0157380_11540141 3300014326 Bacteria 719
142 Ga0182008_10164649 3300014497 Bacteria 1117
143 Ga0157379_10466712 3300014968 Bacteria 1167
144 Ga0157376_10357859 3300014969 Bacteria 1399
145 Ga0163161_10016627 3300017792 Bacteria 5137
146 Ga0163161_11453268 3300017792 Bacteria 600
147 Ga0209758_1009002 3300025297 Bacteria 6311
148 Ga0207697_10291740 3300025315 Bacteria 723
149 Ga0207656_10084960 3300025321 Bacteria 1428
150 Ga0207682_10519851 3300025893 Bacteria 563
151 Ga0207710_10060164 3300025900 Bacteria 1721
152 Ga0207688_10088446 3300025901 Bacteria 1776
153 Ga0207684_10338198 3300025910 Bacteria 1296
154 Ga0207707_10009415 3300025912 Bacteria 8473
155 Ga0207707_10503564 3300025912 Bacteria 1033
156 Ga0207695_10028180 3300025913 Bacteria 6235
157 Ga0207695_10469271 3300025913 Bacteria 1141
158 Ga0207671_10010265 3300025914 Bacteria 7744
159 Ga0207671_10334433 3300025914 Bacteria 1200
160 Ga0207693_10082875 3300025915 Bacteria 2512
161 Ga0207663_10447708 3300025916 Bacteria 995
162 Ga0207660_10034871 3300025917 Bacteria 3490
163 Ga0207660_10350272 3300025917 Bacteria 1183
164 Ga0207657_10003989 3300025919 Bacteria 15691
165 Ga0207657_10243297 3300025919 Bacteria 1436
166 Ga0207652_10012855 3300025921 Bacteria 6768
167 Ga0207652_10853699 3300025921 Bacteria 806
168 Ga0207646_10231545 3300025922 Bacteria 1669
169 Ga0207694_10041206 3300025924 Bacteria 3558
170 Ga0207694_11352402 3300025924 Bacteria 602
171 Ga0207659_10448066 3300025926 Bacteria 1087
172 Ga0207700_10476154 3300025928 Bacteria 1103
173 Ga0207664_10301838 3300025929 Bacteria 1409
174 Ga0207706_10021355 3300025933 Bacteria 5816
175 Ga0207709_10149732 3300025935 Bacteria 1615
176 Ga0207670_10202327 3300025936 Bacteria 1510
177 Ga0207669_10073695 3300025937 Bacteria 2155
178 Ga0207704_10026146 3300025938 Bacteria 3197
179 Ga0207691_10022479 3300025940 Bacteria 5947
180 Ga0207691_10195560 3300025940 Bacteria 1762
181 Ga0207689_10130988 3300025942 Bacteria 2064
182 Ga0207679_10571965 3300025945 Bacteria 1016
183 Ga0207667_10045088 3300025949 Bacteria 4670
184 Ga0207667_10180050 3300025949 Bacteria 2171
185 Ga0207667_11677130 3300025949 Bacteria 603
186 Ga0207712_10185672 3300025961 Bacteria 1637
187 Ga0207668_10451124 3300025972 Bacteria 1097
188 Ga0207658_10614389 3300025986 Bacteria 977
189 Ga0207703_10775754 3300026035 Bacteria 914
190 Ga0207703_11445403 3300026035 Bacteria 661
191 Ga0207639_10005362 3300026041 Bacteria 8666
192 Ga0207678_10585937 3300026067 Bacteria 977
193 Ga0207708_10111321 3300026075 Bacteria 2126
194 Ga0207702_10321858 3300026078 Bacteria 1473
195 Ga0207702_10375871 3300026078 Bacteria 1365
196 Ga0207641_10035342 3300026088 Bacteria 4162
197 Ga0207648_10310996 3300026089 Bacteria 1414
198 Ga0207676_11224474 3300026095 Bacteria 744
199 Ga0207674_10024558 3300026116 Bacteria 6437
200 Ga0207675_100649072 3300026118 Bacteria 1061
201 Ga0207683_10307056 3300026121 Bacteria 1452
202 Ga0207683_10502364 3300026121 Bacteria 1120
203 Ga0207683_10554599 3300026121 Bacteria 1062
204 Ga0207683_10751022 3300026121 Bacteria 905
205 Ga0207698_10298495 3300026142 Bacteria 1498
206 Ga0207698_10306851 3300026142 Bacteria 1480
207 Ga0209589_1000003 3300027357 Bacteria 629130
208 Ga0209489_100003 3300027361 Bacteria 663105
209 Ga0209700_100003 3300027363 Bacteria 663105
210 Ga0209588_1013366 3300027671 Bacteria 2503
211 Ga0268266_10546672 3300028379 Bacteria 1109
212 Ga0268266_10563233 3300028379 Bacteria 1092
213 Ga0268266_10769463 3300028379 Bacteria 929
