F450956

General Info

Members Datasets Scaffolds Average Seq Length
473 184 473 108

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100582300|Ga0070675_1005823002
Length 117
Sequence MPGSLMTEPKQINFTIVPEDPDPQDSSTSKREYANFCAVAHTPFDLTLTFCDVRPLSERDVKSAEANQTVRAPVVSRIALPFAVVPGLIAALQEQMRAVQEAQAAQTPVNWPKGPLH

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
111 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
157 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
158 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
159 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
160 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
161 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
162 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
168 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 1.06
Rhizosphere 97.46
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10344253 3300005289 Bacteria 819
2 Ga0065712_10155832 3300005290 Bacteria 1336
3 Ga0065712_10261990 3300005290 Bacteria 935
4 Ga0065712_10368332 3300005290 Bacteria 766
5 Ga0065715_10093446 3300005293 Bacteria 4667
6 Ga0065715_10164551 3300005293 Bacteria 1598
7 Ga0065715_10362048 3300005293 Bacteria 934
8 Ga0065707_10000711 3300005295 Bacteria 16357
9 Ga0065707_10559015 3300005295 Bacteria 716
10 Ga0065707_10757287 3300005295 Bacteria 616
11 Ga0070670_100316747 3300005331 Bacteria 1366
12 Ga0070670_100451754 3300005331 Bacteria 1139
13 Ga0070670_101679230 3300005331 Bacteria 584
14 Ga0070677_10505383 3300005333 Unclassified 656
15 Ga0070677_10622797 3300005333 Bacteria 600
16 Ga0068869_100265207 3300005334 Bacteria 1376
17 Ga0070680_100322195 3300005336 Bacteria 1312
18 Ga0068868_101037508 3300005338 Unclassified 752
19 Ga0070689_100118937 3300005340 Bacteria 2109
20 Ga0070689_101299618 3300005340 Unclassified 655
21 Ga0070689_101509741 3300005340 Bacteria 609
22 Ga0070692_10966790 3300005345 Unclassified 593
23 Ga0070668_100160710 3300005347 Bacteria 1823
24 Ga0070669_100020555 3300005353 Bacteria 4715
25 Ga0070669_100365563 3300005353 Bacteria 1174
26 Ga0070669_101120958 3300005353 Unclassified 678
27 Ga0070669_101451280 3300005353 Unclassified 596
28 Ga0070675_100295224 3300005354 Unclassified 1427
29 Ga0070675_100350590 3300005354 Bacteria 1309
30 Ga0070675_100394982 3300005354 Bacteria 1233
31 Ga0070675_100582300 3300005354 Unclassified 1014
32 Ga0070675_101914378 3300005354 Unclassified 547
33 Ga0070674_100127242 3300005356 Bacteria 1894
34 Ga0070674_100443409 3300005356 Unclassified 1070
35 Ga0070673_100520082 3300005364 Bacteria 1078
36 Ga0070673_100862370 3300005364 Bacteria 838
37 Ga0070688_100089406 3300005365 Bacteria 2009
38 Ga0070688_100103296 3300005365 Bacteria 1883
39 Ga0070688_100554456 3300005365 Bacteria 874
40 Ga0070667_100206616 3300005367 Bacteria 1744
41 Ga0070703_10030749 3300005406 Bacteria 1620
42 Ga0070703_10105413 3300005406 Bacteria 1000
43 Ga0070701_10220153 3300005438 Bacteria 1132
44 Ga0070700_100522966 3300005441 Bacteria 917
45 Ga0070700_100678281 3300005441 Bacteria 817
46 Ga0070700_100966343 3300005441 Bacteria 698
47 Ga0070700_101276713 3300005441 Bacteria 616
48 Ga0070694_101174938 3300005444 Bacteria 642
49 Ga0070708_100738640 3300005445 Bacteria 926
50 Ga0070678_100754708 3300005456 Unclassified 880
51 Ga0070662_100287132 3300005457 Bacteria 1333
52 Ga0068867_100045926 3300005459 Bacteria 3206
53 Ga0070707_100162935 3300005468 Bacteria 2173
54 Ga0070684_100906840 3300005535 Bacteria 826
55 Ga0068853_101902336 3300005539 Unclassified 577
56 Ga0070686_100088057 3300005544 Bacteria 2071
57 Ga0070695_100117770 3300005545 Bacteria 1813
58 Ga0070695_101541166 3300005545 Bacteria 554
59 Ga0070665_100767668 3300005548 Bacteria 977
60 Ga0070665_101949574 3300005548 Unclassified 593
