F450901

General Info

Members Datasets Scaffolds Average Seq Length
472 293 405 183

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0223821|Ga0501038_0223821_17_646
Length 200
Sequence MAHFPRSHDIVIGPLDLVARVDEALAVQAVAFGLDADEIAVRRQIVLHHMTCLGARALGATTTGGRLVGFVYGMPNDRVHWWSTVVEPYLRARGHEDWLDDSFVITELHVHPRHQNRGIGRALITTITDSAAEPRSILSAIDTDSPARGLYHSLGYQDLARQVLFPSAPKPYAVMGALLPLRRRPGQQPAIDFHRPSPPG

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
9 2643221647 Streptomyces sp. Root369 Isolate Unclassified
10 2643221670 Streptomyces sp. Root431 Isolate Unclassified
11 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
12 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
13 2643221714 Streptomyces sp. Root264 Isolate Unclassified
14 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
15 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
16 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
17 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
18 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
21 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
22 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
23 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
24 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
25 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
26 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
27 2862574272 Streptomyces sp. AcE210 Isolate Nodule
28 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
29 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
30 2867369537 Streptomyces sp. Z26 Isolate Unclassified
31 2867428634 Streptomyces sp. RP5T Isolate Unclassified
32 2867475112 Streptomyces sp. TM32 Isolate Unclassified
33 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
34 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
35 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
36 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
37 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
38 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
39 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
40 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
41 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
42 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
43 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
44 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
45 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
46 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
47 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
48 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
49 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
50 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
51 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
52 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
53 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
54 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
55 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
56 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
57 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
112 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
113 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
114 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
115 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
116 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
117 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
118 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
119 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
137 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
252 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
253 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
254 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
255 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
256 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
257 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
258 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
259 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
260 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
261 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
262 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
263 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
264 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
265 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
268 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
269 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
270 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
271 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
272 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
275 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
276 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
277 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
278 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
283 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
284 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
285 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
286 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
287 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
288 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
289 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
290 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
291 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
292 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
293 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.81
Metatranscriptomes 0
Isolates 14.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.26
Nodule 0.64
Rhizoplane 1.06
Rhizosphere 77.54
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10030345 3300002075 Bacteria 1104
2 rootH1_10089050 3300003323 Bacteria 1227
3 Ga0070670_100813312 3300005331 Bacteria 844
4 Ga0070681_10442129 3300005458 Bacteria 1212
5 Ga0068853_100207606 3300005539 Bacteria 1784
6 Ga0068855_100155972 3300005563 Bacteria 2594
7 Ga0068856_100164198 3300005614 Bacteria 2232
8 Ga0081455_10070144 3300005937 Bacteria 2911
9 Ga0075365_10146398 3300006038 Bacteria 1641
10 Ga0075370_10094471 3300006353 Bacteria 1727
11 Ga0105250_10054436 3300009092 Bacteria 1605
12 Ga0105243_10504521 3300009148 Bacteria 1147
13 Ga0105238_10296607 3300009551 Bacteria 1600
14 Ga0105239_10305201 3300010375 Bacteria 1793
15 Ga0105246_10050240 3300011119 Bacteria 2860
16 Ga0157369_10334693 3300013105 Bacteria 1573
17 Ga0157372_10136543 3300013307 Bacteria 2824
18 Ga0182008_10002627 3300014497 Bacteria 11152
19 Ga0182007_10001609 3300015262 Bacteria 11985
20 Ga0183367_1013 3300015688 Bacteria 334176
21 Ga0213875_10002706 3300021388 Bacteria 10470
22 Ga0209758_1001931 3300025297 Bacteria 22510
23 Ga0207426_1004698 3300025302 Bacteria 6543
24 Ga0207426_1011895 3300025302 Bacteria 3293
25 Ga0207647_10020503 3300025904 Bacteria 4431
26 Ga0207709_10220943 3300025935 Bacteria 1366
27 Ga0207691_10408485 3300025940 Bacteria 1158
28 Ga0207667_10239192 3300025949 Bacteria 1858
29 Ga0207702_10108022 3300026078 Bacteria 2468
30 Ga0307517_10046442 3300028786 Bacteria 4530
31 Ga0307515_10160679 3300028794 Bacteria 2293
32 Ga0268256_1017068 3300030500 Bacteria 2057
33 Ga0307511_10013718 3300030521 Bacteria 7906
34 Ga0307512_10002763 3300030522 Bacteria 21448
35 Ga0307512_10017744 3300030522 Bacteria 6518
36 Ga0307513_10021535 3300031456 Bacteria 7608
37 Ga0307513_10308372 3300031456 Bacteria 1346
38 Ga0307508_10002014 3300031616 Bacteria 22128
39 Ga0307508_10003354 3300031616 Bacteria 16243