214 Ga0268264_10000022 3300028381 Bacteria 476624
215 Ga0307511_10098616 3300030521 Bacteria 1933
216 Ga0265330_10147648 3300031235 Bacteria 999
217 Ga0265332_10022675 3300031238 Bacteria 2770
218 Ga0265325_10010874 3300031241 Bacteria 5246
219 Ga0265340_10004404 3300031247 Bacteria 7879
220 Ga0265331_10018697 3300031250 Bacteria 3587
221 Ga0265331_10182675 3300031250 Bacteria 947
222 Ga0265316_10073238 3300031344 Bacteria 2639
223 Ga0265316_10662863 3300031344 Bacteria 737
224 Ga0307509_10121840 3300031507 Bacteria 2584
225 Ga0307508_10121036 3300031616 Bacteria 2220
226 Ga0307508_10549570 3300031616 Bacteria 753
227 Ga0265314_10038940 3300031711 Bacteria 3430
228 Ga0265314_10041341 3300031711 Bacteria 3301
229 Ga0265342_10141339 3300031712 Bacteria 1343
230 Ga0307411_11940839 3300032005 Bacteria 549
231 Ga0307507_10036993 3300033179 Bacteria 4974
232 Ga0307510_10061950 3300033180 Bacteria 3828
233 Ga0307510_10400276 3300033180 Bacteria 816
234 Ga0315911_1000001 3300033442 Bacteria 1088602
235 Ga0373926_0218519 3300035083 Bacteria 735
236 Ga0373929_0046364 3300035085 Bacteria 982
237 Ga0373934_0022928 3300035086 Bacteria 2410
238 Ga0373934_0101876 3300035086 Bacteria 1161
239 Ga0373934_0260389 3300035086 Bacteria 718
240 Ga0373944_0077284 3300035089 Bacteria 1094
241 Ga0373923_0044635 3300035111 Bacteria 1838
242 Ga0373923_0051159 3300035111 Bacteria 1732
243 Ga0373923_0110659 3300035111 Bacteria 1219
244 Ga0373932_0387230 3300035112 Bacteria 538
245 Ga0373936_0015833 3300035113 Bacteria 2893
246 Ga0373936_0420463 3300035113 Bacteria 615
247 Ga0373936_0573897 3300035113 Bacteria 528
248 Ga0373945_0018308 3300035116 Bacteria 2382
249 Ga0373953_0000391 3300035117 Bacteria 11920
250 Ga0373954_0000035 3300035118 Bacteria 51266
251 Ga0373954_0006222 3300035118 Bacteria 5205
252 Ga0373956_0000207 3300035119 Bacteria 22860
253 Ga0373956_0428988 3300035119 Bacteria 631
254 Ga0373957_0001128 3300035120 Bacteria 7068
255 Ga0373943_0015005 3300035170 Bacteria 3516
256 Ga0373943_0053506 3300035170 Bacteria 1994
257 Ga0373946_0004658 3300035171 Bacteria 4922
258 Ga0373955_0001026 3300035172 Bacteria 11850
259 Ga0373955_0107721 3300035172 Bacteria 1608
260 Ga0373924_0006045 3300035410 Bacteria 4320
261 Ga0373924_0080478 3300035410 Bacteria 1385
262 Ga0373931_0081607 3300035691 Bacteria 1786
263 Ga0373931_0350007 3300035691 Bacteria 925
264 Ga0373935_0000256 3300035692 Bacteria 26305
265 Ga0373935_0025093 3300035692 Bacteria 3673
266 Ga0373935_1398112 3300035692 Bacteria 523
267 Ga0373927_0005857 3300035695 Bacteria 8428
268 Ga0373927_0032639 3300035695 Bacteria 3391
269 Ga0373933_0000037 3300035724 Bacteria 81092
270 Ga0373947_0001480 3300035725 Bacteria 14434
271 Ga0373937_0000118 3300036401 Bacteria 75902
272 Ga0373937_0076968 3300036401 Bacteria 3082
273 Ga0373925_0020476 3300037068 Bacteria 4815
274 Ga0373925_0024933 3300037068 Bacteria 4368
275 Ga0373925_0370803 3300037068 Bacteria 1165
276 Ga0373925_0805655 3300037068 Bacteria 774
277 Ga0373925_1341703 3300037068 Bacteria 586
278 Ga0395905_0716540 3300037471 Bacteria 903
279 Ga0395905_1042395 3300037471 Bacteria 721
280 Ga0451798_0019876 3300041458 Bacteria 896
281 Ga0451853_1679816 3300041512 Bacteria 540
282 Ga0466969_0108532 3300044656 Bacteria 1301
283 Ga0495592_0000649 3300046454 Bacteria 24123
284 Ga0495592_0087410 3300046454 Bacteria 2242
285 Ga0495603_0000027 3300046455 Bacteria 61238
286 Ga0495603_0008387 3300046455 Bacteria 6243
