F450810

General Info

Members Datasets Scaffolds Average Seq Length
472 208 944 194

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10018871|Ga0163161_100188715
Length 210
Sequence MRYSKKMRLERFVEPYSTDYTGTLVTTRLFRLLALLLMLACTMPRAHAADMVEITRAYIESSEEGYKLAATYSFELNHDLDDAVQHGVPLFFTTEIELTRPRWYWFDEKAIVARQTSRLSYNVLTRQYHVSGGGLQQSFATLDDALFLIRRPSRWLVARRGELKVGQTYNVTLRMGMDRDYLPKPIQVNAFNNSDWRLASNKKTFLYTAE

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
73 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
74 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
75 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
84 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
85 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
86 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
87 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
101 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
161 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
184 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
185 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
190 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
191 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
193 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
194 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
195 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
196 2643221638 Duganella sp. Root336D2 Isolate Unclassified
197 2738541297 Duganella sp. GV083 Isolate Unclassified
198 2738541357 Duganella sp. GV053 Isolate Unclassified
199 2738543003 Duganella sp. GV066 Isolate Unclassified
200 2738543026 Duganella sp. GV089 Isolate Unclassified
201 2738543029 Duganella sp. GV039 Isolate Unclassified
202 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
203 2818991436 Collimonas arenae 515 Isolate Unclassified
204 2821131069 Duganella sp. 1224 Isolate Unclassified
205 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
206 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
207 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
208 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.37
Nodule 0.21
Rhizoplane 1.06
Rhizosphere 76.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10018871 3300017792 Bacteria 4834
2 JGI25162J39368_1000040 3300002737 Bacteria 175938
3 JGI25152J39213_1003345 3300002773 Bacteria 5512
4 JGI25150J39212_1006172 3300002774 Bacteria 2496
5 JGI25159J45721_1006306 3300002987 Bacteria 3570
6 JGI25159J45721_1009296 3300002987 Bacteria 2604
7 JGI25159J45721_1009302 3300002987 Bacteria 2603
8 JGI25165J46597_1000051 3300003214 Bacteria 241012
9 JGI25160J50197_1000548 3300003354 Bacteria 21264
10 JGI25161J50226_1002570 3300003374 Bacteria 4575
11 JGI25161J50226_1003959 3300003374 Bacteria 3218
12 Ga0055538_1000025 3300003751 Bacteria 241012
13 Ga0055539_1000032 3300003752 Bacteria 241012
14 Ga0055533_1000042 3300003756 Bacteria 241012
15 Ga0055525_1000050 3300003759 Bacteria 241012
16 Ga0055526_1011051 3300003771 Bacteria 4120
17 Ga0055526_1011131 3300003771 Bacteria 4096
18 Ga0055537_1000172 3300003773 Bacteria 48382
19 Ga0055537_1012211 3300003773 Bacteria 1689
20 Ga0055524_1001210 3300003775 Bacteria 15311
21 Ga0055524_1006087 3300003775 Bacteria 5282
22 Ga0055524_1034151 3300003775 Bacteria 1412
23 Ga0055534_1000169 3300003784 Bacteria 48382
24 Ga0055534_1004001 3300003784 Bacteria 4423
25 Ga0055528_1000482 3300003790 Bacteria 31599
26 Ga0055528_1000486 3300003790 Bacteria 31484
27 Ga0055528_1005060 3300003790 Bacteria 6226
28 Ga0055530_10014837 3300003791 Bacteria 2574
29 Ga0055531_10008167 3300003794 Bacteria 5576
30 Ga0055541_1000023 3300003841 Bacteria 241012
31 Ga0055543_1005427 3300004625 Bacteria 3256
32 Ga0055543_1030296 3300004625 Bacteria 946
33 Ga0065165_1056903 3300005262 Bacteria 1085
34 Ga0070682_100095724 3300005337 Bacteria 1950
35 Ga0070660_100001210 3300005339 Bacteria 17514
36 Ga0070661_100008819 3300005344 Bacteria 6978
37 Ga0070659_100001642 3300005366 Bacteria 16115
38 Ga0070664_100083780 3300005564 Bacteria 2751
39 Ga0070717_10074351 3300006028 Bacteria 2840
40 Ga0105244_10024622 3300009036 Bacteria 3282
41 Ga0105250_10118080 3300009092 Bacteria 1089
42 Ga0105243_10106659 3300009148 Bacteria 2336
43 Ga0105242_10389115 3300009176 Bacteria 1298
44 Ga0105239_10835244 3300010375 Bacteria 1056
45 Ga0157371_10000153 3300013102 Bacteria 101298
46 Ga0182008_10000714 3300014497 Bacteria 23822
47 Ga0182008_10030062 3300014497 Bacteria 2740
48 Ga0182006_1000030 3300015261 Bacteria 242894
49 Ga0182006_1008553 3300015261 Bacteria 4638
