F450950

General Info

Members Datasets Scaffolds Average Seq Length
473 194 946 225

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100029229|Ga0068869_1000292293
Length 275
Sequence MRLKRTNGPLSGGQTQSSLCEDCDRGGACQSSSDEGLVSGKRAIFFRSPFFGHLVRGALLLLLFTSVTSMIHKKTTRVVFFGDSITQQGAQPGGYIVKMKEALEKAGRGSDFDLAGAGIGGNKVYDLYLRMDEDVLAQKPDVVVIWIGVNDVWHKASSGTGTDADKFEKFYIAIINKLRDKGIKVILCTPAVIGERTDFTNMQDGDLNYYSQIIRNLAQKFKCGLVDFRETFHTYELKNNPSNKESGILTRDRVHLNDAGNQLVAEKMQEALDVK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
172 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
173 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
177 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
180 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
187 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
194 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 0.42
Rhizosphere 93.45
Stem 0
Stem Tuber 0
Unclassified 15.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100029229 3300005334 Bacteria 3860
2 rootH1_10003589 3300003316 Bacteria 10187
3 rootH1_10099811 3300003316 Bacteria 1747
4 rootH1_10148408 3300003316 Unclassified 1912
5 rootH1_10177783 3300003316 Bacteria 1297
6 rootH2_10025169 3300003320 Bacteria 31618
7 rootH2_10032300 3300003320 Bacteria 1124
8 rootH2_10051275 3300003320 Bacteria 9092
9 rootH2_10168268 3300003320 Bacteria 1823
10 rootL2_10021373 3300003322 Bacteria 13025
11 rootL2_10065549 3300003322 Unclassified 3042
12 rootL2_10112962 3300003322 Bacteria 6300
13 Ga0055536_1016116 3300003781 Bacteria 2517
14 Ga0065165_1000285 3300005262 Bacteria 86006
15 Ga0065715_10216615 3300005293 Bacteria 1290
16 Ga0065715_10257040 3300005293 Bacteria 1148
17 Ga0070658_10186998 3300005327 Bacteria 1745
18 Ga0070676_10010285 3300005328 Bacteria 5074
19 Ga0070676_10078478 3300005328 Unclassified 1998
20 Ga0070690_100011351 3300005330 Bacteria 5208
21 Ga0070670_100017041 3300005331 Bacteria 6235
22 Ga0070670_100042500 3300005331 Unclassified 3907
23 Ga0070670_100095482 3300005331 Bacteria 2557
24 Ga0070670_100187269 3300005331 Bacteria 1797
25 Ga0070677_10002957 3300005333 Bacteria 5463
26 Ga0070677_10101800 3300005333 Bacteria 1268
27 Ga0068869_100015568 3300005334 Bacteria 5106
28 Ga0068869_100081321 3300005334 Bacteria 2419
29 Ga0070666_10002958 3300005335 Bacteria 10296
30 Ga0070666_10011763 3300005335 Bacteria 5503
31 Ga0070666_10072474 3300005335 Unclassified 2345
32 Ga0070682_100047583 3300005337 Bacteria 2667
33 Ga0068868_100000524 3300005338 Bacteria 25677
34 Ga0068868_100145208 3300005338 Unclassified 1950
35 Ga0068868_100434258 3300005338 Bacteria 1139
36 Ga0068868_100494404 3300005338 Bacteria 1070
37 Ga0068868_101051770 3300005338 Bacteria 747
38 Ga0070660_100128673 3300005339 Bacteria 2025
39 Ga0070689_100015073 3300005340 Bacteria 5629
40 Ga0070661_100000686 3300005344 Bacteria 24845
41 Ga0070661_100152905 3300005344 Unclassified 1745
42 Ga0070668_100013224 3300005347 Bacteria 6156
43 Ga0070668_100715598 3300005347 Bacteria 884
44 Ga0070669_100000826 3300005353 Bacteria 22540
45 Ga0070669_100019244 3300005353 Bacteria 4876
46 Ga0070675_100235731 3300005354 Unclassified 1598
47 Ga0070675_100241887 3300005354 Unclassified 1577
48 Ga0070675_100264370 3300005354 Bacteria 1508
49 Ga0070671_100100914 3300005355 Bacteria 2421
50 Ga0070671_100239136 3300005355 Unclassified 1541
51 Ga0070671_100245630 3300005355 Unclassified 1520
52 Ga0070671_100328060 3300005355 Bacteria 1304
53 Ga0070671_100522366 3300005355 Bacteria 1022
54 Ga0070671_100524473 3300005355 Bacteria 1020
55 Ga0070674_100017342 3300005356 Bacteria 4527
56 Ga0070674_100192420 3300005356 Bacteria 1570
57 Ga0070673_100013009 3300005364 Bacteria 5738
58 Ga0070673_100020293 3300005364 Bacteria 4792
59 Ga0070673_100020477 3300005364 Bacteria 4772
60 Ga0070673_100077537 3300005364 Unclassified 2686
61 Ga0070673_100139467 3300005364 Bacteria 2044
62 Ga0070673_100246079 3300005364 Bacteria 1556
63 Ga0070688_100008621 3300005365 Bacteria 5548
64 Ga0070688_100316985 3300005365 Bacteria 1132
65 Ga0070688_100421332 3300005365 Bacteria 992
66 Ga0070659_100054983 3300005366 Bacteria 3136
67 Ga0070667_100008582 3300005367 Bacteria 8469
68 Ga0070667_100048454 3300005367 Bacteria 3576
69 Ga0070667_100057466 3300005367 Bacteria 3288
70 Ga0070663_100121274 3300005455 Unclassified 1975
71 Ga0070663_100538567 3300005455 Bacteria 974
72 Ga0070678_100022136 3300005456 Bacteria 4204
73 Ga0070678_100028413 3300005456 Bacteria 3813
74 Ga0070678_100145147 3300005456 Bacteria 1904
75 Ga0070662_100002459 3300005457 Bacteria 11410
76 Ga0070662_100211129 3300005457 Unclassified 1545
77 Ga0070662_100840514 3300005457 Unclassified 781
78 Ga0068867_100076711 3300005459 Unclassified 2510
79 Ga0068867_100094228 3300005459 Unclassified 2276
80 Ga0068867_100149063 3300005459 Unclassified 1836
81 Ga0068867_100159907 3300005459 Bacteria 1776
82 Ga0068867_100167609 3300005459 Bacteria 1737
83 Ga0070685_10078017 3300005466 Bacteria 1979
84 Ga0070684_100000433 3300005535 Bacteria 28743