287 Ga0495629_0000290 3300046459 Bacteria 43459
288 Ga0495629_0001487 3300046459 Bacteria 18475
289 Ga0495638_0528787 3300046460 Bacteria 589
290 Ga0495641_0004283 3300046461 Bacteria 10166
291 Ga0495651_0000412 3300046462 Bacteria 33198
292 Ga0495651_0084347 3300046462 Bacteria 2394
293 Ga0495651_0918980 3300046462 Bacteria 534
294 Ga0495653_0000161 3300046463 Bacteria 55322
295 Ga0495653_0100958 3300046463 Bacteria 2091
296 Ga0495653_0591316 3300046463 Bacteria 683
297 Ga0495580_0000610 3300046472 Bacteria 30234
298 Ga0495582_0000425 3300046473 Bacteria 23064
299 Ga0495639_0000048 3300046475 Bacteria 53257
300 Ga0495662_0000505 3300046476 Bacteria 17752
301 Ga0495664_0050706 3300046477 Bacteria 2465
302 Ga0495664_0096962 3300046477 Bacteria 1775
303 Ga0495664_0281600 3300046477 Bacteria 1005
304 Ga0495664_0703819 3300046477 Unclassified 597
305 Ga0495584_0307757 3300046491 Bacteria 805
306 Ga0495585_0265705 3300046492 Bacteria 852
307 Ga0495594_0000279 3300046499 Bacteria 25038
308 Ga0495606_0127161 3300046507 Bacteria 1519
309 Ga0495608_0000337 3300046511 Bacteria 33005
310 Ga0495608_0349304 3300046511 Bacteria 910
311 Ga0495618_0074656 3300046514 Bacteria 2159
312 Ga0495620_0150551 3300046515 Bacteria 907
313 Ga0495628_0002406 3300046516 Bacteria 16872
314 Ga0495630_0008325 3300046517 Bacteria 7444
315 Ga0495631_0095919 3300046518 Bacteria 1277
316 Ga0495637_0330750 3300046520 Bacteria 537
317 Ga0495648_0376063 3300046524 Bacteria 642
318 Ga0495666_0092289 3300046526 Bacteria 1428
319 Ga0495652_0000604 3300046529 Bacteria 42071
320 Ga0495652_0016212 3300046529 Bacteria 6665
321 Ga0495665_0000165 3300046531 Bacteria 33325
322 Ga0495665_0230598 3300046531 Bacteria 956
323 Ga0495640_0002246 3300046533 Bacteria 15480
324 Ga0495640_0009295 3300046533 Bacteria 7658
325 Ga0495586_0277184 3300046535 Bacteria 959
326 Ga0495587_0012948 3300046536 Bacteria 5244
327 Ga0495645_0047900 3300046543 Bacteria 3113
328 Ga0495645_0181486 3300046543 Bacteria 1442
329 Ga0495622_0050030 3300046557 Bacteria 1940
330 Ga0495622_0050752 3300046557 Bacteria 1924
331 Ga0495633_0101446 3300046558 Bacteria 1336
332 Ga0495667_0000147 3300046559 Bacteria 47993
333 Ga0495667_0034694 3300046559 Bacteria 3373
334 Ga0495668_0627444 3300046616 Bacteria 594
335 Ga0495634_0001502 3300046642 Bacteria 20642
336 Ga0495634_0002287 3300046642 Bacteria 16031
337 Ga0495635_0000517 3300046663 Bacteria 24463
338 Ga0495635_0004027 3300046663 Bacteria 10201
339 Ga0495635_0310910 3300046663 Bacteria 1056
340 Ga0495588_0032126 3300046674 Bacteria 2644
341 Ga0495657_0000995 3300046675 Bacteria 24963
342 Ga0495657_0108342 3300046675 Bacteria 1763
343 Ga0495599_0000253 3300046678 Bacteria 33822
344 Ga0495623_0000549 3300046679 Bacteria 25012
345 Ga0495623_0138417 3300046679 Bacteria 1451
346 Ga0495623_0250590 3300046679 Bacteria 996
347 Ga0495646_0003057 3300046680 Bacteria 10369
348 Ga0495646_0039365 3300046680 Bacteria 2915
349 Ga0495647_0000836 3300046681 Bacteria 9208
350 Ga0495658_0001036 3300046683 Bacteria 14692
351 Ga0495658_0680115 3300046683 Unclassified 659
352 Ga0495669_0037419 3300046684 Bacteria 2147
353 Ga0495613_0030930 3300046689 Bacteria 3976
354 Ga0495613_0204447 3300046689 Bacteria 1391
355 Ga0495624_0000380 3300046690 Bacteria 35436
356 Ga0495600_0001048 3300046809 Bacteria 14960
357 Ga0495581_0006694 3300047315 Bacteria 6679
358 Ga0495581_0302570 3300047315 Bacteria 935
359 Ga0495604_0000253 3300047317 Bacteria 47392
360 Ga0495674_0007638 3300047319 Bacteria 10327