50 Ga0182006_1025155 3300015261 Bacteria 2448
51 Ga0182007_10000037 3300015262 Bacteria 123677
52 Ga0182007_10003504 3300015262 Bacteria 7386
53 Ga0182007_10029112 3300015262 Bacteria 1892
54 Ga0182005_1000021 3300015265 Bacteria 272185
55 Ga0182005_1000072 3300015265 Bacteria 84500
56 Ga0213872_10000065 3300021361 Bacteria 96648
57 Ga0213872_10000814 3300021361 Bacteria 22604
58 Ga0213872_10052768 3300021361 Bacteria 1844
59 Ga0209760_101495 3300025207 Bacteria 2438
60 Ga0209436_100389 3300025208 Bacteria 19875
61 Ga0209436_102679 3300025208 Bacteria 5166
62 Ga0209436_102691 3300025208 Bacteria 5140
63 Ga0209784_100010 3300025224 Bacteria 683664
64 Ga0209566_100008 3300025225 Bacteria 683664
65 Ga0209674_100019 3300025226 Bacteria 683664
66 Ga0209563_100021 3300025230 Bacteria 683764
67 Ga0207427_100412 3300025231 Bacteria 24713
68 Ga0209437_100019 3300025233 Bacteria 683764
69 Ga0207425_1000013 3300025245 Bacteria 497384
70 Ga0207425_1000152 3300025245 Bacteria 59354
71 Ga0207425_1010168 3300025245 Bacteria 2302
72 Ga0207425_1010508 3300025245 Bacteria 2251
73 Ga0209677_100011 3300025253 Bacteria 683664
74 Ga0209129_1000152 3300025258 Bacteria 112977
75 Ga0209129_1003996 3300025258 Bacteria 6066
76 Ga0209233_1000025 3300025261 Bacteria 683764
77 Ga0209565_1000159 3300025263 Bacteria 90295
78 Ga0209565_1000671 3300025263 Bacteria 21657
79 Ga0209565_1013856 3300025263 Bacteria 1872
80 Ga0209673_1000006 3300025273 Bacteria 650600
81 Ga0209673_1048627 3300025273 Bacteria 1140
82 Ga0209130_1000425 3300025284 Bacteria 45376
83 Ga0209130_1000499 3300025284 Bacteria 39996
84 Ga0209130_1001299 3300025284 Bacteria 17162
85 Ga0209675_1000005 3300025291 Bacteria 849192
86 Ga0209675_1001676 3300025291 Bacteria 12326
87 Ga0209025_1109666 3300025294 Bacteria 851
88 Ga0209564_1000028 3300025295 Bacteria 510986
89 Ga0209564_1000604 3300025295 Bacteria 56098
90 Ga0209564_1000634 3300025295 Bacteria 53519
91 Ga0209564_1002267 3300025295 Bacteria 15774
92 Ga0209758_1000031 3300025297 Bacteria 497252
93 Ga0209758_1000354 3300025297 Bacteria 83217
94 Ga0209050_1000525 3300025298 Bacteria 63749
95 Ga0209050_1000601 3300025298 Bacteria 57317
96 Ga0209050_1012832 3300025298 Bacteria 3794
97 Ga0209256_1000274 3300025299 Bacteria 90266
98 Ga0209256_1000414 3300025299 Bacteria 67073
99 Ga0209256_1000426 3300025299 Bacteria 66188
100 Ga0207426_1001125 3300025302 Bacteria 24348
101 Ga0207426_1026952 3300025302 Bacteria 1920
102 Ga0209051_1025440 3300025303 Bacteria 2409
103 Ga0209257_1000157 3300025304 Bacteria 181004
104 Ga0209257_1020499 3300025304 Bacteria 2441
105 Ga0207655_1004659 3300025728 Bacteria 9620
106 Ga0207684_11125724 3300025910 Bacteria 652
107 Ga0207657_10001197 3300025919 Bacteria 27574
108 Ga0207649_10006155 3300025920 Bacteria 6514
109 Ga0207690_10025335 3300025932 Bacteria 3722
110 Ga0207679_10074104 3300025945 Bacteria 2578
111 Ga0207641_10883051 3300026088 Bacteria 887
112 Ga0268265_10271353 3300028380 Bacteria 1513
113 Ga0316176_1115751 3300030732 Bacteria 1107
114 Ga0316178_1005495 3300030735 Bacteria 1443
115 Ga0316180_1100836 3300030736 Bacteria 1640
116 Ga0316182_1004325 3300030745 Bacteria 2794
117 Ga0307408_100000610 3300031548 Bacteria 30592
118 Ga0307408_100238094 3300031548 Bacteria 1494
119 Ga0307416_101471963 3300032002 Bacteria 787
120 Ga0307414_10031274 3300032004 Bacteria 3489
121 Ga0395899_0001494 3300037312 Bacteria 19857
122 Ga0395900_0069150 3300037418 Bacteria 3629
123 Ga0395901_0514138 3300038443 Bacteria 1217
124 Ga0436361_0304675 3300039447 Bacteria 999
125 Ga0436361_0537295 3300039447 Bacteria 22640
126 Ga0436361_0620883 3300039447 Bacteria 4484
127 Ga0436361_0900144 3300039447 Bacteria 143515
128 Ga0450897_005987 3300042128 Bacteria 1073
129 Ga0450898_028085 3300042134 Bacteria 1021
130 Ga0450906_007389 3300042145 Bacteria 2171
131 Ga0439446_0052955 3300042156 Bacteria 1215
132 Ga0439464_0041381 3300042439 Bacteria 1314
133 Ga0466969_0231399 3300044656 Bacteria 839
134 Ga0466972_0045763 3300044658 Bacteria 2120
135 Ga0466965_0168484 3300044683 Bacteria 1151
136 Ga0466966_0015317 3300044684 Bacteria 5070
137 Ga0466971_0006347 3300044719 Bacteria 5134
138 Ga0466968_0295300 3300044735 Bacteria 778
139 Ga0466970_0011751 3300044765 Bacteria 4467
140 Ga0466970_0111489 3300044765 Bacteria 1494
141 Ga0466957_0098408 3300044842 Bacteria 1841
142 Ga0466959_0009707 3300045049 Bacteria 6853
143 Ga0466959_0029881 3300045049 Bacteria 4036
144 Ga0495617_000011 3300046452 Bacteria 301936
145 Ga0495617_000610 3300046452 Bacteria 17970