40 Ga0307508_10027776 3300031616 Bacteria 5120
41 Ga0307508_10047719 3300031616 Bacteria 3817
42 Ga0307508_10251109 3300031616 Bacteria 1365
43 Ga0307514_10064277 3300031649 Bacteria 2783
44 Ga0307514_10068120 3300031649 Bacteria 2683
45 Ga0307514_10072822 3300031649 Bacteria 2571
46 Ga0307516_10041811 3300031730 Bacteria 4552
47 Ga0307516_10075048 3300031730 Bacteria 3236
48 Ga0307516_10111727 3300031730 Bacteria 2534
49 Ga0307518_10097795 3300031838 Bacteria 2104
50 Ga0307518_10137224 3300031838 Bacteria 1711
51 Ga0307410_10144837 3300031852 Bacteria 1762
52 Ga0307410_10967042 3300031852 Bacteria 733
53 Ga0307409_100214933 3300031995 Bacteria 1731
54 Ga0307416_101004678 3300032002 Bacteria 937
55 Ga0307416_101302194 3300032002 Bacteria 832
56 Ga0307416_101914486 3300032002 Bacteria 696
57 Ga0307411_10131491 3300032005 Bacteria 1830
58 Ga0307507_10013905 3300033179 Bacteria 9684
59 Ga0307507_10125911 3300033179 Bacteria 2027
60 Ga0307510_10063001 3300033180 Bacteria 3781
61 Ga0307510_10251296 3300033180 Bacteria 1256
62 Ga0395900_0074862 3300037418 Bacteria 3480
63 Ga0395900_1229506 3300037418 Bacteria 664
64 Ga0395898_0007411 3300037466 Bacteria 11647
65 Ga0436364_1263823 3300037853 Bacteria 35965
66 Ga0395901_0019315 3300038443 Bacteria 6967
67 Ga0439436_0003897 3300041404 Bacteria 4574
68 Ga0451849_0115485 3300041505 Bacteria 699
69 Ga0451853_0254657 3300041512 Bacteria 3172
70 Ga0451853_3045339 3300041512 Bacteria 1072
71 Ga0439433_0038793 3300041999 Bacteria 1105
72 Ga0439448_0163923 3300042005 Bacteria 774
73 Ga0439449_0070347 3300042007 Bacteria 1290
74 Ga0439449_0118725 3300042007 Bacteria 981
75 Ga0439449_0177399 3300042007 Bacteria 796
76 Ga0439457_000213 3300042014 Bacteria 15420
77 Ga0439462_0022248 3300042015 Bacteria 1658
78 Ga0439463_115917 3300042016 Bacteria 692
79 Ga0450890_027492 3300042127 Bacteria 797
80 Ga0450897_007398 3300042128 Bacteria 1001
81 Ga0450894_000614 3300042131 Bacteria 5999
82 Ga0450898_000734 3300042134 Bacteria 3997
83 Ga0450900_042966 3300042136 Bacteria 680
84 Ga0450903_000124 3300042138 Bacteria 16697
85 Ga0439458_0001305 3300042157 Bacteria 6292
86 Ga0450908_006004 3300042184 Bacteria 2318
87 Ga0466969_0013287 3300044656 Bacteria 4336
88 Ga0466969_0031914 3300044656 Bacteria 2679
89 Ga0466972_0008208 3300044658 Bacteria 5236
90 Ga0466972_0019186 3300044658 Bacteria 3420
91 Ga0466972_0292406 3300044658 Bacteria 761
92 Ga0466965_0002839 3300044683 Bacteria 7467
93 Ga0466966_0006551 3300044684 Bacteria 7707
94 Ga0466966_0069650 3300044684 Bacteria 2206
95 Ga0466961_0001365 3300044693 Bacteria 15062
96 Ga0466961_0050041 3300044693 Bacteria 2669
97 Ga0466963_0000146 3300044694 Bacteria 27935
98 Ga0466963_0092426 3300044694 Bacteria 2061
99 Ga0466963_0512424 3300044694 Bacteria 847
100 Ga0466964_0034447 3300044706 Bacteria 2021
101 Ga0466964_0049268 3300044706 Bacteria 1724
102 Ga0466971_0000681 3300044719 Bacteria 13594
103 Ga0466971_0083829 3300044719 Bacteria 1455
104 Ga0466971_0131413 3300044719 Bacteria 1162
105 Ga0466968_0045781 3300044735 Bacteria 1857
106 Ga0466970_0001388 3300044765 Bacteria 11677
107 Ga0466957_0001009 3300044842 Bacteria 14495
108 Ga0466959_0001182 3300045049 Bacteria 15746
109 Ga0466959_0215697 3300045049 Bacteria 1332
110 Ga0466958_0001814 3300045836 Bacteria 10364
111 Ga0466958_0047842 3300045836 Bacteria 2583
112 Ga0466958_0377480 3300045836 Bacteria 914
113 Ga0466967_0021830 3300045976 Bacteria 5209
114 Ga0466967_0042917 3300045976 Bacteria 3912
115 Ga0466967_0123593 3300045976 Bacteria 2394
116 Ga0495617_002127 3300046452 Bacteria 8149
117 Ga0495617_123336 3300046452 Bacteria 834
118 Ga0495627_028159 3300046453 Bacteria 1797
119 Ga0495592_0024488 3300046454 Bacteria 4587
120 Ga0495603_0000260 3300046455 Bacteria 27834
121 Ga0495603_0017077 3300046455 Bacteria 4393
122 Ga0495603_0020582 3300046455 Bacteria 3996
123 Ga0495603_0035588 3300046455 Bacteria 2990
124 Ga0495603_0047167 3300046455 Bacteria 2566
125 Ga0495603_0599576 3300046455 Bacteria 630
126 Ga0495590_0044377 3300046457 Bacteria 1550
127 Ga0495629_0005680 3300046459 Bacteria 9315
128 Ga0495629_0021532 3300046459 Bacteria 4600
129 Ga0495629_0041309 3300046459 Bacteria 3245
130 Ga0495629_0057571 3300046459 Bacteria 2717
131 Ga0495629_0063198 3300046459 Bacteria 2585
132 Ga0495629_0090744 3300046459 Bacteria 2132
133 Ga0495629_0098172 3300046459 Bacteria 2043
134 Ga0495629_0143313 3300046459 Bacteria 1662
135 Ga0495638_0027353 3300046460 Bacteria 3692
136 Ga0495638_0030285 3300046460 Bacteria 3485
137 Ga0495638_0030724 3300046460 Bacteria 3455
138 Ga0495651_0000524 3300046462 Bacteria 29820
139 Ga0495651_0113297 3300046462 Bacteria 2002
140 Ga0495580_0218696 3300046472 Bacteria 1309
141 Ga0495582_0094498 3300046473 Bacteria 1669
142 Ga0495582_0366929 3300046473 Bacteria 829
143 Ga0495639_0137359 3300046475 Bacteria 1173
144 Ga0495639_0300097 3300046475 Bacteria 801
145 Ga0495662_0015669 3300046476 Bacteria 3679
146 Ga0495662_0026141 3300046476 Bacteria 2819
147 Ga0495662_0339513 3300046476 Bacteria 738
148 Ga0495664_0024529 3300046477 Bacteria 3506
149 Ga0495664_0508093 3300046477 Bacteria 719
150 Ga0495584_0100974 3300046491 Bacteria 1458
151 Ga0495585_0010601 3300046492 Bacteria 5479
152 Ga0495585_0016823 3300046492 Bacteria 4237
153 Ga0495585_0046284 3300046492 Bacteria 2426
154 Ga0495585_0183665 3300046492 Bacteria 1074
155 Ga0495594_0000468 3300046499 Bacteria 20543
156 Ga0495594_0015862 3300046499 Bacteria 3963
157 Ga0495594_0045215 3300046499 Bacteria 2417
158 Ga0495594_0188873 3300046499 Bacteria 1173
159 Ga0495594_0281575 3300046499 Bacteria 947
160 Ga0495594_0633655 3300046499 Bacteria 605
161 Ga0495607_0026303 3300046501 Bacteria 3610
162 Ga0495607_0182471 3300046501 Bacteria 1051
163 Ga0495583_0022645 3300046506 Bacteria 3199
164 Ga0495583_0151326 3300046506 Bacteria 961
165 Ga0495606_0012214 3300046507 Bacteria 6911
166 Ga0495618_0035584 3300046514 Bacteria 3125
167 Ga0495618_0077144 3300046514 Bacteria 2123
168 Ga0495620_0036242 3300046515 Bacteria 2208
169 Ga0495620_0039471 3300046515 Bacteria 2085
170 Ga0495628_0035435 3300046516 Bacteria 4010
171 Ga0495628_0094890 3300046516 Bacteria 2305
172 Ga0495630_0046909 3300046517 Bacteria 3230
173 Ga0495630_0108400 3300046517 Bacteria 2104
174 Ga0495631_0012167 3300046518 Bacteria 4211
175 Ga0495631_0071400 3300046518 Bacteria 1500
176 Ga0495632_0023483 3300046519 Bacteria 3293
177 Ga0495632_0065744 3300046519 Bacteria 1751
178 Ga0495637_0036639 3300046520 Bacteria 2134
179 Ga0495643_0007025 3300046522 Bacteria 7313
180 Ga0495643_0012445 3300046522 Bacteria 5133
181 Ga0495643_0164773 3300046522 Bacteria 1088
182 Ga0495644_0130911 3300046523 Bacteria 956
183 Ga0495648_0038373 3300046524 Bacteria 3064
184 Ga0495666_0113567 3300046526 Bacteria 1271
185 Ga0495652_0014315 3300046529 Bacteria 7123
186 Ga0495652_0137508 3300046529 Bacteria 1925
187 Ga0495654_0025665 3300046530 Bacteria 3034
188 Ga0495640_0058705 3300046533 Bacteria 2623
189 Ga0495640_0106857 3300046533 Bacteria 1832
190 Ga0495640_0462248 3300046533 Bacteria 774
191 Ga0495586_0367594 3300046535 Bacteria 827
192 Ga0495587_0097654 3300046536 Bacteria 1693
193 Ga0495609_0026983 3300046538 Bacteria 2626
194 Ga0495597_0070887 3300046542 Bacteria 1501
195 Ga0495645_0028863 3300046543 Bacteria 4032
196 Ga0495645_0160933 3300046543 Bacteria 1552
197 Ga0495622_0045952 3300046557 Bacteria 2028
198 Ga0495622_0064830 3300046557 Bacteria 1689
199 Ga0495633_0013378 3300046558 Bacteria 4327
200 Ga0495633_0025900 3300046558 Bacteria 2884
201 Ga0495633_0068719 3300046558 Bacteria 1654
202 Ga0495667_0075833 3300046559 Bacteria 2188