361 Ga0495674_0161694 3300047319 Bacteria 1873
362 Ga0495674_0350771 3300047319 Bacteria 1198
363 Ga0495674_0350909 3300047319 Bacteria 1198
364 Ga0495676_0031535 3300047321 Bacteria 4480
365 Ga0495680_0000406 3300047322 Bacteria 48300
366 Ga0495680_0639996 3300047322 Unclassified 708
367 Ga0495675_0000285 3300047444 Bacteria 36643
368 Ga0495677_0048091 3300047445 Bacteria 1567
369 Ga0495673_0039888 3300047469 Bacteria 2127
370 Ga0495684_0000184 3300047471 Bacteria 47730
371 Ga0495684_0038153 3300047471 Bacteria 3684
372 Ga0495593_0000160 3300047673 Bacteria 34170
373 Ga0495593_0007660 3300047673 Bacteria 6299
374 Ga0495602_0001148 3300048088 Bacteria 25888
375 Ga0495602_0782071 3300048088 Bacteria 642
376 Ga0495602_0811547 3300048088 Bacteria 628
377 Ga0495614_0027200 3300048089 Bacteria 2467
378 Ga0496101_0022873 3300048904 Bacteria 4310
379 Ga0496101_1291764 3300048904 Bacteria 571
380 Ga0496103_0660509 3300048906 Bacteria 664
381 Ga0496106_0000623 3300048909 Bacteria 25352
382 Ga0496106_0106756 3300048909 Bacteria 2177
383 Ga0496107_0053762 3300048910 Bacteria 2905
384 Ga0496108_0302677 3300048911 Bacteria 1393
385 Ga0496108_1188927 3300048911 Bacteria 645
386 Ga0496109_0363360 3300048912 Bacteria 1367
387 Ga0496110_0454695 3300048913 Bacteria 1167
388 Ga0496110_0798716 3300048913 Bacteria 848
389 Ga0496112_0268308 3300048915 Bacteria 1655
390 Ga0496115_1000154 3300048918 Bacteria 639
391 Ga0496116_0302052 3300048919 Bacteria 761
392 Ga0496117_0006618 3300048920 Bacteria 11646
393 Ga0496118_0005952 3300048921 Bacteria 13618
394 Ga0496119_0242231 3300048922 Bacteria 913
395 Ga0496119_0438543 3300048922 Bacteria 617
396 Ga0496120_0267605 3300048923 Bacteria 795
397 Ga0496121_0001595 3300048924 Bacteria 37710
398 Ga0496121_0069632 3300048924 Bacteria 2838
399 Ga0496121_0078415 3300048924 Bacteria 2626
400 Ga0496121_0413785 3300048924 Bacteria 879
401 Ga0496124_0001501 3300048927 Bacteria 34172
402 Ga0496125_0074283 3300048928 Bacteria 2637
403 Ga0496126_0004715 3300048929 Bacteria 16093
404 Ga0496126_0033748 3300048929 Bacteria 4814
405 Ga0496126_0126655 3300048929 Bacteria 2210
406 Ga0496126_0272311 3300048929 Bacteria 1405
407 Ga0496126_0360133 3300048929 Bacteria 1188
408 nmdc:mga03n38_499769_c1 3300050490 Bacteria 682
409 nmdc:mga0yw44_3341_c1 3300050492 Bacteria 7107
410 nmdc:mga0yw44_569505_c1 3300050492 Bacteria 769
411 nmdc:mga06z11_385778_c1 3300050494 Bacteria 842
412 nmdc:mga07m45_60739_c1 3300050496 Bacteria 2140
413 nmdc:mga08x19_480019_c1 3300050514 Bacteria 876
414 Ga0495601_0004707 3300053077 Bacteria 7907
415 Ga0495612_0083989 3300053078 Bacteria 1341
416 Ga0500610_0158113 3300053079 Bacteria 1130
417 Ga0500635_0026146 3300053080 Bacteria 1845
418 Ga0500635_0110174 3300053080 Bacteria 1022
419 Ga0500635_0127930 3300053080 Bacteria 955
420 Ga0495595_0000318 3300053084 Bacteria 18768
421 Ga0495595_0605417 3300053084 Bacteria 560
422 Ga0495619_0000209 3300053085 Bacteria 42507
423 Ga0495619_0316714 3300053085 Bacteria 1080
424 Ga0495619_0669380 3300053085 Bacteria 707
425 Ga0500578_0225229 3300053086 Bacteria 1138
426 Ga0500566_0109407 3300053094 Bacteria 1504
427 Ga0500566_0235247 3300053094 Bacteria 901
428 Ga0500640_094592 3300053095 Bacteria 1245
429 Ga0500554_049232 3300053102 Bacteria 1321
430 Ga0500569_147081 3300053109 Bacteria 794
431 Ga0500572_151425 3300053111 Bacteria 757
432 Ga0500595_061605 3300053119 Bacteria 1132
433 Ga0500559_0014119 3300053136 Bacteria 3376