85 Ga0068853_100001703 3300005539 Bacteria 16107
86 Ga0068853_100019067 3300005539 Bacteria 5683
87 Ga0068853_100052139 3300005539 Bacteria 3523
88 Ga0068853_100125315 3300005539 Bacteria 2294
89 Ga0068853_100215391 3300005539 Unclassified 1752
90 Ga0070672_100042695 3300005543 Bacteria 3492
91 Ga0070672_100087034 3300005543 Bacteria 2513
92 Ga0070672_100114529 3300005543 Bacteria 2201
93 Ga0070672_100181049 3300005543 Bacteria 1756
94 Ga0070686_100112275 3300005544 Bacteria 1859
95 Ga0070686_100246648 3300005544 Bacteria 1303
96 Ga0070686_100516565 3300005544 Bacteria 929
97 Ga0070665_100519548 3300005548 Bacteria 1202
98 Ga0068855_100448280 3300005563 Bacteria 1408
99 Ga0070664_100006889 3300005564 Bacteria 9161
100 Ga0070664_100049812 3300005564 Unclassified 3543
101 Ga0070664_100484910 3300005564 Bacteria 1138
102 Ga0070664_100693116 3300005564 Bacteria 949
103 Ga0068857_100091449 3300005577 Bacteria 2724
104 Ga0068857_100756024 3300005577 Bacteria 926
105 Ga0068854_100010925 3300005578 Bacteria 5890
106 Ga0068854_100012762 3300005578 Bacteria 5502
107 Ga0068854_100069229 3300005578 Unclassified 2576
108 Ga0068856_100072440 3300005614 Unclassified 3411
109 Ga0068856_100556472 3300005614 Bacteria 1168
110 Ga0070702_100049403 3300005615 Unclassified 2399
111 Ga0068852_100557521 3300005616 Bacteria 1147
112 Ga0068852_100635345 3300005616 Bacteria 1074
113 Ga0068852_100794153 3300005616 Bacteria 960
114 Ga0068859_100000012 3300005617 Bacteria 300376
115 Ga0068859_100019080 3300005617 Bacteria 6886
116 Ga0068859_100039433 3300005617 Bacteria 4738
117 Ga0068859_100048520 3300005617 Bacteria 4265
118 Ga0068859_100146299 3300005617 Bacteria 2438
119 Ga0068859_101088891 3300005617 Bacteria 879
120 Ga0068864_100003733 3300005618 Bacteria 12569
121 Ga0068864_100013085 3300005618 Bacteria 6873
122 Ga0068864_100014772 3300005618 Bacteria 6487
123 Ga0068864_100110781 3300005618 Bacteria 2445
124 Ga0068864_100268103 3300005618 Bacteria 1590
125 Ga0068866_10022237 3300005718 Unclassified 2932
126 Ga0068866_10065586 3300005718 Bacteria 1899
127 Ga0068861_100008364 3300005719 Bacteria 7118
128 Ga0068861_100024652 3300005719 Bacteria 4354
129 Ga0068861_100054296 3300005719 Unclassified 3052
130 Ga0068861_100156026 3300005719 Bacteria 1878
131 Ga0068861_100243813 3300005719 Bacteria 1530
132 Ga0068851_10026761 3300005834 Bacteria 2837
133 Ga0068851_10094058 3300005834 Bacteria 1582
134 Ga0068870_10012204 3300005840 Bacteria 4008
135 Ga0068870_10025414 3300005840 Bacteria 2939
136 Ga0068870_10047917 3300005840 Bacteria 2248
137 Ga0068870_10404355 3300005840 Bacteria 889
138 Ga0068863_100006838 3300005841 Bacteria 11182
139 Ga0068863_100131588 3300005841 Bacteria 2389
140 Ga0068863_100224362 3300005841 Bacteria 1811
141 Ga0068858_100004161 3300005842 Bacteria 14235
142 Ga0068858_100184423 3300005842 Bacteria 1971
143 Ga0068858_100339693 3300005842 Bacteria 1437
144 Ga0068860_100000003 3300005843 Bacteria 575741
145 Ga0068860_100000764 3300005843 Bacteria 36178
146 Ga0068860_100009954 3300005843 Bacteria 9423
147 Ga0068860_100038029 3300005843 Bacteria 4605
148 Ga0068860_100381630 3300005843 Unclassified 1391
149 Ga0068862_100053986 3300005844 Bacteria 3440
150 Ga0068862_100313470 3300005844 Bacteria 1446
151 Ga0068862_100770565 3300005844 Bacteria 937
152 Ga0081539_10001900 3300005985 Bacteria 32389
153 Ga0097621_100052822 3300006237 Bacteria 3311
154 Ga0097621_100062244 3300006237 Bacteria 3064
155 Ga0097621_100185304 3300006237 Bacteria 1800
156 Ga0097621_100445891 3300006237 Bacteria 1165
157 Ga0097621_100447323 3300006237 Bacteria 1163
158 Ga0068871_100027376 3300006358 Bacteria 4458
159 Ga0068871_100445566 3300006358 Bacteria 1160
160 Ga0068871_100491086 3300006358 Bacteria 1106
161 Ga0068871_100546354 3300006358 Bacteria 1049
162 Ga0075430_100043229 3300006846 Unclassified 3808
163 Ga0075430_100281147 3300006846 Bacteria 1377
164 Ga0075431_100092266 3300006847 Bacteria 3126
165 Ga0075429_100002958 3300006880 Bacteria 14415
166 Ga0068865_100163903 3300006881 Bacteria 1698
167 Ga0068865_100208363 3300006881 Unclassified 1522
168 Ga0097620_100000012 3300006931 Bacteria 300376
169 Ga0097620_100019082 3300006931 Bacteria 6886
170 Ga0097620_100039433 3300006931 Bacteria 4738
171 Ga0097620_100048519 3300006931 Bacteria 4265
172 Ga0097620_100094473 3300006931 Bacteria 3042
173 Ga0097620_100146296 3300006931 Bacteria 2438
174 Ga0097620_100194902 3300006931 Bacteria 2110
175 Ga0097620_101088690 3300006931 Bacteria 879
176 Ga0105240_10000896 3300009093 Bacteria 53128
177 Ga0111539_10271709 3300009094 Unclassified 1973
178 Ga0111539_10452523 3300009094 Bacteria 1495
179 Ga0111539_10829833 3300009094 Bacteria 1076
180 Ga0111539_11059369 3300009094 Bacteria 942
181 Ga0105245_10176446 3300009098 Bacteria 2038
182 Ga0105247_10002595 3300009101 Bacteria 12225
183 Ga0105247_10006777 3300009101 Bacteria 7064
184 Ga0105247_10363967 3300009101 Bacteria 1021
185 Ga0105241_10001105 3300009174 Bacteria 20534