146 Ga0495617_144193 3300046452 Bacteria 759
147 Ga0495592_0021604 3300046454 Bacteria 4896
148 Ga0495603_0219753 3300046455 Bacteria 1096
149 Ga0495590_0000144 3300046457 Bacteria 43127
150 Ga0495591_000444 3300046458 Bacteria 33698
151 Ga0495638_0000354 3300046460 Bacteria 57368
152 Ga0495638_0030351 3300046460 Bacteria 3481
153 Ga0495651_0008878 3300046462 Bacteria 7718
154 Ga0495651_0047306 3300046462 Bacteria 3326
155 Ga0495653_0000102 3300046463 Bacteria 70205
156 Ga0495653_0013444 3300046463 Bacteria 6669
157 Ga0495650_0000248 3300046471 Bacteria 106527
158 Ga0495650_0000297 3300046471 Bacteria 90619
159 Ga0495650_0000774 3300046471 Bacteria 39438
160 Ga0495580_0349538 3300046472 Bacteria 1002
161 Ga0495605_0000614 3300046474 Bacteria 27775
162 Ga0495605_0123519 3300046474 Bacteria 1172
163 Ga0495584_0000013 3300046491 Bacteria 185735
164 Ga0495584_0000951 3300046491 Bacteria 18190
165 Ga0495584_0000972 3300046491 Bacteria 17980
166 Ga0495584_0005265 3300046491 Bacteria 6853
167 Ga0495584_0007060 3300046491 Bacteria 5869
168 Ga0495584_0009352 3300046491 Bacteria 5048
169 Ga0495584_0025508 3300046491 Bacteria 2997
170 Ga0495584_0070894 3300046491 Bacteria 1751
171 Ga0495584_0167591 3300046491 Bacteria 1116
172 Ga0495585_0000150 3300046492 Bacteria 75556
173 Ga0495585_0000380 3300046492 Bacteria 42602
174 Ga0495585_0001052 3300046492 Bacteria 22828
175 Ga0495585_0001910 3300046492 Bacteria 15650
176 Ga0495585_0002646 3300046492 Bacteria 12583
177 Ga0495585_0008106 3300046492 Bacteria 6384
178 Ga0495585_0009562 3300046492 Bacteria 5803
179 Ga0495585_0017175 3300046492 Bacteria 4185
180 Ga0495585_0027998 3300046492 Bacteria 3216
181 Ga0495585_0065342 3300046492 Bacteria 1993
182 Ga0495585_0068238 3300046492 Bacteria 1943
183 Ga0495585_0080881 3300046492 Bacteria 1760
184 Ga0495585_0080991 3300046492 Bacteria 1759
185 Ga0495585_0081502 3300046492 Bacteria 1753
186 Ga0495585_0090961 3300046492 Bacteria 1643
187 Ga0495594_0263455 3300046499 Bacteria 982
188 Ga0495596_0001746 3300046500 Bacteria 12188
189 Ga0495596_0004637 3300046500 Bacteria 6651
190 Ga0495596_0010788 3300046500 Bacteria 3965
191 Ga0495607_0001581 3300046501 Bacteria 19837
192 Ga0495607_0002900 3300046501 Bacteria 13528
193 Ga0495607_0060114 3300046501 Bacteria 2164
194 Ga0495607_0075448 3300046501 Bacteria 1868
195 Ga0495607_0163423 3300046501 Bacteria 1129
196 Ga0495607_0229730 3300046501 Bacteria 903
197 Ga0495583_0000063 3300046506 Bacteria 194362
198 Ga0495583_0000161 3300046506 Bacteria 113144
199 Ga0495583_0004590 3300046506 Bacteria 9795
200 Ga0495583_0019188 3300046506 Bacteria 3575
201 Ga0495583_0043404 3300046506 Bacteria 2094
202 Ga0495583_0055124 3300046506 Bacteria 1797
203 Ga0495583_0103160 3300046506 Bacteria 1215
204 Ga0495583_0229844 3300046506 Bacteria 748
205 Ga0495606_0000169 3300046507 Bacteria 115434
206 Ga0495606_0000187 3300046507 Bacteria 108140
207 Ga0495606_0000609 3300046507 Bacteria 56606
208 Ga0495606_0001166 3300046507 Bacteria 37155
209 Ga0495606_0008871 3300046507 Bacteria 8616
210 Ga0495606_0014338 3300046507 Bacteria 6196
211 Ga0495606_0068189 3300046507 Bacteria 2251
212 Ga0495606_0099901 3300046507 Bacteria 1768
213 Ga0495608_0009162 3300046511 Bacteria 6919
214 Ga0495608_0044437 3300046511 Bacteria 2965
215 Ga0495610_0000007 3300046512 Bacteria 820919
216 Ga0495610_0001852 3300046512 Bacteria 18334
217 Ga0495610_0005691 3300046512 Bacteria 8783
218 Ga0495610_0018225 3300046512 Bacteria 3973
219 Ga0495610_0047024 3300046512 Bacteria 2124
220 Ga0495610_0061057 3300046512 Bacteria 1792
221 Ga0495616_0003244 3300046513 Bacteria 10465
222 Ga0495616_0004083 3300046513 Bacteria 9264
223 Ga0495616_0013248 3300046513 Bacteria 4659
224 Ga0495616_0046100 3300046513 Bacteria 2202
225 Ga0495616_0087793 3300046513 Bacteria 1477
226 Ga0495616_0097436 3300046513 Bacteria 1383
227 Ga0495616_0188876 3300046513 Bacteria 911
228 Ga0495616_0299364 3300046513 Bacteria 679
229 Ga0495616_0306386 3300046513 Bacteria 670
230 Ga0495620_0008670 3300046515 Bacteria 5449
231 Ga0495628_0000518 3300046516 Bacteria 35375
232 Ga0495628_0030073 3300046516 Bacteria 4400
233 Ga0495628_0332109 3300046516 Bacteria 1120
234 Ga0495631_0001381 3300046518 Bacteria 14767
235 Ga0495631_0025194 3300046518 Bacteria 2741
236 Ga0495632_0052558 3300046519 Bacteria 2003
237 Ga0495632_0250472 3300046519 Bacteria 794
238 Ga0495637_0000029 3300046520 Bacteria 143929
239 Ga0495637_0008278 3300046520 Bacteria 5113
240 Ga0495637_0027432 3300046520 Bacteria 2548
241 Ga0495643_0000245 3300046522 Bacteria 80531