203 Ga0495656_0160947 3300046615 Bacteria 1091
204 Ga0495656_0171539 3300046615 Bacteria 1061
205 Ga0495668_0056340 3300046616 Bacteria 2169
206 Ga0495668_0083798 3300046616 Bacteria 1748
207 Ga0495634_0021581 3300046642 Bacteria 4548
208 Ga0495611_0007706 3300046648 Bacteria 4573
209 Ga0495611_0018761 3300046648 Bacteria 2967
210 Ga0495611_0449612 3300046648 Bacteria 587
211 Ga0495625_0151802 3300046660 Bacteria 1557
212 Ga0495635_0002772 3300046663 Bacteria 12017
213 Ga0495635_0153361 3300046663 Bacteria 1568
214 Ga0495635_0361238 3300046663 Bacteria 968
215 Ga0495661_0040388 3300046665 Bacteria 2893
216 Ga0495661_0045748 3300046665 Bacteria 2675
217 Ga0495661_0414728 3300046665 Bacteria 653
218 Ga0495588_0002219 3300046674 Bacteria 8316
219 Ga0495588_0018518 3300046674 Bacteria 3397
220 Ga0495588_0092994 3300046674 Bacteria 1580
221 Ga0495657_0046358 3300046675 Bacteria 2943
222 Ga0495657_0082795 3300046675 Bacteria 2072
223 Ga0495657_0370460 3300046675 Bacteria 845
224 Ga0495623_0008170 3300046679 Bacteria 6805
225 Ga0495646_0097325 3300046680 Bacteria 1691
226 Ga0495646_0121120 3300046680 Bacteria 1480
227 Ga0495613_0001119 3300046689 Bacteria 20415
228 Ga0495613_0010768 3300046689 Bacteria 6784
229 Ga0495613_0059758 3300046689 Bacteria 2793
230 Ga0495613_0061337 3300046689 Bacteria 2753
231 Ga0495613_0102146 3300046689 Bacteria 2070
232 Ga0495613_0235446 3300046689 Bacteria 1281
233 Ga0495613_0419158 3300046689 Bacteria 911
234 Ga0495624_0324835 3300046690 Bacteria 926
235 Ga0495670_0022614 3300046691 Bacteria 3105
236 Ga0495670_0061049 3300046691 Bacteria 1895
237 Ga0495671_0046000 3300046692 Bacteria 2183
238 Ga0495671_0057429 3300046692 Bacteria 1926
239 Ga0495671_0110782 3300046692 Bacteria 1341
240 Ga0495671_0138505 3300046692 Bacteria 1186
241 Ga0495671_0180960 3300046692 Bacteria 1024
242 Ga0495671_0256065 3300046692 Bacteria 845
243 Ga0495649_0049636 3300046694 Bacteria 2279
244 Ga0495649_0213084 3300046694 Bacteria 1000
245 Ga0495589_0012085 3300046794 Bacteria 4477
246 Ga0495589_0027799 3300046794 Bacteria 2858
247 Ga0495589_0030885 3300046794 Bacteria 2698
248 Ga0495589_0053113 3300046794 Bacteria 2000
249 Ga0495589_0062162 3300046794 Bacteria 1832
250 Ga0495589_0164930 3300046794 Bacteria 1054
251 Ga0495600_0029761 3300046809 Bacteria 3536
252 Ga0495600_0095120 3300046809 Bacteria 1942
253 Ga0495600_0144635 3300046809 Bacteria 1541
254 Ga0495660_0055036 3300046810 Bacteria 2154
255 Ga0495660_0105061 3300046810 Bacteria 1448
256 Ga0495581_0020124 3300047315 Bacteria 3874
257 Ga0495581_0051815 3300047315 Bacteria 2370
258 Ga0495581_0189195 3300047315 Bacteria 1204
259 Ga0495604_0003849 3300047317 Bacteria 11954
260 Ga0495604_0034076 3300047317 Bacteria 4029
261 Ga0495604_0057842 3300047317 Bacteria 2979
262 Ga0495636_0001057 3300047318 Bacteria 10339
263 Ga0495636_0030899 3300047318 Bacteria 2192
264 Ga0495636_0044254 3300047318 Bacteria 1853
265 Ga0495636_0125306 3300047318 Bacteria 1139
266 Ga0495636_0288715 3300047318 Bacteria 765
267 Ga0495674_0053802 3300047319 Bacteria 3537
268 Ga0495676_0022585 3300047321 Bacteria 5471
269 Ga0495676_0046245 3300047321 Bacteria 3534
270 Ga0495676_0081552 3300047321 Bacteria 2451
271 Ga0495676_0107520 3300047321 Bacteria 2053
272 Ga0495676_0145994 3300047321 Bacteria 1689
273 Ga0495676_0202979 3300047321 Bacteria 1376
274 Ga0495680_0003865 3300047322 Bacteria 14497
275 Ga0495683_0008343 3300047323 Bacteria 5551
276 Ga0495683_0020839 3300047323 Bacteria 3380
277 Ga0495683_0255444 3300047323 Bacteria 767
278 Ga0495687_012486 3300047443 Bacteria 4486
279 Ga0495687_037187 3300047443 Bacteria 2170
280 Ga0495675_0005829 3300047444 Bacteria 7526
281 Ga0495675_0067213 3300047444 Bacteria 2265
282 Ga0495675_0080016 3300047444 Bacteria 2058
283 Ga0495677_0027769 3300047445 Bacteria 2054
284 Ga0495679_110422 3300047446 Bacteria 757
285 Ga0495685_003473 3300047447 Bacteria 5033
286 Ga0495685_009384 3300047447 Bacteria 3266
287 Ga0495685_016414 3300047447 Bacteria 2529
288 Ga0495685_120976 3300047447 Bacteria 859
289 Ga0495685_124420 3300047447 Bacteria 845
290 Ga0495685_133904 3300047447 Bacteria 809
291 Ga0495681_0001749 3300047470 Bacteria 16021
292 Ga0495681_0010814 3300047470 Bacteria 5494
293 Ga0495681_0018085 3300047470 Bacteria 3892
294 Ga0495684_0150828 3300047471 Bacteria 1738
295 Ga0495686_0057805 3300047472 Bacteria 2420
296 Ga0495686_0087168 3300047472 Bacteria 1899
297 Ga0495686_0223975 3300047472 Bacteria 1068
298 Ga0495593_0002624 3300047673 Bacteria 10810
299 Ga0495593_0191464 3300047673 Bacteria 1029
300 Ga0495602_0366434 3300048088 Bacteria 1036
301 Ga0495614_0001484 3300048089 Bacteria 10158
302 Ga0495614_0009959 3300048089 Bacteria 4195
303 Ga0495614_0014753 3300048089 Bacteria 3417
304 Ga0495614_0073442 3300048089 Bacteria 1476
305 Ga0495614_0403353 3300048089 Bacteria 642
306 Ga0495614_0403354 3300048089 Bacteria 642
307 Ga0496106_0038793 3300048909 Bacteria 3566
308 Ga0496108_0069533 3300048911 Bacteria 2971
309 Ga0496109_0006599 3300048912 Bacteria 9772
310 Ga0496113_0465195 3300048916 Bacteria 1016
311 Ga0495678_108640 3300049459 Bacteria 949
312 Ga0501031_0007460 3300049568 Bacteria 7123
313 Ga0501031_0073394 3300049568 Bacteria 2227
314 Ga0501032_0007932 3300049569 Bacteria 7732
315 Ga0501033_0009636 3300049570 Bacteria 7432
316 Ga0501033_0106385 3300049570 Bacteria 2044
317 Ga0501033_0157897 3300049570 Bacteria 1633
318 Ga0501034_0002969 3300049571 Bacteria 19649
319 Ga0501034_0113910 3300049571 Bacteria 2693
320 Ga0501036_0005070 3300049572 Bacteria 10659
321 Ga0501036_0034621 3300049572 Bacteria 4273
322 Ga0501037_0010417 3300049573 Bacteria 6823
323 Ga0501037_0536190 3300049573 Bacteria 791
324 Ga0501038_0001654 3300049574 Bacteria 20719
325 Ga0501038_0003074 3300049574 Bacteria 15554
326 Ga0501038_0223821 3300049574 Bacteria 1500
327 Ga0501039_0130760 3300049575 Bacteria 1970
328 Ga0501039_0161423 3300049575 Bacteria 1761
329 Ga0501040_0023000 3300049576 Bacteria 4176
330 Ga0501041_0007008 3300049577 Bacteria 6612
331 Ga0501042_0273953 3300049578 Bacteria 1218
332 Ga0501043_0002107 3300049579 Bacteria 16982
333 Ga0501046_0005014 3300049580 Bacteria 11888
334 Ga0501046_0188879 3300049580 Bacteria 1538
335 Ga0501047_0000577 3300049581 Bacteria 39081
336 Ga0501047_0017370 3300049581 Bacteria 6890
337 Ga0501047_0044712 3300049581 Bacteria 4280
338 Ga0501047_0255027 3300049581 Bacteria 1602
339 Ga0501048_0002104 3300049582 Bacteria 15177
340 Ga0501069_0261951 3300049585 Bacteria 1010
341 Ga0501070_0346029 3300049586 Bacteria 1207
342 Ga0501070_0621979 3300049586 Bacteria 859
343 Ga0501071_0001009 3300049587 Bacteria 15483
344 Ga0501072_0000779 3300049588 Bacteria 23322
345 Ga0501073_0056827 3300049589 Bacteria 2737
346 Ga0501074_0073209 3300049590 Bacteria 2461
347 Ga0501074_0333245 3300049590 Bacteria 1077
348 Ga0501076_0002946 3300049592 Bacteria 11800
349 Ga0501079_0009350 3300049741 Bacteria 7426
350 Ga0501080_0226479 3300049742 Bacteria 1709
351 Ga0501080_0279684 3300049742 Bacteria 1517
352 Ga0501083_0001149 3300049744 Bacteria 17806
353 Ga0501035_0002230 3300049822 Bacteria 19220
354 Ga0501035_0101620 3300049822 Bacteria 2523
355 Ga0501035_0353943 3300049822 Bacteria 1228
356 Ga0501035_1130903 3300049822 Bacteria 610
357 Ga0501044_0000883 3300049823 Bacteria 36150
358 Ga0501044_0002866 3300049823 Bacteria 19638
359 Ga0501044_0011498 3300049823 Bacteria 9589
360 Ga0501044_0028757 3300049823 Bacteria 5864
361 Ga0501044_0112804 3300049823 Bacteria 2725
362 Ga0501044_0212606 3300049823 Bacteria 1887
363 Ga0501045_0093222 3300049824 Bacteria 2227
364 nmdc:mga03n38_55621_c1 3300050490 Bacteria 1783
365 nmdc:mga0yw44_126320_c1 3300050492 Bacteria 1652