186 Ga0105241_10001109 3300009174 Bacteria 20498
187 Ga0105241_10078254 3300009174 Bacteria 2584
188 Ga0105241_10120151 3300009174 Bacteria 2115
189 Ga0105241_10159083 3300009174 Bacteria 1855
190 Ga0105242_10013970 3300009176 Bacteria 6213
191 Ga0105242_10113791 3300009176 Unclassified 2311
192 Ga0105242_10203643 3300009176 Bacteria 1759
193 Ga0105242_10717483 3300009176 Unclassified 980
194 Ga0105237_10000362 3300009545 Bacteria 64230
195 Ga0105237_10000725 3300009545 Bacteria 45577
196 Ga0105238_10000195 3300009551 Bacteria 67049
197 Ga0105238_10435136 3300009551 Bacteria 1307
198 Ga0105249_10001211 3300009553 Bacteria 22772
199 Ga0105249_10008953 3300009553 Bacteria 8743
200 Ga0105249_10014127 3300009553 Bacteria 7058
201 Ga0105249_10085808 3300009553 Bacteria 2934
202 Ga0105249_11502478 3300009553 Bacteria 746
203 Ga0105239_10023026 3300010375 Bacteria 6867
204 Ga0105239_10142140 3300010375 Bacteria 2675
205 Ga0105239_10219310 3300010375 Bacteria 2133
206 Ga0105239_10636886 3300010375 Bacteria 1217
207 Ga0105246_10224591 3300011119 Bacteria 1474
208 Ga0157373_10172106 3300013100 Bacteria 1524
209 Ga0157371_10043483 3300013102 Bacteria 3200
210 Ga0157371_10212959 3300013102 Bacteria 1387
211 Ga0157371_10276931 3300013102 Bacteria 1211
212 Ga0157370_10058724 3300013104 Bacteria 3656
213 Ga0157370_10116298 3300013104 Unclassified 2498
214 Ga0157370_10374472 3300013104 Bacteria 1312
215 Ga0157370_10398736 3300013104 Bacteria 1266
216 Ga0157370_10436452 3300013104 Bacteria 1204
217 Ga0157370_10906464 3300013104 Bacteria 800
218 Ga0157369_11240284 3300013105 Unclassified 761
219 Ga0157374_10000013 3300013296 Bacteria 461240
220 Ga0157374_10008935 3300013296 Bacteria 8585
221 Ga0157374_10030004 3300013296 Bacteria 4934
222 Ga0157374_10098852 3300013296 Bacteria 2794
223 Ga0157374_10188773 3300013296 Bacteria 2016
224 Ga0157378_10017104 3300013297 Bacteria 6357
225 Ga0157378_10047381 3300013297 Bacteria 3822
226 Ga0157378_10051125 3300013297 Bacteria 3677
227 Ga0157378_10089328 3300013297 Bacteria 2798
228 Ga0157378_10098552 3300013297 Bacteria 2665
229 Ga0163162_10000260 3300013306 Bacteria 48090
230 Ga0163162_10000359 3300013306 Bacteria 41296
231 Ga0163162_10001117 3300013306 Bacteria 24935
232 Ga0163162_10004470 3300013306 Bacteria 13467
233 Ga0163162_10341280 3300013306 Unclassified 1630
234 Ga0163162_10661048 3300013306 Bacteria 1168
235 Ga0157372_10005219 3300013307 Bacteria 13806
236 Ga0157372_10054386 3300013307 Unclassified 4465
237 Ga0157372_10254317 3300013307 Bacteria 2039
238 Ga0157375_10010656 3300013308 Bacteria 8095
239 Ga0157375_10049983 3300013308 Bacteria 4100
240 Ga0157375_10061046 3300013308 Bacteria 3741
241 Ga0157375_10064282 3300013308 Bacteria 3653
242 Ga0157375_10125095 3300013308 Bacteria 2685
243 Ga0157375_10144141 3300013308 Bacteria 2511
244 Ga0157375_10153165 3300013308 Bacteria 2442
245 Ga0157375_10365240 3300013308 Bacteria 1610
246 Ga0163163_10069701 3300014325 Bacteria 3501
247 Ga0163163_10091728 3300014325 Bacteria 3053
248 Ga0163163_10101407 3300014325 Bacteria 2901
249 Ga0163163_10288200 3300014325 Bacteria 1694
250 Ga0163163_10289281 3300014325 Bacteria 1691
251 Ga0163163_10635450 3300014325 Bacteria 1131
252 Ga0157380_10131364 3300014326 Bacteria 2137
253 Ga0157380_10401298 3300014326 Unclassified 1301
254 Ga0157377_10023764 3300014745 Bacteria 3252
255 Ga0157377_10085820 3300014745 Unclassified 1849
256 Ga0157377_10088638 3300014745 Bacteria 1823
257 Ga0157377_10165080 3300014745 Bacteria 1380
258 Ga0157379_10006544 3300014968 Bacteria 10048
259 Ga0157379_10231856 3300014968 Unclassified 1673
260 Ga0157379_10852168 3300014968 Unclassified 862
261 Ga0157376_10027368 3300014969 Bacteria 4518
262 Ga0157376_10082898 3300014969 Bacteria 2757
263 Ga0157376_10487038 3300014969 Bacteria 1210
264 Ga0163161_10088804 3300017792 Unclassified 2285
265 Ga0163161_10657880 3300017792 Bacteria 869
266 Ga0163161_10671761 3300017792 Bacteria 860
267 Ga0213876_10018227 3300021384 Bacteria 3705
268 Ga0209455_1003961 3300025272 Bacteria 5024
269 Ga0209676_1000348 3300025292 Bacteria 87619
270 Ga0209050_1070046 3300025298 Bacteria 787
271 Ga0209257_1000005 3300025304 Bacteria 1592528
272 Ga0209257_1042589 3300025304 Bacteria 1338
273 Ga0207697_10219236 3300025315 Unclassified 839
274 Ga0207656_10038706 3300025321 Bacteria 2013
275 Ga0207656_10218442 3300025321 Bacteria 926
276 Ga0207682_10008121 3300025893 Unclassified 4162
277 Ga0207642_10017265 3300025899 Bacteria 2741
278 Ga0207710_10002918 3300025900 Bacteria 7769
279 Ga0207710_10026293 3300025900 Bacteria 2514
280 Ga0207688_10004641 3300025901 Bacteria 7487
281 Ga0207688_10037343 3300025901 Unclassified 2694
282 Ga0207680_10129560 3300025903 Unclassified 1661
283 Ga0207645_10006815 3300025907 Bacteria 8154
284 Ga0207645_10045806 3300025907 Unclassified 2795
285 Ga0207645_10255117 3300025907 Bacteria 1161
286 Ga0207643_10020309 3300025908 Bacteria 3645
287 Ga0207643_10043080 3300025908 Bacteria 2546
288 Ga0207654_10002386 3300025911 Bacteria 9612