61 Ga0070704_100059365 3300005549 Bacteria 2729
62 Ga0070704_100077801 3300005549 Bacteria 2431
63 Ga0070704_100356563 3300005549 Bacteria 1236
64 Ga0070704_100829043 3300005549 Bacteria 828
65 Ga0068854_100645967 3300005578 Bacteria 908
66 Ga0068852_102373491 3300005616 Bacteria 551
67 Ga0068859_100004386 3300005617 Bacteria 14390
68 Ga0068859_100206163 3300005617 Bacteria 2051
69 Ga0068859_100259160 3300005617 Bacteria 1830
70 Ga0068859_100274723 3300005617 Bacteria 1777
71 Ga0068859_101700340 3300005617 Unclassified 697
72 Ga0068859_102579831 3300005617 Unclassified 559
73 Ga0068859_102886512 3300005617 Bacteria 527
74 Ga0068861_100218789 3300005719 Bacteria 1608
75 Ga0068861_100229287 3300005719 Bacteria 1574
76 Ga0068861_100310529 3300005719 Unclassified 1369
77 Ga0068870_10110085 3300005840 Bacteria 1571
78 Ga0068863_100777848 3300005841 Bacteria 954
79 Ga0068863_101213735 3300005841 Bacteria 760
80 Ga0068858_100308544 3300005842 Bacteria 1511
81 Ga0068860_100124497 3300005843 Bacteria 2471
82 Ga0068860_100184273 3300005843 Unclassified 2018
83 Ga0068862_100588191 3300005844 Bacteria 1067
84 Ga0068862_100755352 3300005844 Bacteria 946
85 Ga0068862_100925842 3300005844 Bacteria 858
86 Ga0075363_100821135 3300006048 Unclassified 566
87 Ga0075367_10005554 3300006178 Bacteria 6280
88 Ga0075366_10038270 3300006195 Bacteria 2833
89 Ga0075366_10414622 3300006195 Unclassified 829
90 Ga0097621_100204832 3300006237 Bacteria 1714
91 Ga0068871_100947528 3300006358 Bacteria 800
92 Ga0068871_101120372 3300006358 Unclassified 736
93 Ga0075428_100000010 3300006844 Bacteria 213631
94 Ga0075428_102202099 3300006844 Bacteria 569
95 Ga0075433_10089844 3300006852 Bacteria 2715
96 Ga0075433_10436283 3300006852 Bacteria 1155
97 Ga0075429_101088051 3300006880 Bacteria 698
98 Ga0068865_102146427 3300006881 Unclassified 508
99 Ga0097620_100004386 3300006931 Bacteria 14390
100 Ga0097620_100206164 3300006931 Bacteria 2051
101 Ga0097620_100259164 3300006931 Bacteria 1830
102 Ga0097620_100274717 3300006931 Bacteria 1777
103 Ga0097620_101700536 3300006931 Unclassified 697
104 Ga0097620_102581190 3300006931 Unclassified 559
105 Ga0097620_102886557 3300006931 Bacteria 527
106 Ga0075435_100085533 3300007076 Bacteria 2596
107 Ga0111539_10000001 3300009094 Bacteria 1035431
108 Ga0111539_10014318 3300009094 Bacteria 9904
109 Ga0111539_10048898 3300009094 Bacteria 5048
110 Ga0111539_10200407 3300009094 Bacteria 2328
111 Ga0111539_10448985 3300009094 Bacteria 1501
112 Ga0111539_10458551 3300009094 Unclassified 1484
113 Ga0111539_11007087 3300009094 Bacteria 969
114 Ga0114129_12470777 3300009147 Bacteria 621
115 Ga0105243_11696228 3300009148 Unclassified 661
116 Ga0105242_12025187 3300009176 Unclassified 618
117 Ga0105242_12046078 3300009176 Bacteria 616
118 Ga0105242_12646308 3300009176 Unclassified 551
119 Ga0105248_11020071 3300009177 Bacteria 935
120 Ga0105248_13312226 3300009177 Unclassified 512
121 Ga0105249_10187968 3300009553 Bacteria 2014
122 Ga0105249_10283009 3300009553 Bacteria 1657
123 Ga0105249_11043369 3300009553 Bacteria 887
124 Ga0105249_11555194 3300009553 Unclassified 734
125 Ga0105249_12495256 3300009553 Unclassified 589
126 Ga0163162_10564305 3300013306 Bacteria 1266
127 Ga0163163_10000011 3300014325 Bacteria 264399
128 Ga0157380_10042450 3300014326 Bacteria 3555
129 Ga0157380_10099635 3300014326 Bacteria 2417
130 Ga0157380_10346978 3300014326 Bacteria 1387
131 Ga0157380_10773869 3300014326 Bacteria 974
132 Ga0157380_10993105 3300014326 Bacteria 872
133 Ga0157380_11078505 3300014326 Bacteria 841
134 Ga0157380_11403677 3300014326 Bacteria 749
135 Ga0157380_11435377 3300014326 Bacteria 741
136 Ga0207653_10131922 3300025885 Bacteria 907
137 Ga0207682_10026896 3300025893 Bacteria 2289
138 Ga0207688_10882883 3300025901 Bacteria 566