242 Ga0495643_0011207 3300046522 Bacteria 5477
243 Ga0495643_0013463 3300046522 Bacteria 4891
244 Ga0495644_0001369 3300046523 Bacteria 9947
245 Ga0495644_0002162 3300046523 Bacteria 7892
246 Ga0495644_0003558 3300046523 Bacteria 6152
247 Ga0495644_0003635 3300046523 Bacteria 6075
248 Ga0495648_0000047 3300046524 Bacteria 166756
249 Ga0495648_0001788 3300046524 Bacteria 20676
250 Ga0495648_0089851 3300046524 Bacteria 1723
251 Ga0495648_0135528 3300046524 Bacteria 1303
252 Ga0495648_0142324 3300046524 Bacteria 1260
253 Ga0495648_0173346 3300046524 Bacteria 1103
254 Ga0495648_0183496 3300046524 Bacteria 1062
255 Ga0495663_0005806 3300046525 Bacteria 3416
256 Ga0495642_0005188 3300046528 Bacteria 5012
257 Ga0495642_0008089 3300046528 Bacteria 4024
258 Ga0495642_0016058 3300046528 Bacteria 2914
259 Ga0495642_0019020 3300046528 Bacteria 2689
260 Ga0495642_0057673 3300046528 Bacteria 1606
261 Ga0495652_0247256 3300046529 Bacteria 1323
262 Ga0495652_0274786 3300046529 Bacteria 1236
263 Ga0495654_0003005 3300046530 Bacteria 10534
264 Ga0495654_0005817 3300046530 Bacteria 7105
265 Ga0495609_0001074 3300046538 Bacteria 19093
266 Ga0495609_0001607 3300046538 Bacteria 14766
267 Ga0495609_0012484 3300046538 Bacteria 4030
268 Ga0495609_0034302 3300046538 Bacteria 2301
269 Ga0495609_0129676 3300046538 Bacteria 1080
270 Ga0495597_0003595 3300046542 Bacteria 8923
271 Ga0495597_0031172 3300046542 Bacteria 2427
272 Ga0495597_0052525 3300046542 Bacteria 1794
273 Ga0495597_0056410 3300046542 Bacteria 1720
274 Ga0495597_0184056 3300046542 Bacteria 843
275 Ga0495645_0030000 3300046543 Bacteria 3961
276 Ga0495645_0083955 3300046543 Bacteria 2282
277 Ga0495622_0000500 3300046557 Bacteria 24597
278 Ga0495622_0017632 3300046557 Bacteria 3324
279 Ga0495622_0017664 3300046557 Bacteria 3321
280 Ga0495633_0000465 3300046558 Bacteria 41465
281 Ga0495633_0000942 3300046558 Bacteria 24395
282 Ga0495633_0004871 3300046558 Bacteria 8395
283 Ga0495633_0006236 3300046558 Bacteria 7119
284 Ga0495633_0007939 3300046558 Bacteria 6048
285 Ga0495633_0016956 3300046558 Bacteria 3736
286 Ga0495633_0019974 3300046558 Bacteria 3378
287 Ga0495633_0036747 3300046558 Bacteria 2345
288 Ga0495633_0040334 3300046558 Bacteria 2225
289 Ga0495633_0071097 3300046558 Bacteria 1623
290 Ga0495633_0158659 3300046558 Bacteria 1044
291 Ga0495633_0179957 3300046558 Bacteria 973
292 Ga0495656_0018702 3300046615 Bacteria 2666
293 Ga0495656_0050354 3300046615 Bacteria 1778
294 Ga0495656_0054003 3300046615 Bacteria 1727
295 Ga0495656_0089033 3300046615 Bacteria 1408
296 Ga0495668_0000219 3300046616 Bacteria 83081
297 Ga0495668_0006876 3300046616 Bacteria 7374
298 Ga0495668_0012594 3300046616 Bacteria 5014
299 Ga0495668_0018565 3300046616 Bacteria 4018
300 Ga0495668_0105237 3300046616 Bacteria 1543
301 Ga0495611_0000336 3300046648 Bacteria 30672
302 Ga0495611_0004973 3300046648 Bacteria 5690
303 Ga0495611_0024173 3300046648 Bacteria 2641
304 Ga0495611_0048085 3300046648 Bacteria 1916
305 Ga0495611_0092999 3300046648 Bacteria 1394
306 Ga0495611_0101148 3300046648 Bacteria 1338
307 Ga0495611_0213975 3300046648 Bacteria 897
308 Ga0495611_0222592 3300046648 Bacteria 878
309 Ga0495625_0002389 3300046660 Bacteria 20388
310 Ga0495625_0008548 3300046660 Bacteria 8713
311 Ga0495625_0041651 3300046660 Bacteria 3341
312 Ga0495625_0314274 3300046660 Bacteria 999
313 Ga0495625_0387717 3300046660 Bacteria 875
314 Ga0495659_0000010 3300046664 Bacteria 87574
315 Ga0495659_0000622 3300046664 Bacteria 12979
316 Ga0495659_0023115 3300046664 Bacteria 2109
317 Ga0495659_0029421 3300046664 Bacteria 1907
318 Ga0495659_0030023 3300046664 Bacteria 1889
319 Ga0495661_0012598 3300046665 Bacteria 5708
320 Ga0495661_0041194 3300046665 Bacteria 2859
321 Ga0495661_0041445 3300046665 Bacteria 2848
322 Ga0495661_0058192 3300046665 Bacteria 2304
323 Ga0495661_0071470 3300046665 Bacteria 2028
324 Ga0495661_0095202 3300046665 Bacteria 1686
325 Ga0495661_0120556 3300046665 Bacteria 1449
326 Ga0495661_0284653 3300046665 Bacteria 832
327 Ga0495657_0157013 3300046675 Bacteria 1409
328 Ga0495623_0024186 3300046679 Bacteria 3917
329 Ga0495623_0099868 3300046679 Bacteria 1769
330 Ga0495623_0153140 3300046679 Bacteria 1361
331 Ga0495623_0274825 3300046679 Bacteria 939
332 Ga0495646_0005978 3300046680 Bacteria 7713
333 Ga0495658_0032942 3300046683 Bacteria 2834
334 Ga0495669_0000240 3300046684 Bacteria 32062
335 Ga0495669_0069128 3300046684 Bacteria 1607
336 Ga0495669_0153059 3300046684 Bacteria 1092
337 Ga0495624_0008507 3300046690 Bacteria 7149