289 Ga0207654_10050862 3300025911 Bacteria 2383
290 Ga0207654_10102486 3300025911 Unclassified 1766
291 Ga0207695_10000584 3300025913 Bacteria 73948
292 Ga0207695_10000725 3300025913 Bacteria 64078
293 Ga0207695_10022349 3300025913 Bacteria 7182
294 Ga0207695_10026921 3300025913 Bacteria 6409
295 Ga0207695_10029547 3300025913 Bacteria 6052
296 Ga0207671_10001808 3300025914 Bacteria 23903
297 Ga0207671_10004727 3300025914 Bacteria 12854
298 Ga0207671_10005353 3300025914 Bacteria 11874
299 Ga0207662_10015000 3300025918 Bacteria 4353
300 Ga0207662_10193632 3300025918 Unclassified 1313
301 Ga0207681_10015223 3300025923 Bacteria 4795
302 Ga0207681_10020575 3300025923 Bacteria 4184
303 Ga0207681_10076467 3300025923 Bacteria 2351
304 Ga0207694_10000780 3300025924 Bacteria 28623
305 Ga0207694_10005327 3300025924 Bacteria 9913
306 Ga0207694_10318302 3300025924 Bacteria 1283
307 Ga0207650_10008539 3300025925 Bacteria 6994
308 Ga0207650_10018147 3300025925 Bacteria 4934
309 Ga0207650_10114643 3300025925 Bacteria 2091
310 Ga0207650_10508949 3300025925 Bacteria 1007
311 Ga0207659_10197714 3300025926 Bacteria 1603
312 Ga0207659_10213222 3300025926 Unclassified 1549
313 Ga0207644_10022912 3300025931 Unclassified 4271
314 Ga0207644_10530505 3300025931 Bacteria 973
315 Ga0207690_10035663 3300025932 Bacteria 3215
316 Ga0207706_10066287 3300025933 Unclassified 3178
317 Ga0207686_10163121 3300025934 Bacteria 1564
318 Ga0207686_10253452 3300025934 Unclassified 1287
319 Ga0207670_10005966 3300025936 Bacteria 6726
320 Ga0207670_10037302 3300025936 Bacteria 3167
321 Ga0207669_10008664 3300025937 Bacteria 4789
322 Ga0207669_10036505 3300025937 Bacteria 2810
323 Ga0207669_10042554 3300025937 Bacteria 2652
324 Ga0207669_10329560 3300025937 Bacteria 1171
325 Ga0207704_10054868 3300025938 Bacteria 2432
326 Ga0207704_10096967 3300025938 Bacteria 1954
327 Ga0207704_10235792 3300025938 Bacteria 1364
328 Ga0207704_10574034 3300025938 Unclassified 920
329 Ga0207691_10006449 3300025940 Bacteria 11331
330 Ga0207691_10012590 3300025940 Bacteria 8109
331 Ga0207691_10028319 3300025940 Bacteria 5247
332 Ga0207691_10167748 3300025940 Bacteria 1923
333 Ga0207689_10001398 3300025942 Bacteria 23013
334 Ga0207689_10002441 3300025942 Bacteria 17314
335 Ga0207689_10009324 3300025942 Bacteria 8484
336 Ga0207689_10014010 3300025942 Bacteria 6826
337 Ga0207689_10074309 3300025942 Bacteria 2793
338 Ga0207689_10184727 3300025942 Bacteria 1720
339 Ga0207689_10351167 3300025942 Unclassified 1226
340 Ga0207661_10010722 3300025944 Bacteria 6605
341 Ga0207679_10000915 3300025945 Bacteria 18846
342 Ga0207679_10157192 3300025945 Bacteria 1858
343 Ga0207679_10524559 3300025945 Bacteria 1060
344 Ga0207667_10231165 3300025949 Bacteria 1894
345 Ga0207651_10024772 3300025960 Bacteria 3718
346 Ga0207651_10287667 3300025960 Bacteria 1361
347 Ga0207651_10451831 3300025960 Bacteria 1103
348 Ga0207712_10003924 3300025961 Bacteria 9396
349 Ga0207712_10007713 3300025961 Bacteria 6804
350 Ga0207712_10372662 3300025961 Bacteria 1192
351 Ga0207668_10049157 3300025972 Bacteria 2897
352 Ga0207668_10252728 3300025972 Bacteria 1432
353 Ga0207640_10584207 3300025981 Unclassified 943
354 Ga0207658_10114926 3300025986 Bacteria 2135
355 Ga0207658_10261851 3300025986 Bacteria 1474
356 Ga0207677_10109056 3300026023 Bacteria 2057
357 Ga0207677_10274711 3300026023 Bacteria 1380
358 Ga0207677_10456275 3300026023 Bacteria 1096
359 Ga0207703_10224602 3300026035 Unclassified 1681
360 Ga0207703_10360335 3300026035 Bacteria 1341
361 Ga0207639_10011309 3300026041 Bacteria 6195
362 Ga0207639_10047491 3300026041 Bacteria 3245
363 Ga0207639_10066591 3300026041 Bacteria 2800
364 Ga0207639_10133222 3300026041 Unclassified 2060
365 Ga0207639_10199133 3300026041 Bacteria 1716
366 Ga0207678_10249635 3300026067 Bacteria 1519
367 Ga0207702_10053370 3300026078 Unclassified 3421
368 Ga0207641_10000048 3300026088 Bacteria 178206
369 Ga0207641_10025028 3300026088 Bacteria 4922
370 Ga0207648_10000488 3300026089 Bacteria 44152
371 Ga0207648_10030714 3300026089 Bacteria 4755
372 Ga0207648_10048358 3300026089 Unclassified 3724
373 Ga0207648_10151137 3300026089 Unclassified 2049
374 Ga0207648_10218745 3300026089 Bacteria 1692
375 Ga0207648_10875481 3300026089 Bacteria 838
376 Ga0207648_10884490 3300026089 Bacteria 834
377 Ga0207648_10885062 3300026089 Bacteria 834
378 Ga0207676_10005296 3300026095 Bacteria 9136
379 Ga0207676_10029438 3300026095 Bacteria 4112
380 Ga0207676_10741817 3300026095 Unclassified 954
381 Ga0207674_10003090 3300026116 Bacteria 20578
382 Ga0207674_10068063 3300026116 Bacteria 3584
383 Ga0207674_10177122 3300026116 Bacteria 2085
384 Ga0207674_10272347 3300026116 Bacteria 1641
385 Ga0207675_100004399 3300026118 Bacteria 13609
386 Ga0207675_100027432 3300026118 Bacteria 5304
387 Ga0207675_100039964 3300026118 Bacteria 4377
388 Ga0207675_100112581 3300026118 Unclassified 2569
389 Ga0207675_100617106 3300026118 Bacteria 1089
390 Ga0207675_100772926 3300026118 Unclassified 973