139 Ga0207643_10247341 3300025908 Bacteria 1098
140 Ga0207684_10299070 3300025910 Bacteria 1387
141 Ga0207646_10093021 3300025922 Bacteria 2699
142 Ga0207681_10039083 3300025923 Bacteria 3148
143 Ga0207681_10855984 3300025923 Unclassified 760
144 Ga0207681_11760146 3300025923 Unclassified 517
145 Ga0207681_11772613 3300025923 Unclassified 515
146 Ga0207650_10078978 3300025925 Bacteria 2491
147 Ga0207650_10410230 3300025925 Bacteria 1123
148 Ga0207659_10094851 3300025926 Bacteria 2236
149 Ga0207659_10223734 3300025926 Bacteria 1514
150 Ga0207659_10733643 3300025926 Bacteria 847
151 Ga0207706_10533746 3300025933 Bacteria 1011
152 Ga0207670_10456856 3300025936 Bacteria 1031
153 Ga0207670_11095240 3300025936 Unclassified 672
154 Ga0207669_10185573 3300025937 Bacteria 1495
155 Ga0207711_10021872 3300025941 Bacteria 5342
156 Ga0207711_10312553 3300025941 Bacteria 1451
157 Ga0207711_11278687 3300025941 Unclassified 676
158 Ga0207711_11994932 3300025941 Unclassified 523
159 Ga0207689_10843502 3300025942 Bacteria 773
160 Ga0207651_11280645 3300025960 Bacteria 659
161 Ga0207712_10167289 3300025961 Bacteria 1715
162 Ga0207712_10311596 3300025961 Bacteria 1295
163 Ga0207712_11386166 3300025961 Unclassified 629
164 Ga0207668_10426127 3300025972 Bacteria 1127
165 Ga0207668_10626692 3300025972 Bacteria 939
166 Ga0207658_10166550 3300025986 Bacteria 1811
167 Ga0207677_11289403 3300026023 Unclassified 671
168 Ga0207703_10543232 3300026035 Bacteria 1095
169 Ga0207708_10186508 3300026075 Bacteria 1649
170 Ga0207708_10825206 3300026075 Bacteria 799
171 Ga0207675_100216116 3300026118 Unclassified 1846
172 Ga0207675_100348925 3300026118 Bacteria 1450
173 Ga0207675_100839603 3300026118 Bacteria 933
174 Ga0207428_10000002 3300027907 Bacteria 854851
175 Ga0207428_10017090 3300027907 Bacteria 6233
176 Ga0207428_10075171 3300027907 Bacteria 2648
177 Ga0207428_10852132 3300027907 Bacteria 645
178 Ga0268266_11479658 3300028379 Bacteria 655
179 Ga0268265_10624147 3300028380 Bacteria 1033
180 Ga0268265_10966379 3300028380 Unclassified 840
181 Ga0268265_11039165 3300028380 Bacteria 811
182 Ga0268264_10093130 3300028381 Unclassified 2602
183 Ga0268264_10165453 3300028381 Bacteria 1996
184 Ga0268264_12098535 3300028381 Unclassified 574
185 Ga0268264_12105186 3300028381 Bacteria 573
186 Ga0307408_100032664 3300031548 Bacteria 3630
187 Ga0307408_100049179 3300031548 Bacteria 3027
188 Ga0307408_100052776 3300031548 Bacteria 2934
189 Ga0307408_100241301 3300031548 Bacteria 1485
190 Ga0307405_10107905 3300031731 Bacteria 1880
191 Ga0307405_10329053 3300031731 Bacteria 1170
192 Ga0307405_10825724 3300031731 Unclassified 778
193 Ga0307413_10054878 3300031824 Bacteria 2420
194 Ga0307413_10345375 3300031824 Bacteria 1146
195 Ga0307413_10416747 3300031824 Bacteria 1057
196 Ga0307410_10164597 3300031852 Bacteria 1665
197 Ga0307410_10264308 3300031852 Bacteria 1343
198 Ga0307410_10922886 3300031852 Bacteria 749
199 Ga0307406_10146266 3300031901 Bacteria 1680
200 Ga0307407_10079170 3300031903 Bacteria 1982
201 Ga0307407_11393117 3300031903 Unclassified 552
202 Ga0307412_10087440 3300031911 Bacteria 2171
203 Ga0307412_10152083 3300031911 Bacteria 1709
204 Ga0307412_10447045 3300031911 Bacteria 1064
205 Ga0307412_10482829 3300031911 Unclassified 1028
206 Ga0307412_10517053 3300031911 Bacteria 997
207 Ga0307409_100061792 3300031995 Bacteria 2929
208 Ga0307409_100131252 3300031995 Bacteria 2141
209 Ga0307409_100179559 3300031995 Bacteria 1872
210 Ga0307416_100040904 3300032002 Bacteria 3606
211 Ga0307416_100106013 3300032002 Bacteria 2462
212 Ga0307416_100155164 3300032002 Bacteria 2106
213 Ga0307416_100921856 3300032002 Unclassified 974
214 Ga0307416_101541449 3300032002 Bacteria 770
215 Ga0307416_101566606 3300032002 Bacteria 764
216 Ga0307416_101700428 3300032002 Bacteria 736