366 nmdc:mga07m45_586850_c1 3300050496 Bacteria 644
367 Ga0495612_0045745 3300053078 Bacteria 1792
368 Ga0500578_0037987 3300053086 Bacteria 3092
369 Ga0500644_0008353 3300053088 Bacteria 2731
370 Ga0500583_0122951 3300053092 Bacteria 1285
371 Ga0500566_0011136 3300053094 Bacteria 5299
372 Ga0500640_006474 3300053095 Bacteria 4474
373 Ga0500641_0189703 3300053096 Bacteria 880
374 Ga0500654_029120 3300053099 Bacteria 3360
375 Ga0500558_246316 3300053106 Bacteria 590
376 Ga0500560_005281 3300053107 Bacteria 2844
377 Ga0500560_043736 3300053107 Bacteria 1414
378 Ga0500569_002057 3300053109 Bacteria 3914
379 Ga0500572_004010 3300053111 Bacteria 3347
380 Ga0500614_045972 3300053123 Bacteria 1128
381 Ga0500628_001946 3300053129 Bacteria 3473
382 Ga0500652_009436 3300053131 Bacteria 3300
383 Ga0500658_0012540 3300053134 Bacteria 3128
384 Ga0500559_0328988 3300053136 Bacteria 716
385 Ga0500561_0000965 3300053137 Bacteria 4600
386 Ga0500573_0082160 3300053140 Bacteria 1830
387 Ga0500574_131006 3300053141 Bacteria 739
388 Ga0500577_0094131 3300053142 Bacteria 1216
389 Ga0500600_0023154 3300053149 Bacteria 3713
390 Ga0500600_0148033 3300053149 Bacteria 1172
391 Ga0500600_0151063 3300053149 Bacteria 1155
392 Ga0500603_024367 3300053150 Bacteria 1514
393 Ga0500616_0011791 3300053153 Bacteria 5142
394 Ga0500624_006266 3300053157 Bacteria 1605
395 Ga0500633_0001744 3300053160 Bacteria 4237
396 Ga0500634_0017299 3300053161 Bacteria 3860
397 Ga0500656_000239 3300053732 Bacteria 3665
398 Ga0500587_002079 3300053739 Bacteria 2861
399 Ga0501084_0005162 3300054114 Bacteria 10681
400 Ga0501084_1080824 3300054114 Bacteria 674
401 Ga0501082_0003379 3300060353 Bacteria 13925
402 Ga0466962_0030067 3300061719 Bacteria 2600
403 Ga0466962_0105762 3300061719 Bacteria 1353
404 Ga0466962_0174499 3300061719 Bacteria 1047
405 Ga0530510_0025602 3300061734 Bacteria 4220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041999 Ga0439433_0038793 Ga0439433_0038793_10_501 163
2 3300042016 Ga0439463_115917 Ga0439463_115917_22_513 163
3 3300049573 Ga0501037_0536190 Ga0501037_0536190_268_777 163
4 iso_pu_bacteria 2912715099 2912717275 171
5 iso_pu_bacteria 2582581313 2585307839 172
6 iso_pu_bacteria 2643221647 2644269652 172
7 iso_pu_bacteria 2643221714 2644629154 172
8 iso_pu_bacteria 2784746763 2785340881 172
9 iso_pu_bacteria 2784746768 2785371866 172
10 iso_pu_bacteria 2786546132 2786672979 172
11 iso_pu_bacteria 2862382967 2862386522 172
12 iso_pu_bacteria 2863404153 2863408962 172
13 iso_pu_bacteria 2867428634 2867433294 172
14 iso_pu_bacteria 2877676314 2877678714 172
15 iso_pu_bacteria 2912723979 2912729854 172
16 iso_pu_bacteria 2946072368 2946078044 172
17 iso_pu_bacteria 2954380949 2954383686 172
18 iso_pu_bacteria 2954673503 2954679288 172
19 iso_pu_bacteria 2954682443 2954684867 172
20 iso_pu_bacteria 2954691527 2954694484 172
21 iso_pu_bacteria 2954701450 2954709688 172
22 iso_pu_bacteria 2954711539 2954713975 172
23 iso_pu_bacteria 2954721474 2954723944 172
24 iso_pu_bacteria 2954731030 2954737894 172
25 iso_pu_bacteria 2954740390 2954742841 172
26 iso_pu_bacteria 2954749733 2954756748 172
27 iso_pu_bacteria 2954759201 2954761801 172
28 iso_pu_bacteria 3006393351 3006394168 172
29 iso_pu_bacteria 8008558824 8008563124 172
30 iso_pu_bacteria 8008574985 8008576843 172
31 iso_pu_bacteria 8023623736 8023626258 172
32 iso_pu_bacteria 8025478263 8025485487 172
33 3300046674 Ga0495588_0002219 Ga0495588_0002219_2938_3459 173
34 3300046692 Ga0495671_0046000 Ga0495671_0046000_1578_2099 173
35 3300047470 Ga0495681_0001749 Ga0495681_0001749_13000_13521 173
36 3300048089 Ga0495614_0403353 Ga0495614_0403353_30_551 173
37 3300048089 Ga0495614_0403354 Ga0495614_0403354_92_613 173
38 3300053107 Ga0500560_005281 Ga0500560_005281_350_871 173
39 iso_pu_bacteria 2867475112 2867477167 173
40 iso_pu_bacteria 2997451912 2997455977 173
41 3300046476 Ga0495662_0339513 Ga0495662_0339513_26_553 174
42 3300046477 Ga0495664_0508093 Ga0495664_0508093_167_694 174
43 3300046514 Ga0495618_0035584 Ga0495618_0035584_27_554 174
44 3300046523 Ga0495644_0130911 Ga0495644_0130911_394_921 174
45 3300046675 Ga0495657_0082795 Ga0495657_0082795_27_554 174
46 3300046675 Ga0495657_0370460 Ga0495657_0370460_292_819 174
47 iso_pu_bacteria 2554235005 2554255970 174
48 iso_pu_bacteria 2643221670 2644387204 174
49 iso_pu_bacteria 2643221587 2643943722 175
50 iso_pu_bacteria 2643221677 2644434019 175
51 iso_pu_bacteria 2862290372 2862294239 175
52 iso_pu_bacteria 2862574272 2862577173 175
53 iso_pu_bacteria 2918501144 2918506831 175
54 3300006038 Ga0075365_10146398 Ga0075365_101463982 176
55 3300006353 Ga0075370_10094471 Ga0075370_100944712 176
56 3300025940 Ga0207691_10408485 Ga0207691_104084852 176
57 3300028786 Ga0307517_10046442 Ga0307517_100464423 176
58 3300030500 Ga0268256_1017068 Ga0268256_10170681 176
59 3300031456 Ga0307513_10308372 Ga0307513_103083722 176
60 3300031616 Ga0307508_10027776 Ga0307508_100277765 176
61 3300031616 Ga0307508_10047719 Ga0307508_100477193 176
62 3300031649 Ga0307514_10068120 Ga0307514_100681202 176
63 3300031730 Ga0307516_10041811 Ga0307516_100418114 176
64 3300031730 Ga0307516_10075048 Ga0307516_100750482 176
65 3300033180 Ga0307510_10251296 Ga0307510_102512961 176
66 3300037418 Ga0395900_0074862 Ga0395900_0074862_851_1426 176
67 3300037418 Ga0395900_1229506 Ga0395900_1229506_74_604 176
68 3300037466 Ga0395898_0007411 Ga0395898_0007411_8436_9011 176
69 3300038443 Ga0395901_0019315 Ga0395901_0019315_3978_4553 176
70 3300041404 Ga0439436_0003897 Ga0439436_0003897_3592_4122 176
71 3300041505 Ga0451849_0115485 Ga0451849_0115485_30_560 176
72 3300041512 Ga0451853_0254657 Ga0451853_0254657_618_1148 176
73 3300041512 Ga0451853_3045339 Ga0451853_3045339_140_670 176
74 3300042005 Ga0439448_0163923 Ga0439448_0163923_169_699 176
75 3300042007 Ga0439449_0118725 Ga0439449_0118725_371_901 176
76 3300042014 Ga0439457_000213 Ga0439457_000213_5404_5934 176
77 3300042015 Ga0439462_0022248 Ga0439462_0022248_413_943 176
78 3300042127 Ga0450890_027492 Ga0450890_027492_207_737 176
79 3300042128 Ga0450897_007398 Ga0450897_007398_291_821 176
80 3300042131 Ga0450894_000614 Ga0450894_000614_4641_5171 176
81 3300042134 Ga0450898_000734 Ga0450898_000734_1434_1964 176
82 3300042138 Ga0450903_000124 Ga0450903_000124_1733_2263 176
83 3300042157 Ga0439458_0001305 Ga0439458_0001305_2137_2667 176
84 3300042184 Ga0450908_006004 Ga0450908_006004_855_1385 176
85 3300044694 Ga0466963_0092426 Ga0466963_0092426_788_1318 176
86 3300044694 Ga0466963_0512424 Ga0466963_0512424_158_688 176
87 3300044706 Ga0466964_0034447 Ga0466964_0034447_425_955 176
88 3300044719 Ga0466971_0131413 Ga0466971_0131413_31_561 176
89 3300045836 Ga0466958_0047842 Ga0466958_0047842_507_1037 176
90 3300045836 Ga0466958_0377480 Ga0466958_0377480_68_598 176
91 3300045976 Ga0466967_0021830 Ga0466967_0021830_2913_3443 176
92 3300045976 Ga0466967_0123593 Ga0466967_0123593_924_1454 176
93 3300046459 Ga0495629_0098172 Ga0495629_0098172_368_901 176
94 3300046460 Ga0495638_0027353 Ga0495638_0027353_869_1402 176
95 3300046492 Ga0495585_0016823 Ga0495585_0016823_1393_1926 176
96 3300046492 Ga0495585_0183665 Ga0495585_0183665_208_741 176
97 3300046499 Ga0495594_0188873 Ga0495594_0188873_333_866 176
98 3300046519 Ga0495632_0065744 Ga0495632_0065744_1023_1556 176
99 3300046522 Ga0495643_0012445 Ga0495643_0012445_3583_4116 176
100 3300046533 Ga0495640_0462248 Ga0495640_0462248_211_744 176
101 3300046558 Ga0495633_0025900 Ga0495633_0025900_1704_2237 176
102 3300046615 Ga0495656_0171539 Ga0495656_0171539_324_857 176
103 3300046648 Ga0495611_0449612 Ga0495611_0449612_40_573 176