391 Ga0207683_10145505 3300026121 Unclassified 2137
392 Ga0207683_10177605 3300026121 Bacteria 1930
393 Ga0207683_10182294 3300026121 Bacteria 1904
394 Ga0207698_10011219 3300026142 Bacteria 5800
395 Ga0207698_10514518 3300026142 Bacteria 1167
396 Ga0207428_10023627 3300027907 Bacteria 5166
397 Ga0207428_10096042 3300027907 Bacteria 2295
398 Ga0268266_10297146 3300028379 Bacteria 1506
399 Ga0268266_10383569 3300028379 Bacteria 1326
400 Ga0268265_10129339 3300028380 Unclassified 2095
401 Ga0268265_10165386 3300028380 Bacteria 1885
402 Ga0268265_10296485 3300028380 Bacteria 1454
403 Ga0268264_10000063 3300028381 Bacteria 301702
404 Ga0268264_10005916 3300028381 Bacteria 10353
405 Ga0268264_10010959 3300028381 Bacteria 7488
406 Ga0268264_10011650 3300028381 Bacteria 7253
407 Ga0268264_10012307 3300028381 Bacteria 7042
408 Ga0268264_10021263 3300028381 Bacteria 5300
409 Ga0268264_10049163 3300028381 Bacteria 3508
410 Ga0307517_10316885 3300028786 Bacteria 865
411 Ga0265327_10050181 3300031251 Bacteria 2185
412 Ga0307509_10037053 3300031507 Bacteria 5333
413 Ga0307509_10046897 3300031507 Bacteria 4650
414 Ga0307509_10076928 3300031507 Bacteria 3461
415 Ga0307405_10192439 3300031731 Bacteria 1474
416 Ga0307414_10253083 3300032004 Bacteria 1465
417 Ga0307510_10004246 3300033180 Bacteria 16837
418 Ga0436365_1040940 3300039437 Bacteria 11578
419 Ga0451798_0316994 3300041458 Bacteria 783
420 Ga0451807_2254113 3300041486 Bacteria 978
421 Ga0453684_0816735 3300044712 Bacteria 1004
422 Ga0466960_0026372 3300044901 Bacteria 2640
423 Ga0466960_0070424 3300044901 Bacteria 1740
424 Ga0495592_0415941 3300046454 Bacteria 849
425 Ga0495638_0000026 3300046460 Bacteria 347061
426 Ga0495594_0049267 3300046499 Bacteria 2315
427 Ga0495606_0003504 3300046507 Bacteria 16619
428 Ga0495644_0164598 3300046523 Unclassified 851
429 Ga0495652_0342267 3300046529 Bacteria 1074
430 Ga0495611_0000037 3300046648 Bacteria 101602
431 Ga0495672_0035088 3300047320 Bacteria 3091
432 Ga0501031_0004536 3300049568 Bacteria 9001
433 Ga0501033_0193498 3300049570 Bacteria 1455
434 Ga0501034_0002112 3300049571 Bacteria 24754
435 Ga0501034_0269408 3300049571 Bacteria 1644
436 Ga0501036_0001356 3300049572 Bacteria 18774
437 Ga0501036_0188187 3300049572 Unclassified 1737
438 Ga0501037_0041256 3300049573 Bacteria 3394
439 Ga0501039_0075793 3300049575 Bacteria 2615
440 Ga0501039_0151516 3300049575 Bacteria 1821
441 Ga0501043_0005661 3300049579 Bacteria 10068
442 Ga0501047_0009239 3300049581 Bacteria 9309
443 Ga0501199_003958 3300049650 Bacteria 1443
444 Ga0501202_001976 3300049652 Unclassified 3379
445 Ga0501207_009500 3300049654 Bacteria 1421
446 Ga0501217_053131 3300049661 Viruses 1064
447 Ga0501235_063320 3300049669 Unclassified 868
448 Ga0501236_000164 3300049670 Bacteria 6859
449 Ga0501247_001803 3300049677 Bacteria 2144
450 Ga0501257_003029 3300049686 Unclassified 3577
451 Ga0501257_007960 3300049686 Unclassified 2375
452 Ga0501259_005057 3300049688 Bacteria 2089
453 Ga0501219_000399 3300049703 Bacteria 7248
454 Ga0501225_0028792 3300049705 Unclassified 1526
455 Ga0501080_0600315 3300049742 Bacteria 977
456 Ga0501264_000040 3300049761 Bacteria 18495
457 Ga0501035_0027395 3300049822 Bacteria 5209
458 Ga0501035_0083413 3300049822 Bacteria 2820
459 Ga0501044_0005473 3300049823 Bacteria 14106
460 Ga0501044_0153372 3300049823 Bacteria 2285
461 Ga0501044_0432852 3300049823 Bacteria 1224
462 Ga0501226_002663 3300049853 Bacteria 2165
463 Ga0501284_00011 3300050005 Bacteria 131008
464 nmdc:mga09592_18509_c1 3300050508 Bacteria 5713
465 nmdc:mga0qj67_15330_c1 3300050509 Bacteria 5804
466 nmdc:mga0qj67_168312_c1 3300050509 Unclassified 1779
467 nmdc:mga08y16_159037_c1 3300050511 Bacteria 2347
468 nmdc:mga08y16_947321_c1 3300050511 Bacteria 844
469 Ga0500583_0242981 3300053092 Unclassified 890
470 Ga0500616_0000043 3300053153 Bacteria 342930
471 Ga0500645_020958 3300053730 Bacteria 2020
472 Ga0500645_062205 3300053730 Bacteria 1078
473 2522547775 2522125168 Bacteria 7376607
474 Ga0068869_100029229
475 rootH1_10003589
476 rootH1_10099811
477 rootH1_10148408
478 rootH1_10177783
479 rootH2_10025169
480 rootH2_10032300
481 rootH2_10051275
482 rootH2_10168268
483 rootL2_10021373
484 rootL2_10065549
485 rootL2_10112962
486 Ga0055536_1016116
487 Ga0065165_1000285
488 Ga0065715_10216615
489 Ga0065715_10257040
490 Ga0070658_10186998
491 Ga0070676_10010285
492 Ga0070676_10078478
493 Ga0070690_100011351
494 Ga0070670_100017041
495 Ga0070670_100042500
496 Ga0070670_100095482
497 Ga0070670_100187269
498 Ga0070677_10002957
499 Ga0070677_10101800
500 Ga0068869_100015568
501 Ga0068869_100081321
502 Ga0070666_10002958
503 Ga0070666_10011763
504 Ga0070666_10072474
505 Ga0070682_100047583
506 Ga0068868_100000524
507 Ga0068868_100145208
508 Ga0068868_100434258
509 Ga0068868_100494404
510 Ga0068868_101051770
511 Ga0070660_100128673
512 Ga0070689_100015073
513 Ga0070661_100000686
514 Ga0070661_100152905
515 Ga0070668_100013224
516 Ga0070668_100715598
517 Ga0070669_100000826
518 Ga0070669_100019244