217 Ga0307411_10047228 3300032005 Bacteria 2782
218 Ga0307411_10879973 3300032005 Unclassified 794
219 Ga0307411_11585886 3300032005 Bacteria 604
220 Ga0307415_102006312 3300032126 Unclassified 563
221 Ga0373934_0000878 3300035086 Bacteria 10850
222 Ga0373953_0044489 3300035117 Bacteria 1775
223 Ga0373956_0004818 3300035119 Bacteria 5398
224 Ga0373956_0044495 3300035119 Bacteria 1979
225 Ga0373956_0602839 3300035119 Bacteria 524
226 Ga0373957_0138855 3300035120 Bacteria 992
227 Ga0373955_0001450 3300035172 Bacteria 10076
228 Ga0373933_0084435 3300035724 Bacteria 1951
229 Ga0373947_0510972 3300035725 Bacteria 817
230 Ga0373937_0000867 3300036401 Bacteria 26012
231 Ga0373937_1226220 3300036401 Unclassified 698
232 Ga0451807_0417392 3300041486 Unclassified 650
233 Ga0451853_2114990 3300041512 Unclassified 636
234 Ga0450920_062702 3300042122 Unclassified 752
235 Ga0439459_0114381 3300042438 Bacteria 674
236 Ga0453683_0157120 3300044673 Bacteria 1438
237 Ga0451576_0007100 3300045051 Bacteria 13523
238 Ga0466967_1492054 3300045976 Bacteria 673
239 Ga0495592_0101022 3300046454 Bacteria 2056
240 Ga0495592_0122778 3300046454 Bacteria 1825
241 Ga0495592_0538234 3300046454 Bacteria 720
242 Ga0495641_0283648 3300046461 Bacteria 746
243 Ga0495651_0752119 3300046462 Unclassified 604
244 Ga0495587_0237549 3300046536 Bacteria 1026
245 Ga0495587_0465882 3300046536 Bacteria 700
246 Ga0495587_0614165 3300046536 Bacteria 598
247 Ga0495598_0204131 3300046537 Bacteria 715
248 Ga0495621_0052358 3300046539 Bacteria 1463
249 Ga0495645_0231205 3300046543 Bacteria 1238
250 Ga0495656_0046437 3300046615 Bacteria 1838
251 Ga0495599_0088202 3300046678 Bacteria 1937
252 Ga0495599_0725915 3300046678 Bacteria 571
253 Ga0495684_0746838 3300047471 Bacteria 644
254 Ga0496102_0758915 3300048905 Bacteria 893
255 Ga0496106_0796231 3300048909 Bacteria 750
256 Ga0496110_0702028 3300048913 Bacteria 913
257 Ga0496114_1586337 3300048917 Unclassified 542
258 Ga0501298_072198 3300049521 Unclassified 747
259 Ga0501031_0013288 3300049568 Bacteria 5373
260 Ga0501031_0782590 3300049568 Bacteria 612
261 Ga0501032_0005211 3300049569 Bacteria 9673
262 Ga0501032_0005991 3300049569 Bacteria 8969
263 Ga0501032_0080911 3300049569 Bacteria 2161
264 Ga0501032_0081965 3300049569 Bacteria 2146
265 Ga0501033_0003267 3300049570 Bacteria 13417
266 Ga0501033_0006579 3300049570 Bacteria 9090
267 Ga0501033_0018774 3300049570 Bacteria 5226
268 Ga0501033_0417766 3300049570 Bacteria 934
269 Ga0501033_0420350 3300049570 Bacteria 931
270 Ga0501033_0812153 3300049570 Bacteria 632
271 Ga0501034_0002713 3300049571 Bacteria 20857
272 Ga0501034_0007399 3300049571 Bacteria 11692
273 Ga0501034_0012642 3300049571 Bacteria 8710
274 Ga0501034_0024299 3300049571 Bacteria 6163
275 Ga0501034_0149414 3300049571 Bacteria 2312
276 Ga0501034_0238654 3300049571 Bacteria 1764
277 Ga0501034_0621240 3300049571 Bacteria 984
278 Ga0501036_0004139 3300049572 Bacteria 11667
279 Ga0501036_0008367 3300049572 Bacteria 8477
280 Ga0501036_0021561 3300049572 Bacteria 5416
281 Ga0501036_0022618 3300049572 Bacteria 5289
282 Ga0501036_0094108 3300049572 Bacteria 2532
283 Ga0501036_0231547 3300049572 Bacteria 1550
284 Ga0501036_1105352 3300049572 Unclassified 647
285 Ga0501036_1609633 3300049572 Unclassified 524
286 Ga0501037_0002251 3300049573 Bacteria 13948
287 Ga0501037_0025602 3300049573 Bacteria 4359
288 Ga0501037_0048350 3300049573 Bacteria 3118
289 Ga0501037_0074856 3300049573 Bacteria 2459
290 Ga0501037_0139243 3300049573 Bacteria 1737
291 Ga0501037_0343967 3300049573 Bacteria 1030
292 Ga0501037_0572743 3300049573 Bacteria 760
293 Ga0501038_0001132 3300049574 Bacteria 24183
294 Ga0501038_0016576 3300049574 Bacteria 6679
295 Ga0501038_0061632 3300049574 Bacteria 3207
296 Ga0501038_0104093 3300049574 Bacteria 2359