104 3300046689 Ga0495613_0102146 Ga0495613_0102146_953_1486 176
105 3300046689 Ga0495613_0419158 Ga0495613_0419158_36_569 176
106 3300046691 Ga0495670_0022614 Ga0495670_0022614_1672_2205 176
107 3300046692 Ga0495671_0110782 Ga0495671_0110782_442_975 176
108 3300046694 Ga0495649_0049636 Ga0495649_0049636_923_1453 176
109 3300046794 Ga0495589_0030885 Ga0495589_0030885_216_749 176
110 3300046810 Ga0495660_0105061 Ga0495660_0105061_212_745 176
111 3300047315 Ga0495581_0189195 Ga0495581_0189195_657_1190 176
112 3300047317 Ga0495604_0034076 Ga0495604_0034076_2560_3093 176
113 3300047323 Ga0495683_0255444 Ga0495683_0255444_11_544 176
114 3300047447 Ga0495685_003473 Ga0495685_003473_3476_4009 176
115 3300047447 Ga0495685_016414 Ga0495685_016414_1541_2071 176
116 3300047470 Ga0495681_0018085 Ga0495681_0018085_2347_2880 176
117 3300047472 Ga0495686_0057805 Ga0495686_0057805_183_716 176
118 3300047472 Ga0495686_0087168 Ga0495686_0087168_172_702 176
119 3300049570 Ga0501033_0009636 Ga0501033_0009636_1985_2515 176
120 3300049581 Ga0501047_0044712 Ga0501047_0044712_1182_1715 176
121 3300049822 Ga0501035_0101620 Ga0501035_0101620_1576_2106 176
122 3300049823 Ga0501044_0011498 Ga0501044_0011498_985_1515 176
123 3300050492 nmdc:mga0yw44_126320_c1 nmdc:mga0yw44_126320_c1_823_1353 176
124 3300050496 nmdc:mga07m45_586850_c1 nmdc:mga07m45_586850_c1_38_568 176
125 3300053086 Ga0500578_0037987 Ga0500578_0037987_1006_1539 176
126 3300053094 Ga0500566_0011136 Ga0500566_0011136_978_1511 176
127 3300053096 Ga0500641_0189703 Ga0500641_0189703_316_846 176
128 3300053099 Ga0500654_029120 Ga0500654_029120_1817_2350 176
129 3300053106 Ga0500558_246316 Ga0500558_246316_36_569 176
130 3300053107 Ga0500560_043736 Ga0500560_043736_703_1236 176
131 3300053109 Ga0500569_002057 Ga0500569_002057_1050_1583 176
132 3300053123 Ga0500614_045972 Ga0500614_045972_291_824 176
133 3300053129 Ga0500628_001946 Ga0500628_001946_1741_2274 176
134 3300053131 Ga0500652_009436 Ga0500652_009436_990_1523 176
135 3300053134 Ga0500658_0012540 Ga0500658_0012540_1380_1913 176
136 3300053136 Ga0500559_0328988 Ga0500559_0328988_145_678 176
137 3300053137 Ga0500561_0000965 Ga0500561_0000965_3062_3595 176
138 3300053140 Ga0500573_0082160 Ga0500573_0082160_1035_1568 176
139 3300053142 Ga0500577_0094131 Ga0500577_0094131_457_990 176
140 3300053149 Ga0500600_0023154 Ga0500600_0023154_1231_1764 176
141 3300053149 Ga0500600_0148033 Ga0500600_0148033_185_715 176
142 3300053150 Ga0500603_024367 Ga0500603_024367_531_1064 176
143 3300053153 Ga0500616_0011791 Ga0500616_0011791_942_1475 176
144 3300053160 Ga0500633_0001744 Ga0500633_0001744_2473_3006 176
145 3300053161 Ga0500634_0017299 Ga0500634_0017299_990_1523 176
146 3300053732 Ga0500656_000239 Ga0500656_000239_2242_2775 176
147 3300053739 Ga0500587_002079 Ga0500587_002079_1201_1734 176
148 3300061719 Ga0466962_0105762 Ga0466962_0105762_187_717 176
149 3300061719 Ga0466962_0174499 Ga0466962_0174499_335_865 176
150 3300021388 Ga0213875_10002706 Ga0213875_1000270611 177
151 3300025302 Ga0207426_1004698 Ga0207426_10046983 177
152 3300031616 Ga0307508_10251109 Ga0307508_102511092 177
153 3300037853 Ga0436364_1263823 Ga0436364_1263823_13329_13874 177
154 3300046459 Ga0495629_0090744 Ga0495629_0090744_630_1166 177
155 3300049568 Ga0501031_0007460 Ga0501031_0007460_1015_1557 177
156 3300049568 Ga0501031_0073394 Ga0501031_0073394_1516_2058 177
157 3300049569 Ga0501032_0007932 Ga0501032_0007932_1311_1853 177
158 3300049570 Ga0501033_0157897 Ga0501033_0157897_922_1464 177
159 3300049571 Ga0501034_0002969 Ga0501034_0002969_11190_11732 177
160 3300049572 Ga0501036_0005070 Ga0501036_0005070_1952_2494 177
161 3300049573 Ga0501037_0010417 Ga0501037_0010417_1311_1853 177
162 3300049574 Ga0501038_0001654 Ga0501038_0001654_8493_9035 177
163 3300049575 Ga0501039_0161423 Ga0501039_0161423_922_1464 177
164 3300049576 Ga0501040_0023000 Ga0501040_0023000_1006_1548 177
165 3300049577 Ga0501041_0007008 Ga0501041_0007008_64_606 177
166 3300049578 Ga0501042_0273953 Ga0501042_0273953_528_1070 177
167 3300049579 Ga0501043_0002107 Ga0501043_0002107_8523_9065 177
168 3300049580 Ga0501046_0005014 Ga0501046_0005014_4973_5515 177
169 3300049581 Ga0501047_0000577 Ga0501047_0000577_27362_27904 177
170 3300049582 Ga0501048_0002104 Ga0501048_0002104_8676_9218 177
171 3300049585 Ga0501069_0261951 Ga0501069_0261951_103_639 177
172 3300049587 Ga0501071_0001009 Ga0501071_0001009_8307_8849 177
173 3300049588 Ga0501072_0000779 Ga0501072_0000779_11046_11588 177
174 3300049590 Ga0501074_0073209 Ga0501074_0073209_538_1080 177
175 3300049592 Ga0501076_0002946 Ga0501076_0002946_6607_7149 177
176 3300049741 Ga0501079_0009350 Ga0501079_0009350_2994_3536 177
177 3300049742 Ga0501080_0226479 Ga0501080_0226479_870_1412 177
178 3300049744 Ga0501083_0001149 Ga0501083_0001149_7466_8008 177
179 3300049822 Ga0501035_0002230 Ga0501035_0002230_11188_11730 177
180 3300049823 Ga0501044_0002866 Ga0501044_0002866_11188_11730 177
181 3300049824 Ga0501045_0093222 Ga0501045_0093222_170_712 177
182 3300054114 Ga0501084_0005162 Ga0501084_0005162_8606_9148 177
183 3300060353 Ga0501082_0003379 Ga0501082_0003379_7341_7883 177
184 3300061734 Ga0530510_0025602 Ga0530510_0025602_1046_1588 177
185 3300032005 Ga0307411_10131491 Ga0307411_101314912 178
186 3300046455 Ga0495603_0599576 Ga0495603_0599576_23_565 179
187 3300046499 Ga0495594_0045215 Ga0495594_0045215_150_692 179
188 3300046501 Ga0495607_0182471 Ga0495607_0182471_155_697 179
189 3300046518 Ga0495631_0071400 Ga0495631_0071400_924_1466 179
190 3300046522 Ga0495643_0164773 Ga0495643_0164773_392_934 179
191 3300046558 Ga0495633_0068719 Ga0495633_0068719_691_1233 179
192 3300046648 Ga0495611_0018761 Ga0495611_0018761_702_1244 179
193 3300046665 Ga0495661_0045748 Ga0495661_0045748_1007_1549 179
194 3300046691 Ga0495670_0061049 Ga0495670_0061049_1289_1831 179
195 3300046692 Ga0495671_0256065 Ga0495671_0256065_281_823 179
196 3300046794 Ga0495589_0027799 Ga0495589_0027799_2021_2563 179
197 3300047318 Ga0495636_0125306 Ga0495636_0125306_268_813 179
198 3300047321 Ga0495676_0145994 Ga0495676_0145994_841_1383 179
199 3300047323 Ga0495683_0020839 Ga0495683_0020839_1791_2333 179
200 3300047447 Ga0495685_133904 Ga0495685_133904_89_631 179
201 3300048089 Ga0495614_0073442 Ga0495614_0073442_99_641 179
202 3300044656 Ga0466969_0013287 Ga0466969_0013287_2529_3074 180
203 3300044658 Ga0466972_0008208 Ga0466972_0008208_2570_3115 180
204 3300044684 Ga0466966_0069650 Ga0466966_0069650_1276_1821 180
205 3300044693 Ga0466961_0050041 Ga0466961_0050041_430_975 180
206 3300044719 Ga0466971_0083829 Ga0466971_0083829_685_1230 180
207 3300045049 Ga0466959_0215697 Ga0466959_0215697_287_832 180
208 3300044658 Ga0466972_0292406 Ga0466972_0292406_115_663 181
209 iso_pu_bacteria 2867369537 2867374128 181
210 iso_pu_bacteria 2582581312 2585302131 182
211 iso_pu_bacteria 2643221578 2643899322 182
212 iso_pu_bacteria 2643221673 2644406943 182
213 iso_pu_bacteria 2767802112 2768647132 182
214 iso_pu_bacteria 2808606982 2811844086 182
215 iso_pu_bacteria 2867346516 2867350943 182
216 iso_pu_bacteria 2875391855 2875397033 182
217 iso_pu_bacteria 2946045630 2946047520 182
218 iso_pu_bacteria 2997600082 2997606218 182
219 3300049574 Ga0501038_0223821 Ga0501038_0223821_17_646 183
220 3300049823 Ga0501044_0000883 Ga0501044_0000883_8231_8860 183
221 iso_pu_bacteria 2582581314 2585316823 183
222 iso_pu_bacteria 2791355406 2793982816 183
223 iso_pu_bacteria 2862281513 2862284277 183
224 iso_pu_bacteria 2990044586 2990045936 183
225 iso_pu_bacteria 2990088156 2990088398 183
226 iso_pu_bacteria 8047893842 8047895770 183
227 iso_pu_bacteria 8048127548 8048135605 183