519 Ga0070675_100235731
520 Ga0070675_100241887
521 Ga0070675_100264370
522 Ga0070671_100100914
523 Ga0070671_100239136
524 Ga0070671_100245630
525 Ga0070671_100328060
526 Ga0070671_100522366
527 Ga0070671_100524473
528 Ga0070674_100017342
529 Ga0070674_100192420
530 Ga0070673_100013009
531 Ga0070673_100020293
532 Ga0070673_100020477
533 Ga0070673_100077537
534 Ga0070673_100139467
535 Ga0070673_100246079
536 Ga0070688_100008621
537 Ga0070688_100316985
538 Ga0070688_100421332
539 Ga0070659_100054983
540 Ga0070667_100008582
541 Ga0070667_100048454
542 Ga0070667_100057466
543 Ga0070663_100121274
544 Ga0070663_100538567
545 Ga0070678_100022136
546 Ga0070678_100028413
547 Ga0070678_100145147
548 Ga0070662_100002459
549 Ga0070662_100211129
550 Ga0070662_100840514
551 Ga0068867_100076711
552 Ga0068867_100094228
553 Ga0068867_100149063
554 Ga0068867_100159907
555 Ga0068867_100167609
556 Ga0070685_10078017
557 Ga0070684_100000433
558 Ga0068853_100001703
559 Ga0068853_100019067
560 Ga0068853_100052139
561 Ga0068853_100125315
562 Ga0068853_100215391
563 Ga0070672_100042695
564 Ga0070672_100087034
565 Ga0070672_100114529
566 Ga0070672_100181049
567 Ga0070686_100112275
568 Ga0070686_100246648
569 Ga0070686_100516565
570 Ga0070665_100519548
571 Ga0068855_100448280
572 Ga0070664_100006889
573 Ga0070664_100049812
574 Ga0070664_100484910
575 Ga0070664_100693116
576 Ga0068857_100091449
577 Ga0068857_100756024
578 Ga0068854_100010925
579 Ga0068854_100012762
580 Ga0068854_100069229
581 Ga0068856_100072440
582 Ga0068856_100556472
583 Ga0070702_100049403
584 Ga0068852_100557521
585 Ga0068852_100635345
586 Ga0068852_100794153
587 Ga0068859_100000012
588 Ga0068859_100019080
589 Ga0068859_100039433
590 Ga0068859_100048520
591 Ga0068859_100146299
592 Ga0068859_101088891
593 Ga0068864_100003733
594 Ga0068864_100013085
595 Ga0068864_100014772
596 Ga0068864_100110781
597 Ga0068864_100268103
598 Ga0068866_10022237
599 Ga0068866_10065586
600 Ga0068861_100008364
601 Ga0068861_100024652
602 Ga0068861_100054296
603 Ga0068861_100156026
604 Ga0068861_100243813
605 Ga0068851_10026761
606 Ga0068851_10094058
607 Ga0068870_10012204
608 Ga0068870_10025414
609 Ga0068870_10047917
610 Ga0068870_10404355
611 Ga0068863_100006838
612 Ga0068863_100131588
613 Ga0068863_100224362
614 Ga0068858_100004161
615 Ga0068858_100184423
616 Ga0068858_100339693
617 Ga0068860_100000003
618 Ga0068860_100000764
619 Ga0068860_100009954
620 Ga0068860_100038029
621 Ga0068860_100381630
622 Ga0068862_100053986
623 Ga0068862_100313470
624 Ga0068862_100770565
625 Ga0081539_10001900
626 Ga0097621_100052822
627 Ga0097621_100062244
628 Ga0097621_100185304
629 Ga0097621_100445891
630 Ga0097621_100447323
631 Ga0068871_100027376
632 Ga0068871_100445566
633 Ga0068871_100491086
634 Ga0068871_100546354
635 Ga0075430_100043229
636 Ga0075430_100281147
637 Ga0075431_100092266
638 Ga0075429_100002958
639 Ga0068865_100163903
640 Ga0068865_100208363
641 Ga0097620_100000012
642 Ga0097620_100019082
643 Ga0097620_100039433
644 Ga0097620_100048519
645 Ga0097620_100094473
646 Ga0097620_100146296
647 Ga0097620_100194902
648 Ga0097620_101088690
649 Ga0105240_10000896
650 Ga0111539_10271709
651 Ga0111539_10452523
652 Ga0111539_10829833
653 Ga0111539_11059369
654 Ga0105245_10176446
655 Ga0105247_10002595
656 Ga0105247_10006777
657 Ga0105247_10363967
658 Ga0105241_10001105
659 Ga0105241_10001109
660 Ga0105241_10078254
661 Ga0105241_10120151
662 Ga0105241_10159083
663 Ga0105242_10013970
664 Ga0105242_10113791
665 Ga0105242_10203643
666 Ga0105242_10717483
667 Ga0105237_10000362
668 Ga0105237_10000725
669 Ga0105238_10000195
670 Ga0105238_10435136
671 Ga0105249_10001211
672 Ga0105249_10008953
673 Ga0105249_10014127
674 Ga0105249_10085808
675 Ga0105249_11502478
676 Ga0105239_10023026
677 Ga0105239_10142140
678 Ga0105239_10219310
679 Ga0105239_10636886
680 Ga0105246_10224591
681 Ga0157373_10172106
682 Ga0157371_10043483
683 Ga0157371_10212959
684 Ga0157371_10276931
685 Ga0157370_10058724
686 Ga0157370_10116298
687 Ga0157370_10374472
688 Ga0157370_10398736
689 Ga0157370_10436452
690 Ga0157370_10906464
691 Ga0157369_11240284
692 Ga0157374_10000013
693 Ga0157374_10008935
694 Ga0157374_10030004
695 Ga0157374_10098852
696 Ga0157374_10188773
697 Ga0157378_10017104
698 Ga0157378_10047381
699 Ga0157378_10051125
700 Ga0157378_10089328
701 Ga0157378_10098552
702 Ga0163162_10000260
703 Ga0163162_10000359
704 Ga0163162_10001117
705 Ga0163162_10004470
706 Ga0163162_10341280
707 Ga0163162_10661048
708 Ga0157372_10005219
709 Ga0157372_10054386
710 Ga0157372_10254317
711 Ga0157375_10010656
712 Ga0157375_10049983
713 Ga0157375_10061046
714 Ga0157375_10064282
715 Ga0157375_10125095
716 Ga0157375_10144141
717 Ga0157375_10153165
718 Ga0157375_10365240
719 Ga0163163_10069701
720 Ga0163163_10091728
721 Ga0163163_10101407
722 Ga0163163_10288200
723 Ga0163163_10289281
724 Ga0163163_10635450
725 Ga0157380_10131364
726 Ga0157380_10401298
727 Ga0157377_10023764
728 Ga0157377_10085820
729 Ga0157377_10088638