338 Ga0495624_0447147 3300046690 Bacteria 774
339 Ga0495670_0002543 3300046691 Bacteria 9010
340 Ga0495670_0005258 3300046691 Bacteria 6369
341 Ga0495670_0015736 3300046691 Bacteria 3718
342 Ga0495670_0026304 3300046691 Bacteria 2879
343 Ga0495671_0006611 3300046692 Bacteria 6684
344 Ga0495671_0081898 3300046692 Bacteria 1581
345 Ga0495671_0146356 3300046692 Bacteria 1150
346 Ga0495671_0240331 3300046692 Bacteria 875
347 Ga0495649_0000644 3300046694 Bacteria 28394
348 Ga0495649_0021823 3300046694 Bacteria 3587
349 Ga0495649_0067622 3300046694 Bacteria 1917
350 Ga0495649_0095924 3300046694 Bacteria 1578
351 Ga0495649_0148672 3300046694 Bacteria 1231
352 Ga0495649_0204350 3300046694 Bacteria 1025
353 Ga0495589_0043683 3300046794 Bacteria 2229
354 Ga0495589_0087253 3300046794 Bacteria 1515
355 Ga0495589_0096064 3300046794 Bacteria 1437
356 Ga0495589_0103220 3300046794 Bacteria 1378
357 Ga0495600_0002933 3300046809 Bacteria 9942
358 Ga0495660_0000301 3300046810 Bacteria 44739
359 Ga0495660_0005048 3300046810 Bacteria 7929
360 Ga0495660_0082169 3300046810 Bacteria 1687
361 Ga0495660_0172372 3300046810 Bacteria 1053
362 Ga0495660_0254588 3300046810 Bacteria 813
363 Ga0495660_0275097 3300046810 Bacteria 772
364 Ga0495604_0033720 3300047317 Bacteria 4052
365 Ga0495604_0038065 3300047317 Bacteria 3785
366 Ga0495636_0000972 3300047318 Bacteria 10710
367 Ga0495636_0001072 3300047318 Bacteria 10285
368 Ga0495636_0003350 3300047318 Bacteria 6212
369 Ga0495636_0013465 3300047318 Bacteria 3246
370 Ga0495674_0009868 3300047319 Bacteria 9064
371 Ga0495672_0000107 3300047320 Bacteria 132267
372 Ga0495672_0000286 3300047320 Bacteria 70060
373 Ga0495672_0001423 3300047320 Bacteria 23535
374 Ga0495672_0021487 3300047320 Bacteria 4209
375 Ga0495672_0061347 3300047320 Bacteria 2167
376 Ga0495676_0051226 3300047321 Bacteria 3305
377 Ga0495676_0270825 3300047321 Bacteria 1152
378 Ga0495683_0000221 3300047323 Bacteria 53874
379 Ga0495683_0000559 3300047323 Bacteria 28050
380 Ga0495683_0002939 3300047323 Bacteria 10088
381 Ga0495683_0017250 3300047323 Bacteria 3744
382 Ga0495683_0032142 3300047323 Bacteria 2673
383 Ga0495683_0035014 3300047323 Bacteria 2552
384 Ga0495683_0056906 3300047323 Bacteria 1944
385 Ga0495683_0072905 3300047323 Bacteria 1684
386 Ga0495683_0235625 3300047323 Bacteria 809
387 Ga0495687_000562 3300047443 Bacteria 43714
388 Ga0495687_025202 3300047443 Bacteria 2815
389 Ga0495687_121510 3300047443 Bacteria 941
390 Ga0495677_0002234 3300047445 Bacteria 7655
391 Ga0495677_0002665 3300047445 Bacteria 6978
392 Ga0495677_0009315 3300047445 Bacteria 3628
393 Ga0495677_0053058 3300047445 Bacteria 1494
394 Ga0495677_0064257 3300047445 Bacteria 1363
395 Ga0495679_023671 3300047446 Bacteria 2079
396 Ga0495679_095973 3300047446 Bacteria 827
397 Ga0495685_000128 3300047447 Bacteria 26198
398 Ga0495673_0000074 3300047469 Bacteria 210788
399 Ga0495673_0000173 3300047469 Bacteria 106086
400 Ga0495673_0005143 3300047469 Bacteria 7973
401 Ga0495673_0046547 3300047469 Bacteria 1921
402 Ga0495681_0024739 3300047470 Bacteria 3153
403 Ga0495681_0026128 3300047470 Bacteria 3047
404 Ga0495681_0032410 3300047470 Bacteria 2631
405 Ga0495681_0065391 3300047470 Bacteria 1663
406 Ga0495681_0090042 3300047470 Bacteria 1356
407 Ga0495681_0149660 3300047470 Bacteria 980
408 Ga0495686_0000387 3300047472 Bacteria 70185
409 Ga0495686_0001928 3300047472 Bacteria 20665
410 Ga0495686_0006559 3300047472 Bacteria 8878
411 Ga0495686_0023856 3300047472 Bacteria 4026
412 Ga0495686_0070510 3300047472 Bacteria 2153
413 Ga0495686_0102897 3300047472 Bacteria 1721
414 Ga0495686_0122998 3300047472 Bacteria 1544
415 Ga0495602_0121927 3300048088 Bacteria 2096
416 Ga0495626_0002890 3300048091 Bacteria 11448
417 Ga0495626_0003826 3300048091 Bacteria 9441
418 Ga0495626_0011604 3300048091 Bacteria 4652
419 Ga0495626_0034461 3300048091 Bacteria 2421
420 Ga0495626_0283591 3300048091 Bacteria 657
421 Ga0496102_0006728 3300048905 Bacteria 9818
422 Ga0496112_0346276 3300048915 Bacteria 1429
423 Ga0496115_0037637 3300048918 Bacteria 3835
424 Ga0496115_0047818 3300048918 Bacteria 3421
425 Ga0496116_0021813 3300048919 Bacteria 4818
426 Ga0496117_0000056 3300048920 Bacteria 271417
427 Ga0496118_0000047 3300048921 Bacteria 271417
428 Ga0496120_0125156 3300048923 Bacteria 1324
429 Ga0496121_0095068 3300048924 Bacteria 2317
430 Ga0496122_0002132 3300048925 Bacteria 29082
431 Ga0496122_0039705 3300048925 Bacteria 3750
432 Ga0496123_0003832 3300048926 Bacteria 16407
433 Ga0496123_0005661 3300048926 Bacteria 12477