228 iso_pu_bacteria 8048356638 8048363164 183
229 iso_pu_bacteria 8048369669 8048372794 183
230 iso_pu_bacteria 8048379754 8048381728 183
231 iso_pu_bacteria 2616644814 2616700108 184
232 iso_pu_bacteria 2808606375 2808913944 184
233 iso_pu_bacteria 2811994917 2812478466 184
234 iso_pu_bacteria 2862507626 2862514279 184
235 iso_pu_bacteria 2643221548 2643762735 185
236 iso_pu_bacteria 2818991463 2819698897 185
237 iso_pu_bacteria 2966598605 2966600557 185
238 3300025302 Ga0207426_1011895 Ga0207426_10118952 186
239 3300031616 Ga0307508_10003354 Ga0307508_1000335414 186
240 3300031730 Ga0307516_10111727 Ga0307516_101117271 186
241 3300031852 Ga0307410_10144837 Ga0307410_101448372 186
242 3300031852 Ga0307410_10967042 Ga0307410_109670421 186
243 3300031995 Ga0307409_100214933 Ga0307409_1002149332 186
244 3300032002 Ga0307416_101302194 Ga0307416_1013021942 186
245 3300032002 Ga0307416_101914486 Ga0307416_1019144861 186
246 3300042136 Ga0450900_042966 Ga0450900_042966_70_636 186
247 3300046452 Ga0495617_123336 Ga0495617_123336_100_669 186
248 3300046455 Ga0495603_0000260 Ga0495603_0000260_125_700 186
249 3300046455 Ga0495603_0035588 Ga0495603_0035588_2223_2792 186
250 3300046459 Ga0495629_0005680 Ga0495629_0005680_6948_7523 186
251 3300046459 Ga0495629_0057571 Ga0495629_0057571_1317_1886 186
252 3300046492 Ga0495585_0010601 Ga0495585_0010601_2474_3043 186
253 3300046499 Ga0495594_0000468 Ga0495594_0000468_4218_4787 186
254 3300046557 Ga0495622_0064830 Ga0495622_0064830_249_818 186
255 3300046674 Ga0495588_0018518 Ga0495588_0018518_1566_2135 186
256 3300046689 Ga0495613_0001119 Ga0495613_0001119_18488_19063 186
257 3300047321 Ga0495676_0022585 Ga0495676_0022585_1318_1887 186
258 3300047321 Ga0495676_0107520 Ga0495676_0107520_1338_1913 186
259 3300047673 Ga0495593_0191464 Ga0495593_0191464_119_694 186
260 3300048089 Ga0495614_0001484 Ga0495614_0001484_8253_8828 186
261 3300048909 Ga0496106_0038793 Ga0496106_0038793_1534_2109 186
262 iso_pu_bacteria 8008485437 8008487296 186
263 iso_pu_bacteria 8025524527 8025526271 186
264 3300003323 rootH1_10089050 rootH1_100890502 187
265 3300015688 Ga0183367_1013 Ga0183367_101334 187
266 3300031838 Ga0307518_10097795 Ga0307518_100977951 187
267 3300032002 Ga0307416_101004678 Ga0307416_1010046782 187
268 3300033179 Ga0307507_10013905 Ga0307507_100139052 187
269 3300033180 Ga0307510_10063001 Ga0307510_100630012 187
270 3300046454 Ga0495592_0024488 Ga0495592_0024488_3942_4505 187
271 3300046459 Ga0495629_0021532 Ga0495629_0021532_870_1433 187
272 3300046460 Ga0495638_0030285 Ga0495638_0030285_1151_1714 187
273 3300046462 Ga0495651_0000524 Ga0495651_0000524_9548_10111 187
274 3300046473 Ga0495582_0094498 Ga0495582_0094498_797_1360 187
275 3300046476 Ga0495662_0026141 Ga0495662_0026141_59_622 187
276 3300046477 Ga0495664_0024529 Ga0495664_0024529_1498_2061 187
277 3300046499 Ga0495594_0015862 Ga0495594_0015862_1442_2005 187
278 3300046514 Ga0495618_0077144 Ga0495618_0077144_1445_2008 187
279 3300046516 Ga0495628_0035435 Ga0495628_0035435_3153_3716 187
280 3300046517 Ga0495630_0046909 Ga0495630_0046909_1482_2045 187
281 3300046529 Ga0495652_0014315 Ga0495652_0014315_1515_2078 187
282 3300046533 Ga0495640_0058705 Ga0495640_0058705_801_1364 187
283 3300046536 Ga0495587_0097654 Ga0495587_0097654_330_893 187
284 3300046543 Ga0495645_0028863 Ga0495645_0028863_1157_1720 187
285 3300046559 Ga0495667_0075833 Ga0495667_0075833_1592_2155 187
286 3300046642 Ga0495634_0021581 Ga0495634_0021581_2469_3032 187
287 3300046663 Ga0495635_0002772 Ga0495635_0002772_813_1376 187
288 3300046680 Ga0495646_0121120 Ga0495646_0121120_275_838 187
289 3300046689 Ga0495613_0010768 Ga0495613_0010768_5362_5925 187
290 3300046692 Ga0495671_0180960 Ga0495671_0180960_377_940 187
291 3300046809 Ga0495600_0029761 Ga0495600_0029761_1486_2049 187
292 3300047317 Ga0495604_0003849 Ga0495604_0003849_7068_7631 187
293 3300047321 Ga0495676_0046245 Ga0495676_0046245_330_893 187
294 3300047444 Ga0495675_0067213 Ga0495675_0067213_990_1553 187
295 3300047673 Ga0495593_0002624 Ga0495593_0002624_7228_7791 187
296 3300048089 Ga0495614_0009959 Ga0495614_0009959_2656_3219 187
297 3300049586 Ga0501070_0621979 Ga0501070_0621979_43_612 187
298 3300050490 nmdc:mga03n38_55621_c1 nmdc:mga03n38_55621_c1_1018_1587 187
299 3300053078 Ga0495612_0045745 Ga0495612_0045745_797_1360 187
300 3300053088 Ga0500644_0008353 Ga0500644_0008353_761_1324 187
301 3300053092 Ga0500583_0122951 Ga0500583_0122951_363_926 187
302 3300053095 Ga0500640_006474 Ga0500640_006474_1189_1752 187
303 3300053111 Ga0500572_004010 Ga0500572_004010_2385_2948 187
304 3300053141 Ga0500574_131006 Ga0500574_131006_121_684 187
305 3300053157 Ga0500624_006266 Ga0500624_006266_887_1450 187
306 3300002075 JGI24738J21930_10030345 JGI24738J21930_100303451 188
307 3300005331 Ga0070670_100813312 Ga0070670_1008133121 188
308 3300005458 Ga0070681_10442129 Ga0070681_104421293 188
309 3300005539 Ga0068853_100207606 Ga0068853_1002076062 188
310 3300005563 Ga0068855_100155972 Ga0068855_1001559721 188
311 3300005614 Ga0068856_100164198 Ga0068856_1001641982 188
312 3300005937 Ga0081455_10070144 Ga0081455_100701442 188
313 3300009092 Ga0105250_10054436 Ga0105250_100544362 188
314 3300009148 Ga0105243_10504521 Ga0105243_105045212 188
315 3300009551 Ga0105238_10296607 Ga0105238_102966072 188
316 3300010375 Ga0105239_10305201 Ga0105239_103052012 188
317 3300011119 Ga0105246_10050240 Ga0105246_100502402 188
318 3300013105 Ga0157369_10334693 Ga0157369_103346932 188
319 3300013307 Ga0157372_10136543 Ga0157372_101365432 188
320 3300014497 Ga0182008_10002627 Ga0182008_100026279 188
321 3300015262 Ga0182007_10001609 Ga0182007_100016093 188
322 3300025297 Ga0209758_1001931 Ga0209758_10019314 188
323 3300025904 Ga0207647_10020503 Ga0207647_100205033 188
324 3300025935 Ga0207709_10220943 Ga0207709_102209432 188
325 3300025949 Ga0207667_10239192 Ga0207667_102391922 188
326 3300026078 Ga0207702_10108022 Ga0207702_101080222 188
327 3300028794 Ga0307515_10160679 Ga0307515_101606792 188
328 3300030521 Ga0307511_10013718 Ga0307511_100137182 188
329 3300030522 Ga0307512_10002763 Ga0307512_100027638 188
330 3300030522 Ga0307512_10017744 Ga0307512_100177442 188
331 3300031456 Ga0307513_10021535 Ga0307513_100215352 188
332 3300031616 Ga0307508_10002014 Ga0307508_100020145 188
333 3300031649 Ga0307514_10064277 Ga0307514_100642771 188
334 3300031649 Ga0307514_10072822 Ga0307514_100728221 188
335 3300031838 Ga0307518_10137224 Ga0307518_101372242 188
336 3300033179 Ga0307507_10125911 Ga0307507_101259112 188
337 3300042007 Ga0439449_0070347 Ga0439449_0070347_237_803 188
338 3300042007 Ga0439449_0177399 Ga0439449_0177399_22_594 188
339 3300044656 Ga0466969_0031914 Ga0466969_0031914_1465_2034 188
340 3300044658 Ga0466972_0019186 Ga0466972_0019186_1843_2412 188
341 3300044683 Ga0466965_0002839 Ga0466965_0002839_6444_7013 188
342 3300044684 Ga0466966_0006551 Ga0466966_0006551_2017_2586 188
343 3300044693 Ga0466961_0001365 Ga0466961_0001365_12477_13046 188
344 3300044694 Ga0466963_0000146 Ga0466963_0000146_11455_12024 188
345 3300044706 Ga0466964_0049268 Ga0466964_0049268_1083_1652 188
346 3300044719 Ga0466971_0000681 Ga0466971_0000681_11009_11578 188
347 3300044735 Ga0466968_0045781 Ga0466968_0045781_769_1338 188
348 3300044765 Ga0466970_0001388 Ga0466970_0001388_9335_9904 188
349 3300044842 Ga0466957_0001009 Ga0466957_0001009_1329_1898 188
350 3300045049 Ga0466959_0001182 Ga0466959_0001182_13161_13730 188
351 3300045836 Ga0466958_0001814 Ga0466958_0001814_7894_8463 188
352 3300045976 Ga0466967_0042917 Ga0466967_0042917_3187_3756 188
353 3300046452 Ga0495617_002127 Ga0495617_002127_3893_4462 188