297 Ga0501038_0146525 3300049574 Bacteria 1927
298 Ga0501038_0454707 3300049574 Unclassified 984
299 Ga0501038_0480223 3300049574 Bacteria 952
300 Ga0501039_0003636 3300049575 Bacteria 11554
301 Ga0501039_0006632 3300049575 Bacteria 8795
302 Ga0501039_0032267 3300049575 Bacteria 4038
303 Ga0501039_1083770 3300049575 Bacteria 621
304 Ga0501040_0281752 3300049576 Bacteria 1187
305 Ga0501040_0416202 3300049576 Bacteria 966
306 Ga0501040_0423877 3300049576 Unclassified 956
307 Ga0501041_0178257 3300049577 Bacteria 1330
308 Ga0501041_0244801 3300049577 Bacteria 1127
309 Ga0501042_0041389 3300049578 Bacteria 3276
310 Ga0501042_0047819 3300049578 Bacteria 3050
311 Ga0501042_0394928 3300049578 Bacteria 1002
312 Ga0501042_0799871 3300049578 Bacteria 686
313 Ga0501043_0008071 3300049579 Bacteria 8308
314 Ga0501043_0013788 3300049579 Bacteria 6325
315 Ga0501043_0022838 3300049579 Bacteria 4905
316 Ga0501043_0059173 3300049579 Bacteria 3006
317 Ga0501043_0382736 3300049579 Bacteria 1065
318 Ga0501043_0461035 3300049579 Bacteria 953
319 Ga0501046_0001492 3300049580 Bacteria 22428
320 Ga0501046_0006759 3300049580 Bacteria 10127
321 Ga0501046_0008708 3300049580 Bacteria 8819
322 Ga0501046_0695256 3300049580 Unclassified 717
323 Ga0501046_1172897 3300049580 Unclassified 528
324 Ga0501047_0000936 3300049581 Bacteria 29599
325 Ga0501047_0007496 3300049581 Bacteria 10267
326 Ga0501047_0194365 3300049581 Bacteria 1891
327 Ga0501047_0295006 3300049581 Bacteria 1464
328 Ga0501047_0309174 3300049581 Bacteria 1421
329 Ga0501047_0420704 3300049581 Bacteria 1167
330 Ga0501047_0455975 3300049581 Bacteria 1107
331 Ga0501047_0820684 3300049581 Bacteria 744
332 Ga0501048_0001779 3300049582 Bacteria 16375
333 Ga0501048_0022895 3300049582 Bacteria 4567
334 Ga0501048_0047611 3300049582 Bacteria 3059
335 Ga0501048_0085288 3300049582 Bacteria 2227
336 Ga0501048_0266935 3300049582 Bacteria 1216
337 Ga0501048_0286915 3300049582 Bacteria 1170
338 Ga0501067_0000881 3300049583 Bacteria 16143
339 Ga0501067_0205083 3300049583 Bacteria 1098
340 Ga0501068_0001505 3300049584 Bacteria 12410
341 Ga0501068_0008328 3300049584 Bacteria 5766
342 Ga0501068_0119992 3300049584 Bacteria 1639
343 Ga0501068_0274300 3300049584 Bacteria 1077
344 Ga0501069_0000446 3300049585 Bacteria 18778
345 Ga0501069_0040112 3300049585 Bacteria 2587
346 Ga0501069_0081628 3300049585 Bacteria 1821
347 Ga0501069_0183562 3300049585 Bacteria 1209
348 Ga0501069_0202740 3300049585 Unclassified 1150
349 Ga0501070_0016601 3300049586 Bacteria 6184
350 Ga0501070_0081791 3300049586 Bacteria 2672
351 Ga0501070_0261869 3300049586 Bacteria 1413
352 Ga0501070_0368668 3300049586 Bacteria 1164
353 Ga0501070_0630041 3300049586 Bacteria 853
354 Ga0501071_0001919 3300049587 Bacteria 12379
355 Ga0501071_0043714 3300049587 Bacteria 3213
356 Ga0501071_0442162 3300049587 Bacteria 995
357 Ga0501072_0030676 3300049588 Bacteria 4206
358 Ga0501072_0099391 3300049588 Bacteria 2313
359 Ga0501072_0099446 3300049588 Bacteria 2312
360 Ga0501072_0296453 3300049588 Bacteria 1285
361 Ga0501072_0417772 3300049588 Bacteria 1063
362 Ga0501073_0000488 3300049589 Bacteria 27619
363 Ga0501073_0002913 3300049589 Bacteria 12846
364 Ga0501073_0124178 3300049589 Bacteria 1789
365 Ga0501073_0201217 3300049589 Unclassified 1377
366 Ga0501073_0217044 3300049589 Bacteria 1322
367 Ga0501073_0232790 3300049589 Bacteria 1272
368 Ga0501073_0469871 3300049589 Bacteria 869
369 Ga0501073_0907705 3300049589 Unclassified 606
370 Ga0501073_0907806 3300049589 Unclassified 606
371 Ga0501074_0001142 3300049590 Bacteria 17387
372 Ga0501074_0002832 3300049590 Bacteria 12145
373 Ga0501074_0114508 3300049590 Bacteria 1929
374 Ga0501074_0261853 3300049590 Bacteria 1229
375 Ga0501075_0289017 3300049591 Bacteria 1249
376 Ga0501075_0296003 3300049591 Bacteria 1233