434 Ga0500559_0052261 3300053136 Bacteria 1805
435 Ga0500564_018367 3300053138 Bacteria 3188
436 Ga0500573_0205996 3300053140 Bacteria 1040
437 Ga0500603_005926 3300053150 Bacteria 2647
438 Ga0500603_034089 3300053150 Bacteria 1328
439 Ga0500619_063691 3300053154 Bacteria 1217
440 Ga0500620_027159 3300053155 Bacteria 1779
441 Ga0500624_047006 3300053157 Bacteria 793
442 Ga0500638_203047 3300053162 Bacteria 837
443 Ga0500638_345321 3300053162 Bacteria 554
444 Ga0500639_201043 3300053163 Bacteria 856
445 Ga0500639_269307 3300053163 Bacteria 666
446 Ga0500636_0000333 3300053177 Bacteria 26138
447 Ga0500636_0116500 3300053177 Bacteria 1503
448 Ga0500636_0140086 3300053177 Bacteria 1339
449 Ga0500636_0293590 3300053177 Bacteria 804
450 Ga0500637_0022637 3300053178 Bacteria 3427
451 Ga0500637_0064352 3300053178 Bacteria 2103
452 Ga0500637_0139114 3300053178 Bacteria 1405
453 Ga0500625_162041 3300053729 Bacteria 820
454 Ga0500552_005490 3300053733 Bacteria 1385
455 Ga0500596_001671 3300053735 Bacteria 4486
456 Ga0500601_000329 3300053737 Bacteria 8658
457 2513656719 2513237096 Bacteria 8722461
458 2513718552 2513237104 Bacteria 10034502
459 2513857909 2513237137 Bacteria 9558895
460 2513917904 2513237145 Bacteria 8979722
461 2517893050 2517572143 Bacteria 9484767
462 2528851588 2528768022 Bacteria 10457665
463 2728750386 2728368998 Bacteria 8720350
464 2874609646 2874604998 Bacteria 7834745
465 2885381968 2885374607 Bacteria 8927485
466 2903755836 2903748898 Bacteria 9972761
467 2904702602
468 2906661441 2906660503 Bacteria 8595048
469 2908743439 2908739725 Bacteria 8628932
470 2908760947 2908756301 Bacteria 8864324
471 3005479611 3005474847 Bacteria 9259049
472 8019557420 8019555841 Bacteria 9642137
473 Ga0099824_1015795
474 JGI25404J52841_10041783
475 Ga0065165_1115860
476 Ga0070683_100022065
477 Ga0070683_102053884
478 Ga0070690_100058425
479 Ga0070680_100009263
480 Ga0070660_100012305
481 Ga0070660_100672368
482 Ga0070689_100086432
483 Ga0070689_101765199
484 Ga0070661_100541460
485 Ga0070668_100452996
486 Ga0070668_100794311
487 Ga0070675_100813661
488 Ga0070675_101057654
489 Ga0070674_100126318
490 Ga0070674_100931546
491 Ga0070688_100171288
492 Ga0070659_100141026
493 Ga0070659_100361497
494 Ga0070709_10475032
495 Ga0070709_10741761
496 Ga0070709_11251331
497 Ga0070713_100824572
498 Ga0070713_100835456
499 Ga0070701_10081611
500 Ga0070701_10134755
501 Ga0070711_100712274
502 Ga0070708_100130658
503 Ga0070663_101007333
504 Ga0070678_100090216
505 Ga0070678_100176395
506 Ga0070678_100465257
507 Ga0070678_100510961
508 Ga0070678_100536012
509 Ga0070681_10158829
510 Ga0070681_10319064
511 Ga0070685_10710774
512 Ga0070706_100493742
513 Ga0070707_101394943
514 Ga0070698_100165645
515 Ga0070698_100431920
516 Ga0070679_100321207
517 Ga0070679_100472187
518 Ga0070679_100895597
519 Ga0070684_100018135
520 Ga0070697_100561111
521 Ga0068853_100007871
522 Ga0070672_100072157
523 Ga0070672_100201915
524 Ga0070686_100279010
525 Ga0070686_101066826
526 Ga0070695_100383905
527 Ga0070665_100115797
528 Ga0070665_100415172
529 Ga0068855_100069044
530 Ga0068855_100116894
531 Ga0068855_101186645
532 Ga0070664_100512654
533 Ga0070664_101304818
534 Ga0068857_100016728
535 Ga0068856_100290808
536 Ga0068852_100038827
537 Ga0068859_100477362
538 Ga0068866_10090737
539 Ga0068851_10228160
540 Ga0068851_10409266
541 Ga0068870_10828506
542 Ga0068863_100081398
543 Ga0068863_100198236
544 Ga0068858_100425889
545 Ga0068858_100897132