354 3300046453 Ga0495627_028159 Ga0495627_028159_28_597 188
355 3300046455 Ga0495603_0017077 Ga0495603_0017077_1995_2564 188
356 3300046455 Ga0495603_0020582 Ga0495603_0020582_2241_2810 188
357 3300046455 Ga0495603_0047167 Ga0495603_0047167_26_595 188
358 3300046457 Ga0495590_0044377 Ga0495590_0044377_744_1313 188
359 3300046459 Ga0495629_0041309 Ga0495629_0041309_785_1354 188
360 3300046459 Ga0495629_0063198 Ga0495629_0063198_515_1084 188
361 3300046459 Ga0495629_0143313 Ga0495629_0143313_380_949 188
362 3300046460 Ga0495638_0030724 Ga0495638_0030724_1710_2279 188
363 3300046462 Ga0495651_0113297 Ga0495651_0113297_456_1025 188
364 3300046472 Ga0495580_0218696 Ga0495580_0218696_556_1125 188
365 3300046473 Ga0495582_0366929 Ga0495582_0366929_96_665 188
366 3300046475 Ga0495639_0137359 Ga0495639_0137359_474_1043 188
367 3300046475 Ga0495639_0300097 Ga0495639_0300097_174_743 188
368 3300046476 Ga0495662_0015669 Ga0495662_0015669_2520_3089 188
369 3300046491 Ga0495584_0100974 Ga0495584_0100974_867_1436 188
370 3300046492 Ga0495585_0046284 Ga0495585_0046284_1832_2401 188
371 3300046499 Ga0495594_0281575 Ga0495594_0281575_161_730 188
372 3300046499 Ga0495594_0633655 Ga0495594_0633655_11_580 188
373 3300046501 Ga0495607_0026303 Ga0495607_0026303_10_579 188
374 3300046506 Ga0495583_0022645 Ga0495583_0022645_2323_2892 188
375 3300046506 Ga0495583_0151326 Ga0495583_0151326_232_801 188
376 3300046507 Ga0495606_0012214 Ga0495606_0012214_3366_3935 188
377 3300046515 Ga0495620_0036242 Ga0495620_0036242_297_866 188
378 3300046515 Ga0495620_0039471 Ga0495620_0039471_24_593 188
379 3300046516 Ga0495628_0094890 Ga0495628_0094890_183_752 188
380 3300046517 Ga0495630_0108400 Ga0495630_0108400_1146_1715 188
381 3300046518 Ga0495631_0012167 Ga0495631_0012167_3578_4147 188
382 3300046519 Ga0495632_0023483 Ga0495632_0023483_1018_1587 188
383 3300046520 Ga0495637_0036639 Ga0495637_0036639_1493_2062 188
384 3300046522 Ga0495643_0007025 Ga0495643_0007025_1328_1897 188
385 3300046524 Ga0495648_0038373 Ga0495648_0038373_2443_3012 188
386 3300046526 Ga0495666_0113567 Ga0495666_0113567_161_730 188
387 3300046529 Ga0495652_0137508 Ga0495652_0137508_1176_1745 188
388 3300046530 Ga0495654_0025665 Ga0495654_0025665_2418_2987 188
389 3300046533 Ga0495640_0106857 Ga0495640_0106857_1006_1575 188
390 3300046535 Ga0495586_0367594 Ga0495586_0367594_207_776 188
391 3300046538 Ga0495609_0026983 Ga0495609_0026983_465_1034 188
392 3300046542 Ga0495597_0070887 Ga0495597_0070887_47_616 188
393 3300046543 Ga0495645_0160933 Ga0495645_0160933_784_1353 188
394 3300046557 Ga0495622_0045952 Ga0495622_0045952_758_1327 188
395 3300046558 Ga0495633_0013378 Ga0495633_0013378_2162_2731 188
396 3300046615 Ga0495656_0160947 Ga0495656_0160947_408_977 188
397 3300046616 Ga0495668_0056340 Ga0495668_0056340_24_593 188
398 3300046616 Ga0495668_0083798 Ga0495668_0083798_1005_1574 188
399 3300046648 Ga0495611_0007706 Ga0495611_0007706_144_713 188
400 3300046660 Ga0495625_0151802 Ga0495625_0151802_68_637 188
401 3300046663 Ga0495635_0153361 Ga0495635_0153361_146_715 188
402 3300046663 Ga0495635_0361238 Ga0495635_0361238_360_929 188
403 3300046665 Ga0495661_0040388 Ga0495661_0040388_27_596 188
404 3300046665 Ga0495661_0414728 Ga0495661_0414728_25_594 188
405 3300046674 Ga0495588_0092994 Ga0495588_0092994_913_1482 188
406 3300046675 Ga0495657_0046358 Ga0495657_0046358_327_896 188
407 3300046679 Ga0495623_0008170 Ga0495623_0008170_3793_4362 188
408 3300046680 Ga0495646_0097325 Ga0495646_0097325_913_1482 188
409 3300046689 Ga0495613_0059758 Ga0495613_0059758_1899_2468 188
410 3300046689 Ga0495613_0061337 Ga0495613_0061337_1667_2236 188
411 3300046689 Ga0495613_0235446 Ga0495613_0235446_365_934 188
412 3300046690 Ga0495624_0324835 Ga0495624_0324835_224_793 188
413 3300046692 Ga0495671_0057429 Ga0495671_0057429_156_725 188
414 3300046692 Ga0495671_0138505 Ga0495671_0138505_172_741 188
415 3300046694 Ga0495649_0213084 Ga0495649_0213084_76_645 188
416 3300046794 Ga0495589_0012085 Ga0495589_0012085_980_1549 188
417 3300046794 Ga0495589_0053113 Ga0495589_0053113_231_800 188
418 3300046794 Ga0495589_0062162 Ga0495589_0062162_1044_1613 188
419 3300046794 Ga0495589_0164930 Ga0495589_0164930_86_655 188
420 3300046809 Ga0495600_0095120 Ga0495600_0095120_585_1154 188
421 3300046809 Ga0495600_0144635 Ga0495600_0144635_337_906 188
422 3300046810 Ga0495660_0055036 Ga0495660_0055036_1553_2122 188
423 3300047315 Ga0495581_0020124 Ga0495581_0020124_1230_1799 188
424 3300047315 Ga0495581_0051815 Ga0495581_0051815_633_1202 188
425 3300047317 Ga0495604_0057842 Ga0495604_0057842_1054_1623 188
426 3300047318 Ga0495636_0001057 Ga0495636_0001057_5193_5762 188
427 3300047318 Ga0495636_0030899 Ga0495636_0030899_294_863 188
428 3300047318 Ga0495636_0044254 Ga0495636_0044254_438_1007 188
429 3300047318 Ga0495636_0288715 Ga0495636_0288715_125_694 188
430 3300047319 Ga0495674_0053802 Ga0495674_0053802_30_599 188
431 3300047321 Ga0495676_0081552 Ga0495676_0081552_1748_2317 188
432 3300047321 Ga0495676_0202979 Ga0495676_0202979_560_1129 188
433 3300047322 Ga0495680_0003865 Ga0495680_0003865_5940_6509 188
434 3300047323 Ga0495683_0008343 Ga0495683_0008343_3430_3999 188
435 3300047443 Ga0495687_012486 Ga0495687_012486_775_1344 188
436 3300047443 Ga0495687_037187 Ga0495687_037187_653_1222 188
437 3300047444 Ga0495675_0005829 Ga0495675_0005829_1551_2120 188
438 3300047444 Ga0495675_0080016 Ga0495675_0080016_1057_1626 188
439 3300047445 Ga0495677_0027769 Ga0495677_0027769_884_1453 188
440 3300047446 Ga0495679_110422 Ga0495679_110422_113_682 188
441 3300047447 Ga0495685_009384 Ga0495685_009384_2303_2872 188
442 3300047447 Ga0495685_120976 Ga0495685_120976_267_836 188
443 3300047447 Ga0495685_124420 Ga0495685_124420_169_738 188
444 3300047470 Ga0495681_0010814 Ga0495681_0010814_432_1001 188
445 3300047471 Ga0495684_0150828 Ga0495684_0150828_1141_1710 188
446 3300047472 Ga0495686_0223975 Ga0495686_0223975_172_741 188
447 3300048088 Ga0495602_0366434 Ga0495602_0366434_410_979 188
448 3300048089 Ga0495614_0014753 Ga0495614_0014753_359_928 188
449 3300048911 Ga0496108_0069533 Ga0496108_0069533_1340_1909 188
450 3300048912 Ga0496109_0006599 Ga0496109_0006599_1810_2379 188
451 3300048916 Ga0496113_0465195 Ga0496113_0465195_255_824 188
452 3300049459 Ga0495678_108640 Ga0495678_108640_237_806 188
453 3300049570 Ga0501033_0106385 Ga0501033_0106385_795_1361 188
454 3300049571 Ga0501034_0113910 Ga0501034_0113910_1908_2474 188
455 3300049572 Ga0501036_0034621 Ga0501036_0034621_1915_2481 188
456 3300049574 Ga0501038_0003074 Ga0501038_0003074_12880_13446 188
457 3300049575 Ga0501039_0130760 Ga0501039_0130760_168_734 188
458 3300049580 Ga0501046_0188879 Ga0501046_0188879_789_1355 188
459 3300049581 Ga0501047_0017370 Ga0501047_0017370_5165_5731 188
460 3300049581 Ga0501047_0255027 Ga0501047_0255027_761_1327 188
461 3300049586 Ga0501070_0346029 Ga0501070_0346029_185_751 188
462 3300049589 Ga0501073_0056827 Ga0501073_0056827_671_1237 188
463 3300049590 Ga0501074_0333245 Ga0501074_0333245_110_676 188
464 3300049742 Ga0501080_0279684 Ga0501080_0279684_781_1347 188
465 3300049822 Ga0501035_0353943 Ga0501035_0353943_214_780 188
466 3300049822 Ga0501035_1130903 Ga0501035_1130903_14_580 188
467 3300049823 Ga0501044_0028757 Ga0501044_0028757_4315_4881 188
468 3300049823 Ga0501044_0112804 Ga0501044_0112804_1389_1955 188
469 3300049823 Ga0501044_0212606 Ga0501044_0212606_191_757 188
470 3300053149 Ga0500600_0151063 Ga0500600_0151063_377_946 188
471 3300054114 Ga0501084_1080824 Ga0501084_1080824_81_647 188
472 3300061719 Ga0466962_0030067 Ga0466962_0030067_1331_1900 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