434 Ga0496124_0106931 3300048927 Bacteria 2258
435 Ga0496125_0033215 3300048928 Bacteria 4571
436 Ga0496125_0371469 3300048928 Bacteria 846
437 Ga0495678_000146 3300049459 Bacteria 85995
438 Ga0495678_011440 3300049459 Bacteria 4248
439 Ga0495682_0001101 3300049460 Bacteria 15713
440 Ga0495682_0003502 3300049460 Bacteria 6974
441 Ga0495682_0008069 3300049460 Bacteria 4160
442 Ga0495682_0018475 3300049460 Bacteria 2625
443 Ga0495682_0049699 3300049460 Bacteria 1528
444 Ga0501034_0046646 3300049571 Bacteria 4378
445 Ga0501227_004587 3300049665 Bacteria 2969
446 Ga0501257_136225 3300049686 Bacteria 668
447 Ga0501279_000540 3300049775 Bacteria 4955
448 Ga0501279_001219 3300049775 Bacteria 3380
449 Ga0501279_003330 3300049775 Bacteria 2093
450 Ga0495601_0003431 3300053077 Bacteria 9081
451 Ga0495619_0301075 3300053085 Bacteria 1111
452 Ga0500595_000507 3300053119 Bacteria 23504
453 Ga0500574_011835 3300053141 Bacteria 1980
454 Ga0500586_001667 3300053145 Bacteria 4778
455 Ga0500619_000663 3300053154 Bacteria 5851
456 Ga0466962_0006586 3300061719 Bacteria 5573
457 2601671908 2600255292 Bacteria 6300551
458 2643788944 2643221554 Bacteria 6603920
459 2644029844 2643221603 Bacteria 6147767
460 2644213001 2643221638 Bacteria 6579467
461 2738827893 2738541297 Bacteria 6549566
462 2739151689 2738541357 Bacteria 6549408
463 2739193609 2738543003 Bacteria 6549560
464 2739320085 2738543026 Bacteria 6549408
465 2739338326 2738543029 Bacteria 6549249
466 2765567255 2765235838 Bacteria 5445269
467 2819543744 2818991436 Bacteria 5376622
468 2821136147 2821131069 Bacteria 6108407
469 2839095197 2839094727 Bacteria 5534556
470 2885082330 2885080285 Bacteria 6355622
471 2932415098 2932410948 Bacteria 6312192
472 2932421254 2932416698 Bacteria 6315112
473 Ga0163161_10018871
474 JGI25162J39368_1000040
475 JGI25152J39213_1003345
476 JGI25150J39212_1006172
477 JGI25159J45721_1006306
478 JGI25159J45721_1009296
479 JGI25159J45721_1009302
480 JGI25165J46597_1000051
481 JGI25160J50197_1000548
482 JGI25161J50226_1002570
483 JGI25161J50226_1003959
484 Ga0055538_1000025
485 Ga0055539_1000032
486 Ga0055533_1000042
487 Ga0055525_1000050
488 Ga0055526_1011051
489 Ga0055526_1011131
490 Ga0055537_1000172
491 Ga0055537_1012211
492 Ga0055524_1001210
493 Ga0055524_1006087
494 Ga0055524_1034151
495 Ga0055534_1000169
496 Ga0055534_1004001
497 Ga0055528_1000482
498 Ga0055528_1000486
499 Ga0055528_1005060
500 Ga0055530_10014837
501 Ga0055531_10008167
502 Ga0055541_1000023
503 Ga0055543_1005427
504 Ga0055543_1030296
505 Ga0065165_1056903
506 Ga0070682_100095724
507 Ga0070660_100001210
508 Ga0070661_100008819
509 Ga0070659_100001642
510 Ga0070664_100083780
511 Ga0070717_10074351
512 Ga0105244_10024622
513 Ga0105250_10118080
514 Ga0105243_10106659
515 Ga0105242_10389115
516 Ga0105239_10835244
517 Ga0157371_10000153
518 Ga0182008_10000714
519 Ga0182008_10030062
520 Ga0182006_1000030
521 Ga0182006_1008553
522 Ga0182006_1025155
523 Ga0182007_10000037
524 Ga0182007_10003504
525 Ga0182007_10029112
526 Ga0182005_1000021
527 Ga0182005_1000072
528 Ga0213872_10000065
529 Ga0213872_10000814
530 Ga0213872_10052768
531 Ga0209760_101495
532 Ga0209436_100389
533 Ga0209436_102679
534 Ga0209436_102691
535 Ga0209784_100010
536 Ga0209566_100008
537 Ga0209674_100019
538 Ga0209563_100021
539 Ga0207427_100412
540 Ga0209437_100019
541 Ga0207425_1000013
542 Ga0207425_1000152
543 Ga0207425_1010168
544 Ga0207425_1010508
545 Ga0209677_100011
546 Ga0209129_1000152
547 Ga0209129_1003996
548 Ga0209233_1000025
549 Ga0209565_1000159
550 Ga0209565_1000671
551 Ga0209565_1013856
552 Ga0209673_1000006
553 Ga0209673_1048627
554 Ga0209130_1000425
555 Ga0209130_1000499
556 Ga0209130_1001299
557 Ga0209675_1000005
558 Ga0209675_1001676
559 Ga0209025_1109666
560 Ga0209564_1000028
561 Ga0209564_1000604
562 Ga0209564_1000634
563 Ga0209564_1002267
564 Ga0209758_1000031
565 Ga0209758_1000354
566 Ga0209050_1000525
567 Ga0209050_1000601
568 Ga0209050_1012832
569 Ga0209256_1000274
570 Ga0209256_1000414
571 Ga0209256_1000426
572 Ga0207426_1001125
573 Ga0207426_1026952
574 Ga0209051_1025440
575 Ga0209257_1000157
576 Ga0209257_1020499
577 Ga0207655_1004659
578 Ga0207684_11125724
579 Ga0207657_10001197
580 Ga0207649_10006155
581 Ga0207690_10025335
582 Ga0207679_10074104
583 Ga0207641_10883051
584 Ga0268265_10271353
585 Ga0316176_1115751
586 Ga0316178_1005495
587 Ga0316180_1100836
588 Ga0316182_1004325
589 Ga0307408_100000610
590 Ga0307408_100238094
591 Ga0307416_101471963
592 Ga0307414_10031274
593 Ga0395899_0001494
594 Ga0395900_0069150
595 Ga0395901_0514138