546 Ga0068860_100000469
547 Ga0068860_100415599
548 Ga0068860_100498431
549 Ga0068862_100210791
550 Ga0081540_1008226
551 Ga0081540_1018032
552 Ga0075365_10037571
553 Ga0075365_10107814
554 Ga0075363_100129006
555 Ga0070715_10672136
556 Ga0070716_100931004
557 Ga0070712_100047343
558 Ga0070712_100237699
559 Ga0075367_10404434
560 Ga0075366_10702273
561 Ga0097621_100309268
562 Ga0068871_100057645
563 Ga0068871_100580478
564 Ga0068865_100010414
565 Ga0068865_100601204
566 Ga0097620_100477323
567 Ga0099822_1009319
568 Ga0099794_10032149
569 Ga0099794_10033703
570 Ga0099795_10022065
571 Ga0105240_10051150
572 Ga0105240_10240744
573 Ga0105240_10502751
574 Ga0105247_10009434
575 Ga0105247_10069370
576 Ga0105247_10167731
577 Ga0105247_10417397
578 Ga0105243_10100149
579 Ga0105241_11127967
580 Ga0105248_10880219
581 Ga0105237_10084692
582 Ga0105237_10091247
583 Ga0105237_10424013
584 Ga0105237_11063797
585 Ga0105237_11633753
586 Ga0105238_10017117
587 Ga0105238_10679291
588 Ga0105249_10754043
589 Ga0099796_10033256
590 Ga0105239_10137327
591 Ga0105239_10144153
592 Ga0105239_10487658
593 Ga0105239_10574739
594 Ga0105239_12418124
595 Ga0105246_10100140
596 Ga0105246_10861007
597 Ga0157337_1013623
598 Ga0157369_10082565
599 Ga0157369_11838967
600 Ga0157374_10914462
601 Ga0157374_11286653
602 Ga0157374_12040832
603 Ga0157378_10048156
604 Ga0157378_10274514
605 Ga0157378_11703937
606 Ga0163162_10614388
607 Ga0163162_10706508
608 Ga0163162_10856644
609 Ga0157372_10191237
610 Ga0157375_10073807
611 Ga0163163_10855348
612 Ga0157380_11123145
613 Ga0157380_11540141
614 Ga0182008_10164649
615 Ga0157379_10466712
616 Ga0157376_10357859
617 Ga0163161_10016627
618 Ga0163161_11453268
619 Ga0209758_1009002
620 Ga0207697_10291740
621 Ga0207656_10084960
622 Ga0207682_10519851
623 Ga0207710_10060164
624 Ga0207688_10088446
625 Ga0207684_10338198
626 Ga0207707_10009415
627 Ga0207707_10503564
628 Ga0207695_10028180
629 Ga0207695_10469271
630 Ga0207671_10010265
631 Ga0207671_10334433
632 Ga0207693_10082875
633 Ga0207663_10447708
634 Ga0207660_10034871
635 Ga0207660_10350272
636 Ga0207657_10003989
637 Ga0207657_10243297
638 Ga0207652_10012855
639 Ga0207652_10853699
640 Ga0207646_10231545
641 Ga0207694_10041206
642 Ga0207694_11352402
643 Ga0207659_10448066
644 Ga0207700_10476154
645 Ga0207664_10301838
646 Ga0207706_10021355
647 Ga0207709_10149732
648 Ga0207670_10202327
649 Ga0207669_10073695
650 Ga0207704_10026146
651 Ga0207691_10022479
652 Ga0207691_10195560
653 Ga0207689_10130988
654 Ga0207679_10571965
655 Ga0207667_10045088
656 Ga0207667_10180050
657 Ga0207667_11677130
658 Ga0207712_10185672
659 Ga0207668_10451124
660 Ga0207658_10614389
661 Ga0207703_10775754
662 Ga0207703_11445403
663 Ga0207639_10005362
664 Ga0207678_10585937
665 Ga0207708_10111321
666 Ga0207702_10321858
667 Ga0207702_10375871
668 Ga0207641_10035342
669 Ga0207648_10310996
670 Ga0207676_11224474
671 Ga0207674_10024558
672 Ga0207675_100649072
673 Ga0207683_10307056
674 Ga0207683_10502364
675 Ga0207683_10554599
676 Ga0207683_10751022
677 Ga0207698_10298495
678 Ga0207698_10306851
679 Ga0209589_1000003
680 Ga0209489_100003
681 Ga0209700_100003
682 Ga0209588_1013366
683 Ga0268266_10546672
684 Ga0268266_10563233
685 Ga0268266_10769463
686 Ga0268264_10000022
687 Ga0307511_10098616
688 Ga0265330_10147648
689 Ga0265332_10022675
690 Ga0265325_10010874
691 Ga0265340_10004404
692 Ga0265331_10018697
693 Ga0265331_10182675
694 Ga0265316_10073238
695 Ga0265316_10662863
696 Ga0307509_10121840