730 Ga0157377_10165080
731 Ga0157379_10006544
732 Ga0157379_10231856
733 Ga0157379_10852168
734 Ga0157376_10027368
735 Ga0157376_10082898
736 Ga0157376_10487038
737 Ga0163161_10088804
738 Ga0163161_10657880
739 Ga0163161_10671761
740 Ga0213876_10018227
741 Ga0209455_1003961
742 Ga0209676_1000348
743 Ga0209050_1070046
744 Ga0209257_1000005
745 Ga0209257_1042589
746 Ga0207697_10219236
747 Ga0207656_10038706
748 Ga0207656_10218442
749 Ga0207682_10008121
750 Ga0207642_10017265
751 Ga0207710_10002918
752 Ga0207710_10026293
753 Ga0207688_10004641
754 Ga0207688_10037343
755 Ga0207680_10129560
756 Ga0207645_10006815
757 Ga0207645_10045806
758 Ga0207645_10255117
759 Ga0207643_10020309
760 Ga0207643_10043080
761 Ga0207654_10002386
762 Ga0207654_10050862
763 Ga0207654_10102486
764 Ga0207695_10000584
765 Ga0207695_10000725
766 Ga0207695_10022349
767 Ga0207695_10026921
768 Ga0207695_10029547
769 Ga0207671_10001808
770 Ga0207671_10004727
771 Ga0207671_10005353
772 Ga0207662_10015000
773 Ga0207662_10193632
774 Ga0207681_10015223
775 Ga0207681_10020575
776 Ga0207681_10076467
777 Ga0207694_10000780
778 Ga0207694_10005327
779 Ga0207694_10318302
780 Ga0207650_10008539
781 Ga0207650_10018147
782 Ga0207650_10114643
783 Ga0207650_10508949
784 Ga0207659_10197714
785 Ga0207659_10213222
786 Ga0207644_10022912
787 Ga0207644_10530505
788 Ga0207690_10035663
789 Ga0207706_10066287
790 Ga0207686_10163121
791 Ga0207686_10253452
792 Ga0207670_10005966
793 Ga0207670_10037302
794 Ga0207669_10008664
795 Ga0207669_10036505
796 Ga0207669_10042554
797 Ga0207669_10329560
798 Ga0207704_10054868
799 Ga0207704_10096967
800 Ga0207704_10235792
801 Ga0207704_10574034
802 Ga0207691_10006449
803 Ga0207691_10012590
804 Ga0207691_10028319
805 Ga0207691_10167748
806 Ga0207689_10001398
807 Ga0207689_10002441
808 Ga0207689_10009324
809 Ga0207689_10014010
810 Ga0207689_10074309
811 Ga0207689_10184727
812 Ga0207689_10351167
813 Ga0207661_10010722
814 Ga0207679_10000915
815 Ga0207679_10157192
816 Ga0207679_10524559
817 Ga0207667_10231165
818 Ga0207651_10024772
819 Ga0207651_10287667
820 Ga0207651_10451831
821 Ga0207712_10003924
822 Ga0207712_10007713
823 Ga0207712_10372662
824 Ga0207668_10049157
825 Ga0207668_10252728
826 Ga0207640_10584207
827 Ga0207658_10114926
828 Ga0207658_10261851
829 Ga0207677_10109056
830 Ga0207677_10274711
831 Ga0207677_10456275
832 Ga0207703_10224602
833 Ga0207703_10360335
834 Ga0207639_10011309
835 Ga0207639_10047491
836 Ga0207639_10066591
837 Ga0207639_10133222
838 Ga0207639_10199133
839 Ga0207678_10249635
840 Ga0207702_10053370
841 Ga0207641_10000048
842 Ga0207641_10025028
843 Ga0207648_10000488
844 Ga0207648_10030714
845 Ga0207648_10048358
846 Ga0207648_10151137
847 Ga0207648_10218745
848 Ga0207648_10875481
849 Ga0207648_10884490
850 Ga0207648_10885062
851 Ga0207676_10005296
852 Ga0207676_10029438
853 Ga0207676_10741817
854 Ga0207674_10003090
855 Ga0207674_10068063
856 Ga0207674_10177122
857 Ga0207674_10272347
858 Ga0207675_100004399
859 Ga0207675_100027432
860 Ga0207675_100039964
861 Ga0207675_100112581
862 Ga0207675_100617106
863 Ga0207675_100772926
864 Ga0207683_10145505
865 Ga0207683_10177605
866 Ga0207683_10182294
867 Ga0207698_10011219
868 Ga0207698_10514518
869 Ga0207428_10023627
870 Ga0207428_10096042
871 Ga0268266_10297146
872 Ga0268266_10383569
873 Ga0268265_10129339
874 Ga0268265_10165386
875 Ga0268265_10296485
876 Ga0268264_10000063
877 Ga0268264_10005916
878 Ga0268264_10010959
879 Ga0268264_10011650
880 Ga0268264_10012307
881 Ga0268264_10021263
882 Ga0268264_10049163
883 Ga0307517_10316885
884 Ga0265327_10050181
885 Ga0307509_10037053
886 Ga0307509_10046897
887 Ga0307509_10076928
888 Ga0307405_10192439
889 Ga0307414_10253083
890 Ga0307510_10004246
891 Ga0436365_1040940
892 Ga0451798_0316994
893 Ga0451807_2254113
894 Ga0453684_0816735
895 Ga0466960_0026372
896 Ga0466960_0070424
897 Ga0495592_0415941
898 Ga0495638_0000026
899 Ga0495594_0049267
900 Ga0495606_0003504
901 Ga0495644_0164598
902 Ga0495652_0342267
903 Ga0495611_0000037
904 Ga0495672_0035088
905 Ga0501031_0004536
906 Ga0501033_0193498
907 Ga0501034_0002112
908 Ga0501034_0269408
909 Ga0501036_0001356
910 Ga0501036_0188187
911 Ga0501037_0041256
912 Ga0501039_0075793
913 Ga0501039_0151516
914 Ga0501043_0005661
915 Ga0501047_0009239
916 Ga0501199_003958
917 Ga0501202_001976
918 Ga0501207_009500
919 Ga0501217_053131
920 Ga0501235_063320
921 Ga0501236_000164
922 Ga0501247_001803
923 Ga0501257_003029
924 Ga0501257_007960
925 Ga0501259_005057
926 Ga0501219_000399
927 Ga0501225_0028792
928 Ga0501080_0600315
929 Ga0501264_000040
930 Ga0501035_0027395
931 Ga0501035_0083413
932 Ga0501044_0005473
933 Ga0501044_0153372
934 Ga0501044_0432852
935 Ga0501226_002663
936 Ga0501284_00011
937 nmdc:mga09592_18509_c1
938 nmdc:mga0qj67_15330_c1
939 nmdc:mga0qj67_168312_c1
940 nmdc:mga08y16_159037_c1
941 nmdc:mga08y16_947321_c1
942 Ga0500583_0242981
943 Ga0500616_0000043
944 Ga0500645_020958
945 Ga0500645_062205
946 2522547775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13472