377 Ga0501075_0353653 3300049591 Bacteria 1119
378 Ga0501075_0853917 3300049591 Bacteria 692
379 Ga0501076_0037177 3300049592 Bacteria 3817
380 Ga0501076_0119345 3300049592 Bacteria 2135
381 Ga0501076_0484436 3300049592 Bacteria 1019
382 Ga0501076_0558002 3300049592 Bacteria 944
383 Ga0501076_0583620 3300049592 Bacteria 922
384 Ga0501076_0583913 3300049592 Bacteria 922
385 Ga0501076_1462963 3300049592 Bacteria 561
386 Ga0501077_0057227 3300049593 Bacteria 2476
387 Ga0501077_0148343 3300049593 Bacteria 1488
388 Ga0501199_039886 3300049650 Unclassified 606
389 Ga0501201_053107 3300049651 Unclassified 510
390 Ga0501206_053428 3300049653 Unclassified 648
391 Ga0501249_034532 3300049679 Bacteria 1135
392 Ga0501253_059000 3300049683 Bacteria 822
393 Ga0501221_135822 3300049704 Unclassified 640
394 Ga0501245_048530 3300049708 Unclassified 747
395 Ga0501079_0008289 3300049741 Bacteria 7875
396 Ga0501079_0021446 3300049741 Bacteria 4941
397 Ga0501079_0028340 3300049741 Bacteria 4296
398 Ga0501079_0150731 3300049741 Bacteria 1813
399 Ga0501079_0450106 3300049741 Bacteria 1011
400 Ga0501079_1202362 3300049741 Unclassified 597
401 Ga0501080_0001608 3300049742 Bacteria 19201
402 Ga0501080_0005855 3300049742 Bacteria 11002
403 Ga0501080_0041187 3300049742 Bacteria 4305
404 Ga0501080_0050478 3300049742 Bacteria 3871
405 Ga0501080_0053573 3300049742 Bacteria 3756
406 Ga0501080_0366464 3300049742 Bacteria 1299
407 Ga0501080_0553814 3300049742 Bacteria 1024
408 Ga0501080_0628282 3300049742 Bacteria 952
409 Ga0501081_0120427 3300049743 Unclassified 1869
410 Ga0501081_0217864 3300049743 Bacteria 1388
411 Ga0501081_0421888 3300049743 Bacteria 989
412 Ga0501081_0608650 3300049743 Bacteria 818
413 Ga0501083_0004799 3300049744 Bacteria 9553
414 Ga0501083_0006416 3300049744 Bacteria 8340
415 Ga0501083_0006619 3300049744 Bacteria 8224
416 Ga0501083_0015256 3300049744 Bacteria 5381
417 Ga0501083_0018712 3300049744 Bacteria 4823
418 Ga0501083_0906876 3300049744 Unclassified 573
419 Ga0501268_145478 3300049765 Unclassified 543
420 Ga0501272_033141 3300049769 Unclassified 664
421 Ga0501035_0010875 3300049822 Bacteria 8428
422 Ga0501035_0108626 3300049822 Bacteria 2432
423 Ga0501035_0232815 3300049822 Bacteria 1569
424 Ga0501035_0262227 3300049822 Bacteria 1464
425 Ga0501044_0001462 3300049823 Bacteria 27726
426 Ga0501044_0006946 3300049823 Bacteria 12458
427 Ga0501044_0376458 3300049823 Bacteria 1335
428 Ga0501044_0723105 3300049823 Bacteria 879
429 Ga0501044_0725638 3300049823 Bacteria 877
430 Ga0501044_0931388 3300049823 Unclassified 742
431 Ga0501045_0001053 3300049824 Bacteria 18173
432 Ga0501045_0018000 3300049824 Bacteria 5017
433 Ga0501045_0068898 3300049824 Bacteria 2600
434 Ga0501045_0277097 3300049824 Bacteria 1248
435 nmdc:mga0k408_24571_c1 3300050493 Bacteria 2571
436 nmdc:mga0k408_655678_c1 3300050493 Unclassified 617
437 nmdc:mga0qj67_1162234_c1 3300050509 Unclassified 601
438 nmdc:mga06r32_1160199_c1 3300050510 Bacteria 720
439 nmdc:mga06r32_1289881_c1 3300050510 Bacteria 674
440 nmdc:mga08y16_1299221_c1 3300050511 Unclassified 694
441 nmdc:mga08y16_131195_c1 3300050511 Bacteria 2605
442 nmdc:mga08y16_392430_c1 3300050511 Bacteria 1422
443 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
444 nmdc:mga08y16_68375_c1 3300050511 Bacteria 3703
445 nmdc:mga08y16_871_c1 3300050511 Bacteria 29077
446 nmdc:mga0n895_444272_c1 3300050512 Bacteria 1310
447 nmdc:mga0rr50_408343_c1 3300050513 Bacteria 1148
448 nmdc:mga0rr50_99512_c1 3300050513 Bacteria 2281
449 nmdc:mga0a205_298528_c1 3300050515 Bacteria 1484
450 nmdc:mga0a205_93937_c1 3300050515 Bacteria 2897
451 Ga0495601_0157295 3300053077 Bacteria 1484
452 Ga0495595_0530902 3300053084 Unclassified 600
453 Ga0495619_1072262 3300053085 Unclassified 537
454 Ga0501084_0010098 3300054114 Bacteria 7802