596 Ga0436361_0304675
597 Ga0436361_0537295
598 Ga0436361_0620883
599 Ga0436361_0900144
600 Ga0450897_005987
601 Ga0450898_028085
602 Ga0450906_007389
603 Ga0439446_0052955
604 Ga0439464_0041381
605 Ga0466969_0231399
606 Ga0466972_0045763
607 Ga0466965_0168484
608 Ga0466966_0015317
609 Ga0466971_0006347
610 Ga0466968_0295300
611 Ga0466970_0011751
612 Ga0466970_0111489
613 Ga0466957_0098408
614 Ga0466959_0009707
615 Ga0466959_0029881
616 Ga0495617_000011
617 Ga0495617_000610
618 Ga0495617_144193
619 Ga0495592_0021604
620 Ga0495603_0219753
621 Ga0495590_0000144
622 Ga0495591_000444
623 Ga0495638_0000354
624 Ga0495638_0030351
625 Ga0495651_0008878
626 Ga0495651_0047306
627 Ga0495653_0000102
628 Ga0495653_0013444
629 Ga0495650_0000248
630 Ga0495650_0000297
631 Ga0495650_0000774
632 Ga0495580_0349538
633 Ga0495605_0000614
634 Ga0495605_0123519
635 Ga0495584_0000013
636 Ga0495584_0000951
637 Ga0495584_0000972
638 Ga0495584_0005265
639 Ga0495584_0007060
640 Ga0495584_0009352
641 Ga0495584_0025508
642 Ga0495584_0070894
643 Ga0495584_0167591
644 Ga0495585_0000150
645 Ga0495585_0000380
646 Ga0495585_0001052
647 Ga0495585_0001910
648 Ga0495585_0002646
649 Ga0495585_0008106
650 Ga0495585_0009562
651 Ga0495585_0017175
652 Ga0495585_0027998
653 Ga0495585_0065342
654 Ga0495585_0068238
655 Ga0495585_0080881
656 Ga0495585_0080991
657 Ga0495585_0081502
658 Ga0495585_0090961
659 Ga0495594_0263455
660 Ga0495596_0001746
661 Ga0495596_0004637
662 Ga0495596_0010788
663 Ga0495607_0001581
664 Ga0495607_0002900
665 Ga0495607_0060114
666 Ga0495607_0075448
667 Ga0495607_0163423
668 Ga0495607_0229730
669 Ga0495583_0000063
670 Ga0495583_0000161
671 Ga0495583_0004590
672 Ga0495583_0019188
673 Ga0495583_0043404
674 Ga0495583_0055124
675 Ga0495583_0103160
676 Ga0495583_0229844
677 Ga0495606_0000169
678 Ga0495606_0000187
679 Ga0495606_0000609
680 Ga0495606_0001166
681 Ga0495606_0008871
682 Ga0495606_0014338
683 Ga0495606_0068189
684 Ga0495606_0099901
685 Ga0495608_0009162
686 Ga0495608_0044437
687 Ga0495610_0000007
688 Ga0495610_0001852
689 Ga0495610_0005691
690 Ga0495610_0018225
691 Ga0495610_0047024
692 Ga0495610_0061057
693 Ga0495616_0003244
694 Ga0495616_0004083
695 Ga0495616_0013248
696 Ga0495616_0046100
697 Ga0495616_0087793
698 Ga0495616_0097436
699 Ga0495616_0188876
700 Ga0495616_0299364
701 Ga0495616_0306386
702 Ga0495620_0008670
703 Ga0495628_0000518
704 Ga0495628_0030073
705 Ga0495628_0332109
706 Ga0495631_0001381
707 Ga0495631_0025194
708 Ga0495632_0052558
709 Ga0495632_0250472
710 Ga0495637_0000029
711 Ga0495637_0008278
712 Ga0495637_0027432
713 Ga0495643_0000245
714 Ga0495643_0011207
715 Ga0495643_0013463
716 Ga0495644_0001369
717 Ga0495644_0002162
718 Ga0495644_0003558
719 Ga0495644_0003635
720 Ga0495648_0000047
721 Ga0495648_0001788
722 Ga0495648_0089851
723 Ga0495648_0135528
724 Ga0495648_0142324
725 Ga0495648_0173346
726 Ga0495648_0183496
727 Ga0495663_0005806
728 Ga0495642_0005188
729 Ga0495642_0008089
730 Ga0495642_0016058
731 Ga0495642_0019020
732 Ga0495642_0057673
733 Ga0495652_0247256
734 Ga0495652_0274786
735 Ga0495654_0003005
736 Ga0495654_0005817
737 Ga0495609_0001074
738 Ga0495609_0001607
739 Ga0495609_0012484
740 Ga0495609_0034302
741 Ga0495609_0129676
742 Ga0495597_0003595
743 Ga0495597_0031172
744 Ga0495597_0052525
745 Ga0495597_0056410
746 Ga0495597_0184056
747 Ga0495645_0030000
748 Ga0495645_0083955
749 Ga0495622_0000500
750 Ga0495622_0017632
751 Ga0495622_0017664
752 Ga0495633_0000465
753 Ga0495633_0000942
754 Ga0495633_0004871
755 Ga0495633_0006236
756 Ga0495633_0007939
757 Ga0495633_0016956
758 Ga0495633_0019974
759 Ga0495633_0036747
760 Ga0495633_0040334
761 Ga0495633_0071097
762 Ga0495633_0158659
763 Ga0495633_0179957
764 Ga0495656_0018702
765 Ga0495656_0050354
766 Ga0495656_0054003
767 Ga0495656_0089033
768 Ga0495668_0000219
769 Ga0495668_0006876
770 Ga0495668_0012594
771 Ga0495668_0018565
772 Ga0495668_0105237
773 Ga0495611_0000336
774 Ga0495611_0004973
775 Ga0495611_0024173
776 Ga0495611_0048085
777 Ga0495611_0092999
778 Ga0495611_0101148
779 Ga0495611_0213975
780 Ga0495611_0222592
781 Ga0495625_0002389
782 Ga0495625_0008548
783 Ga0495625_0041651
784 Ga0495625_0314274
785 Ga0495625_0387717
786 Ga0495659_0000010
787 Ga0495659_0000622
788 Ga0495659_0023115
789 Ga0495659_0029421
790 Ga0495659_0030023
791 Ga0495661_0012598
792 Ga0495661_0041194
793 Ga0495661_0041445
794 Ga0495661_0058192
795 Ga0495661_0071470
796 Ga0495661_0095202
797 Ga0495661_0120556
798 Ga0495661_0284653
799 Ga0495657_0157013
800 Ga0495623_0024186
801 Ga0495623_0099868