697 Ga0307508_10121036
698 Ga0307508_10549570
699 Ga0265314_10038940
700 Ga0265314_10041341
701 Ga0265342_10141339
702 Ga0307411_11940839
703 Ga0307507_10036993
704 Ga0307510_10061950
705 Ga0307510_10400276
706 Ga0315911_1000001
707 Ga0373926_0218519
708 Ga0373929_0046364
709 Ga0373934_0022928
710 Ga0373934_0101876
711 Ga0373934_0260389
712 Ga0373944_0077284
713 Ga0373923_0044635
714 Ga0373923_0051159
715 Ga0373923_0110659
716 Ga0373932_0387230
717 Ga0373936_0015833
718 Ga0373936_0420463
719 Ga0373936_0573897
720 Ga0373945_0018308
721 Ga0373953_0000391
722 Ga0373954_0000035
723 Ga0373954_0006222
724 Ga0373956_0000207
725 Ga0373956_0428988
726 Ga0373957_0001128
727 Ga0373943_0015005
728 Ga0373943_0053506
729 Ga0373946_0004658
730 Ga0373955_0001026
731 Ga0373955_0107721
732 Ga0373924_0006045
733 Ga0373924_0080478
734 Ga0373931_0081607
735 Ga0373931_0350007
736 Ga0373935_0000256
737 Ga0373935_0025093
738 Ga0373935_1398112
739 Ga0373927_0005857
740 Ga0373927_0032639
741 Ga0373933_0000037
742 Ga0373947_0001480
743 Ga0373937_0000118
744 Ga0373937_0076968
745 Ga0373925_0020476
746 Ga0373925_0024933
747 Ga0373925_0370803
748 Ga0373925_0805655
749 Ga0373925_1341703
750 Ga0395905_0716540
751 Ga0395905_1042395
752 Ga0451798_0019876
753 Ga0451853_1679816
754 Ga0466969_0108532
755 Ga0495592_0000649
756 Ga0495592_0087410
757 Ga0495603_0000027
758 Ga0495603_0008387
759 Ga0495629_0000290
760 Ga0495629_0001487
761 Ga0495638_0528787
762 Ga0495641_0004283
763 Ga0495651_0000412
764 Ga0495651_0084347
765 Ga0495651_0918980
766 Ga0495653_0000161
767 Ga0495653_0100958
768 Ga0495653_0591316
769 Ga0495580_0000610
770 Ga0495582_0000425
771 Ga0495639_0000048
772 Ga0495662_0000505
773 Ga0495664_0050706
774 Ga0495664_0096962
775 Ga0495664_0281600
776 Ga0495664_0703819
777 Ga0495584_0307757
778 Ga0495585_0265705
779 Ga0495594_0000279
780 Ga0495606_0127161
781 Ga0495608_0000337
782 Ga0495608_0349304
783 Ga0495618_0074656
784 Ga0495620_0150551
785 Ga0495628_0002406
786 Ga0495630_0008325
787 Ga0495631_0095919
788 Ga0495637_0330750
789 Ga0495648_0376063
790 Ga0495666_0092289
791 Ga0495652_0000604
792 Ga0495652_0016212
793 Ga0495665_0000165
794 Ga0495665_0230598
795 Ga0495640_0002246
796 Ga0495640_0009295
797 Ga0495586_0277184
798 Ga0495587_0012948
799 Ga0495645_0047900
800 Ga0495645_0181486
801 Ga0495622_0050030
802 Ga0495622_0050752
803 Ga0495633_0101446
804 Ga0495667_0000147
805 Ga0495667_0034694
806 Ga0495668_0627444
807 Ga0495634_0001502
808 Ga0495634_0002287
809 Ga0495635_0000517
810 Ga0495635_0004027
811 Ga0495635_0310910
812 Ga0495588_0032126
813 Ga0495657_0000995
814 Ga0495657_0108342
815 Ga0495599_0000253
816 Ga0495623_0000549
817 Ga0495623_0138417
818 Ga0495623_0250590
819 Ga0495646_0003057
820 Ga0495646_0039365
821 Ga0495647_0000836
822 Ga0495658_0001036
823 Ga0495658_0680115
824 Ga0495669_0037419
825 Ga0495613_0030930
826 Ga0495613_0204447
827 Ga0495624_0000380
828 Ga0495600_0001048
829 Ga0495581_0006694
830 Ga0495581_0302570
831 Ga0495604_0000253
832 Ga0495674_0007638
833 Ga0495674_0161694
834 Ga0495674_0350771
835 Ga0495674_0350909
836 Ga0495676_0031535
837 Ga0495680_0000406
838 Ga0495680_0639996
839 Ga0495675_0000285
840 Ga0495677_0048091
841 Ga0495673_0039888
842 Ga0495684_0000184
843 Ga0495684_0038153
844 Ga0495593_0000160
845 Ga0495593_0007660
846 Ga0495602_0001148
847 Ga0495602_0782071
848 Ga0495602_0811547
849 Ga0495614_0027200
850 Ga0496101_0022873
851 Ga0496101_1291764
852 Ga0496103_0660509
853 Ga0496106_0000623