455 Ga0501084_0032364 3300054114 Bacteria 4374
456 Ga0501084_0037964 3300054114 Bacteria 4025
457 Ga0501084_0041444 3300054114 Bacteria 3852
458 Ga0501084_0201556 3300054114 Bacteria 1679
459 Ga0501084_0242750 3300054114 Bacteria 1520
460 Ga0501084_0533350 3300054114 Bacteria 992
461 Ga0501082_0005541 3300060353 Bacteria 10962
462 Ga0501082_0009747 3300060353 Bacteria 8275
463 Ga0501082_0010859 3300060353 Bacteria 7843
464 Ga0501082_0051524 3300060353 Bacteria 3548
465 Ga0501082_0203736 3300060353 Bacteria 1721
466 Ga0501082_0339799 3300060353 Bacteria 1308
467 Ga0501082_0552133 3300060353 Bacteria 1007
468 Ga0501082_0572118 3300060353 Bacteria 988
469 Ga0501082_0764555 3300060353 Bacteria 845
470 Ga0501082_0896793 3300060353 Bacteria 775
471 Ga0530510_0088674 3300061734 Bacteria 2255
472 Ga0530510_0345151 3300061734 Bacteria 1118
473 Ga0530510_0954823 3300061734 Bacteria 656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_1083770 Ga0501039_1083770_303_602 90
2 3300046454 Ga0495592_0122778 Ga0495592_0122778_1406_1735 91
3 3300046678 Ga0495599_0725915 Ga0495599_0725915_104_433 91
4 3300045976 Ga0466967_1492054 Ga0466967_1492054_68_400 97
5 3300049578 Ga0501042_0799871 Ga0501042_0799871_85_411 97
6 3300009176 Ga0105242_12046078 Ga0105242_120460782 98
7 3300050511 nmdc:mga08y16_131195_c1 nmdc:mga08y16_131195_c1_1369_1695 98
8 3300005290 Ga0065712_10155832 Ga0065712_101558322 99
9 3300005293 Ga0065715_10164551 Ga0065715_101645513 99
10 3300005331 Ga0070670_100316747 Ga0070670_1003167472 99
11 3300005334 Ga0068869_100265207 Ga0068869_1002652072 99
12 3300005336 Ga0070680_100322195 Ga0070680_1003221953 99
13 3300005340 Ga0070689_100118937 Ga0070689_1001189374 99
14 3300005340 Ga0070689_101509741 Ga0070689_1015097412 99
15 3300005347 Ga0070668_100160710 Ga0070668_1001607102 99
16 3300005353 Ga0070669_100020555 Ga0070669_1000205552 99
17 3300005353 Ga0070669_100365563 Ga0070669_1003655632 99
18 3300005353 Ga0070669_101451280 Ga0070669_1014512801 99
19 3300005354 Ga0070675_100295224 Ga0070675_1002952244 99
20 3300005354 Ga0070675_100394982 Ga0070675_1003949822 99
21 3300005354 Ga0070675_101914378 Ga0070675_1019143781 99
22 3300005364 Ga0070673_100520082 Ga0070673_1005200822 99
23 3300005365 Ga0070688_100089406 Ga0070688_1000894063 99
24 3300005365 Ga0070688_100103296 Ga0070688_1001032962 99
25 3300005365 Ga0070688_100554456 Ga0070688_1005544562 99
26 3300005367 Ga0070667_100206616 Ga0070667_1002066162 99
27 3300005441 Ga0070700_100522966 Ga0070700_1005229662 99
28 3300005441 Ga0070700_101276713 Ga0070700_1012767131 99
29 3300005459 Ga0068867_100045926 Ga0068867_1000459263 99
30 3300005535 Ga0070684_100906840 Ga0070684_1009068402 99
31 3300005539 Ga0068853_101902336 Ga0068853_1019023362 99
32 3300005544 Ga0070686_100088057 Ga0070686_1000880573 99
33 3300005548 Ga0070665_101949574 Ga0070665_1019495742 99
34 3300005549 Ga0070704_100077801 Ga0070704_1000778012 99
35 3300005578 Ga0068854_100645967 Ga0068854_1006459672 99
36 3300005616 Ga0068852_102373491 Ga0068852_1023734911 99
37 3300005617 Ga0068859_100274723 Ga0068859_1002747233 99
38 3300005617 Ga0068859_101700340 Ga0068859_1017003402 99
39 3300005617 Ga0068859_102579831 Ga0068859_1025798311 99
40 3300005617 Ga0068859_102886512 Ga0068859_1028865121 99
41 3300005841 Ga0068863_100777848 Ga0068863_1007778482 99
42 3300005841 Ga0068863_101213735 Ga0068863_1012137352 99
43 3300005842 Ga0068858_100308544 Ga0068858_1003085442 99
44 3300005843 Ga0068860_100124497 Ga0068860_1001244973 99
45 3300005843 Ga0068860_100184273 Ga0068860_1001842733 99
46 3300005844 Ga0068862_100588191 Ga0068862_1005881912 99
47 3300006358 Ga0068871_101120372 Ga0068871_1011203722 99
48 3300006844 Ga0075428_102202099 Ga0075428_1022020991 99
49 3300006852 Ga0075433_10089844 Ga0075433_100898444 99