802 Ga0495623_0153140
803 Ga0495623_0274825
804 Ga0495646_0005978
805 Ga0495658_0032942
806 Ga0495669_0000240
807 Ga0495669_0069128
808 Ga0495669_0153059
809 Ga0495624_0008507
810 Ga0495624_0447147
811 Ga0495670_0002543
812 Ga0495670_0005258
813 Ga0495670_0015736
814 Ga0495670_0026304
815 Ga0495671_0006611
816 Ga0495671_0081898
817 Ga0495671_0146356
818 Ga0495671_0240331
819 Ga0495649_0000644
820 Ga0495649_0021823
821 Ga0495649_0067622
822 Ga0495649_0095924
823 Ga0495649_0148672
824 Ga0495649_0204350
825 Ga0495589_0043683
826 Ga0495589_0087253
827 Ga0495589_0096064
828 Ga0495589_0103220
829 Ga0495600_0002933
830 Ga0495660_0000301
831 Ga0495660_0005048
832 Ga0495660_0082169
833 Ga0495660_0172372
834 Ga0495660_0254588
835 Ga0495660_0275097
836 Ga0495604_0033720
837 Ga0495604_0038065
838 Ga0495636_0000972
839 Ga0495636_0001072
840 Ga0495636_0003350
841 Ga0495636_0013465
842 Ga0495674_0009868
843 Ga0495672_0000107
844 Ga0495672_0000286
845 Ga0495672_0001423
846 Ga0495672_0021487
847 Ga0495672_0061347
848 Ga0495676_0051226
849 Ga0495676_0270825
850 Ga0495683_0000221
851 Ga0495683_0000559
852 Ga0495683_0002939
853 Ga0495683_0017250
854 Ga0495683_0032142
855 Ga0495683_0035014
856 Ga0495683_0056906
857 Ga0495683_0072905
858 Ga0495683_0235625
859 Ga0495687_000562
860 Ga0495687_025202
861 Ga0495687_121510
862 Ga0495677_0002234
863 Ga0495677_0002665
864 Ga0495677_0009315
865 Ga0495677_0053058
866 Ga0495677_0064257
867 Ga0495679_023671
868 Ga0495679_095973
869 Ga0495685_000128
870 Ga0495673_0000074
871 Ga0495673_0000173
872 Ga0495673_0005143
873 Ga0495673_0046547
874 Ga0495681_0024739
875 Ga0495681_0026128
876 Ga0495681_0032410
877 Ga0495681_0065391
878 Ga0495681_0090042
879 Ga0495681_0149660
880 Ga0495686_0000387
881 Ga0495686_0001928
882 Ga0495686_0006559
883 Ga0495686_0023856
884 Ga0495686_0070510
885 Ga0495686_0102897
886 Ga0495686_0122998
887 Ga0495602_0121927
888 Ga0495626_0002890
889 Ga0495626_0003826
890 Ga0495626_0011604
891 Ga0495626_0034461
892 Ga0495626_0283591
893 Ga0496102_0006728
894 Ga0496112_0346276
895 Ga0496115_0037637
896 Ga0496115_0047818
897 Ga0496116_0021813
898 Ga0496117_0000056
899 Ga0496118_0000047
900 Ga0496120_0125156
901 Ga0496121_0095068
902 Ga0496122_0002132
903 Ga0496122_0039705
904 Ga0496123_0003832
905 Ga0496123_0005661
906 Ga0496124_0106931
907 Ga0496125_0033215
908 Ga0496125_0371469
909 Ga0495678_000146
910 Ga0495678_011440
911 Ga0495682_0001101
912 Ga0495682_0003502
913 Ga0495682_0008069
914 Ga0495682_0018475
915 Ga0495682_0049699
916 Ga0501034_0046646
917 Ga0501227_004587
918 Ga0501257_136225
919 Ga0501279_000540
920 Ga0501279_001219
921 Ga0501279_003330
922 Ga0495601_0003431
923 Ga0495619_0301075
924 Ga0500595_000507
925 Ga0500574_011835
926 Ga0500586_001667
927 Ga0500619_000663
928 Ga0466962_0006586
929 2601671908
930 2643788944
931 2644029844
932 2644213001
933 2738827893
934 2739151689
935 2739193609
936 2739320085
937 2739338326
938 2765567255
939 2819543744
940 2821136147
941 2839095197
942 2885082330
943 2932415098
944 2932421254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14334

DUF4390

Domain of unknown function (DUF4390)

49

206

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eer-assembly1.cif.gz_B crystal structure of human erythropoietin complexed to its receptor at 1.9 angstroms 0.6092 35 191
8h7g-assembly1.cif.gz_D cryo-em structure of the human saga complex 0.607 74 131
1px3-assembly1.cif.gz_B e. coli (lacz) beta-galactosidase (g794a) 0.6054 32 191
7brs-assembly4.cif.gz_D e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.603 32 190
7brs-assembly2.cif.gz_B e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.6026 32 191
ID Description Score Start End Superfamily
af_P71662_1_248_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7756 100 122 3.50.50.60
af_A8WHA8_19_129_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5981 32 191 2.60.40.10
af_A0A0R4INU9_142_237_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5799 34 191 2.60.40.10
af_Q5ALL8_1_94_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5744 34 54 2.30.29.30
af_Q7YTU0_40_142_2.60.40.2950 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5724 36 192 2.60.40.2950
ID Description Score Start End GO Terms
AF-A0A127QS40-F1-model_v4 deleted 0.9865 37 192
AF-A0A377RKR6-F1-model_v4 DUF4390 domain-containing protein 0.9825 33 192
AF-A0A377RKR6-F1-model_v4 DUF4390 domain-containing protein 0.9704 33 192
AF-A0A127QS40-F1-model_v4 deleted 0.968 37 192
AF-Q5P4P9-F1-model_v4 DUF4390 domain-containing protein 0.9679 50 190

Map