Lipase_GDSL_2

GDSL-like Lipase/Acylhydrolase family

80

263

0.85

PF00657

Lipase_GDSL

GDSL-like Lipase/Acylhydrolase

78

268

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ddy-assembly1.cif.gz_D crystal structure of an acetyl xylan esterase alaxease 0.9572 26 219
7ddy-assembly1.cif.gz_D crystal structure of an acetyl xylan esterase alaxease 0.9338 26 219
5bn1-assembly1.cif.gz_A structure of axe2-w215i, an acetyl xylan esterase from geobacillus stearothermophilus 0.8501 20 221
4oao-assembly1.cif.gz_B a mutant of axe2 (r55a), and acetyl-xylooligosaccharide esterase from geobacillus stearmophilus 0.8497 22 221
4jko-assembly1.cif.gz_A crystal structure of a catalytic mutant of axe2 (axe2_s15a), an acetylxylan esterase from geobacillus stearothermophilus 0.8471 22 221
ID Description Score Start End Superfamily
4jggB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8216 25 225 3.40.50.1110
4jggB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8174 25 225 3.40.50.1110
af_A0A2R8QJS0_198_300_3.40.50.12700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.817 111 224 3.40.50.12700
1yzfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8108 25 223 3.40.50.1110
af_A0A2R8QJS0_198_300_3.40.50.12700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8097 111 224 3.40.50.12700
ID Description Score Start End GO Terms
AF-A0A6N4EIY3-F1-model_v4 deleted 0.9928 122 224
AF-A0A6N4EIY3-F1-model_v4 deleted 0.974 122 224
AF-A0A521G9V8-F1-model_v4 G-D-S-L family lipolytic protein 0.9688 19 219 GO:0004622
AF-A0A4Q1D4A3-F1-model_v4 DUF459 domain-containing protein 0.966 19 222 GO:0004622
AF-R9GUS7-F1-model_v4 Lipase/acylhydrolase family protein 0.9643 19 221 GO:0004622

Map