99

165

0.85

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

92

165

0.84

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

31

156

0.78

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

55

158

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.8438 62 133
3bln-assembly1.cif.gz_A-2 crystal structure of acetyltransferase gnat family (np_981174.1) from bacillus cereus atcc 10987 at 1.31 a resolution 0.8054 15 182
3ddd-assembly1.cif.gz_A crystal structure of a putative acetyltransferase (np_142035.1) from pyrococcus horikoshii at 2.25 a resolution 0.8028 1 162
2evn-assembly1.cif.gz_A nmr solution structures of at1g77540 0.7929 73 133
2r7h-assembly1.cif.gz_A crystal structure of a putative acetyltransferase of the gnat family (dde_3044) from desulfovibrio desulfuricans subsp. at 1.85 a resolution 0.7924 15 182
ID Description Score Start End Superfamily
af_O53504_27_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9173 39 169 3.40.630.30
5i0cA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8438 62 133 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8307 108 182 3.40.630.30
af_I6YG32_8_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8263 16 181 3.40.630.30
af_I1KF23_15_150_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8133 26 180 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0C5GI21-F1-model_v4 Acetyltransferase 0.9879 14 188 GO:0016747
AF-A0A2A2ZAD7-F1-model_v4 deleted 0.9861 14 187
AF-A0A7W5F584-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9861 14 188 GO:0005840
GO:0016747
AF-A0A160P5F4-F1-model_v4 Acetyltransferase 0.9858 15 188 GO:0016747
AF-A0A4Q7WL46-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9856 14 188 GO:0016747

Feature Viewer

pLDDT pTM Quality
91.22 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map