854 Ga0496106_0106756
855 Ga0496107_0053762
856 Ga0496108_0302677
857 Ga0496108_1188927
858 Ga0496109_0363360
859 Ga0496110_0454695
860 Ga0496110_0798716
861 Ga0496112_0268308
862 Ga0496115_1000154
863 Ga0496116_0302052
864 Ga0496117_0006618
865 Ga0496118_0005952
866 Ga0496119_0242231
867 Ga0496119_0438543
868 Ga0496120_0267605
869 Ga0496121_0001595
870 Ga0496121_0069632
871 Ga0496121_0078415
872 Ga0496121_0413785
873 Ga0496124_0001501
874 Ga0496125_0074283
875 Ga0496126_0004715
876 Ga0496126_0033748
877 Ga0496126_0126655
878 Ga0496126_0272311
879 Ga0496126_0360133
880 nmdc:mga03n38_499769_c1
881 nmdc:mga0yw44_3341_c1
882 nmdc:mga0yw44_569505_c1
883 nmdc:mga06z11_385778_c1
884 nmdc:mga07m45_60739_c1
885 nmdc:mga08x19_480019_c1
886 Ga0495601_0004707
887 Ga0495612_0083989
888 Ga0500610_0158113
889 Ga0500635_0026146
890 Ga0500635_0110174
891 Ga0500635_0127930
892 Ga0495595_0000318
893 Ga0495595_0605417
894 Ga0495619_0000209
895 Ga0495619_0316714
896 Ga0495619_0669380
897 Ga0500578_0225229
898 Ga0500566_0109407
899 Ga0500566_0235247
900 Ga0500640_094592
901 Ga0500554_049232
902 Ga0500569_147081
903 Ga0500572_151425
904 Ga0500595_061605
905 Ga0500559_0014119
906 Ga0500559_0052261
907 Ga0500564_018367
908 Ga0500573_0205996
909 Ga0500603_005926
910 Ga0500603_034089
911 Ga0500619_063691
912 Ga0500620_027159
913 Ga0500624_047006
914 Ga0500638_203047
915 Ga0500638_345321
916 Ga0500639_201043
917 Ga0500639_269307
918 Ga0500636_0000333
919 Ga0500636_0116500
920 Ga0500636_0140086
921 Ga0500636_0293590
922 Ga0500637_0022637
923 Ga0500637_0064352
924 Ga0500637_0139114
925 Ga0500625_162041
926 Ga0500552_005490
927 Ga0500596_001671
928 Ga0500601_000329
929 2513656719
930 2513718552
931 2513857909
932 2513917904
933 2517893050
934 2528851588
935 2728750386
936 2874609646
937 2885381968
938 2903755836
939 2904702602
940 2906661441
941 2908743439
942 2908760947
943 3005479611
944 8019557420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00042

Globin

Globin

25

127

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ohd-assembly1.cif.gz_A crystal structure of ferric murine neuroglobin cdless mutant 0.8158 7 131
1v5h-assembly1.cif.gz_A-2 crystal structure of human cytoglobin (ferric form) 0.804 7 132
4mu5-assembly1.cif.gz_A crystal structure of murine neuroglobin mutant m144w 0.8018 7 126
5o1k-assembly1.cif.gz_A crystal structure of murine neuroglobin mutant v140w under 20 bar xenon pressure 0.798 7 126
6h6i-assembly1.cif.gz_A ferric murine neuroglobin gly-loop mutant 0.7971 7 131
ID Description Score Start End Superfamily
af_Q9I7P6_29_169_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8084 1 129 1.10.490.10
1v5hA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.804 7 132 1.10.490.10
af_Q22663_26_170_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.795 7 130 1.10.490.10
af_Q9I7P6_29_169_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.7813 1 129 1.10.490.10
3ubvG00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.7811 7 130 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A1G9XHT6-F1-model_v4 Hemoglobin-like flavoprotein 0.9623 1 133 GO:0019825
GO:0020037
AF-A0A1G9XHT6-F1-model_v4 Hemoglobin-like flavoprotein 0.9553 1 133 GO:0019825
GO:0020037
AF-A0A0Q8U910-F1-model_v4 Globin domain-containing protein 0.9471 7 132 GO:0005344
GO:0019825
GO:0020037
AF-A0A257ELJ9-F1-model_v4 Globin 0.9444 7 132 GO:0019825
GO:0020037
AF-A0A537QWN2-F1-model_v4 Globin 0.9442 1 132 GO:0005344
GO:0019825
GO:0020037

Map