50 3300006881 Ga0068865_102146427 Ga0068865_1021464271 99
51 3300006931 Ga0097620_100274717 Ga0097620_1002747172 99
52 3300006931 Ga0097620_101700536 Ga0097620_1017005361 99
53 3300006931 Ga0097620_102581190 Ga0097620_1025811902 99
54 3300006931 Ga0097620_102886557 Ga0097620_1028865571 99
55 3300009094 Ga0111539_10014318 Ga0111539_100143185 99
56 3300009094 Ga0111539_10048898 Ga0111539_100488982 99
57 3300009094 Ga0111539_10200407 Ga0111539_102004074 99
58 3300009094 Ga0111539_10458551 Ga0111539_104585513 99
59 3300009148 Ga0105243_11696228 Ga0105243_116962282 99
60 3300009176 Ga0105242_12646308 Ga0105242_126463081 99
61 3300009177 Ga0105248_11020071 Ga0105248_110200712 99
62 3300009177 Ga0105248_13312226 Ga0105248_133122262 99
63 3300009553 Ga0105249_10187968 Ga0105249_101879683 99
64 3300009553 Ga0105249_10283009 Ga0105249_102830092 99
65 3300009553 Ga0105249_11555194 Ga0105249_115551942 99
66 3300009553 Ga0105249_12495256 Ga0105249_124952562 99
67 3300014325 Ga0163163_10000011 Ga0163163_10000011139 99
68 3300014326 Ga0157380_10993105 Ga0157380_109931051 99
69 3300014326 Ga0157380_11435377 Ga0157380_114353771 99
70 3300025923 Ga0207681_10039083 Ga0207681_100390834 99
71 3300025923 Ga0207681_11760146 Ga0207681_117601461 99
72 3300025923 Ga0207681_11772613 Ga0207681_117726131 99
73 3300025925 Ga0207650_10078978 Ga0207650_100789784 99
74 3300025926 Ga0207659_10223734 Ga0207659_102237343 99
75 3300025926 Ga0207659_10733643 Ga0207659_107336432 99
76 3300025936 Ga0207670_10456856 Ga0207670_104568562 99
77 3300025941 Ga0207711_10021872 Ga0207711_100218723 99
78 3300025941 Ga0207711_10312553 Ga0207711_103125532 99
79 3300025941 Ga0207711_11994932 Ga0207711_119949321 99
80 3300025942 Ga0207689_10843502 Ga0207689_108435021 99
81 3300025961 Ga0207712_10167289 Ga0207712_101672893 99
82 3300025961 Ga0207712_10311596 Ga0207712_103115962 99
83 3300025961 Ga0207712_11386166 Ga0207712_113861662 99
84 3300025972 Ga0207668_10426127 Ga0207668_104261272 99
85 3300025986 Ga0207658_10166550 Ga0207658_101665502 99
86 3300026035 Ga0207703_10543232 Ga0207703_105432321 99
87 3300026075 Ga0207708_10825206 Ga0207708_108252062 99
88 3300027907 Ga0207428_10017090 Ga0207428_100170905 99
89 3300027907 Ga0207428_10075171 Ga0207428_100751714 99
90 3300027907 Ga0207428_10852132 Ga0207428_108521322 99
91 3300028380 Ga0268265_10966379 Ga0268265_109663792 99
92 3300028380 Ga0268265_11039165 Ga0268265_110391651 99
93 3300028381 Ga0268264_10093130 Ga0268264_100931302 99
94 3300028381 Ga0268264_10165453 Ga0268264_101654532 99
95 3300031548 Ga0307408_100241301 Ga0307408_1002413012 99
96 3300031731 Ga0307405_10329053 Ga0307405_103290532 99
97 3300031824 Ga0307413_10345375 Ga0307413_103453752 99
98 3300031852 Ga0307410_10164597 Ga0307410_101645972 99
99 3300031911 Ga0307412_10152083 Ga0307412_101520833 99
100 3300032002 Ga0307416_100040904 Ga0307416_1000409045 99
101 3300032126 Ga0307415_102006312 Ga0307415_1020063122 99
102 3300035086 Ga0373934_0000878 Ga0373934_0000878_9247_9573 99
103 3300035117 Ga0373953_0044489 Ga0373953_0044489_1060_1386 99
104 3300035119 Ga0373956_0004818 Ga0373956_0004818_1485_1811 99
105 3300035119 Ga0373956_0044495 Ga0373956_0044495_1496_1822 99
106 3300035120 Ga0373957_0138855 Ga0373957_0138855_213_539 99
107 3300035172 Ga0373955_0001450 Ga0373955_0001450_3227_3553 99
108 3300035724 Ga0373933_0084435 Ga0373933_0084435_140_466 99
109 3300035725 Ga0373947_0510972 Ga0373947_0510972_382_708 99
110 3300036401 Ga0373937_0000867 Ga0373937_0000867_3697_4023 99
111 3300036401 Ga0373937_1226220 Ga0373937_1226220_162_488 99
112 3300044673 Ga0453683_0157120 Ga0453683_0157120_1097_1423 99
113 3300045051 Ga0451576_0007100 Ga0451576_0007100_7656_7982 99
114 3300046454 Ga0495592_0538234 Ga0495592_0538234_207_533 99
115 3300046461 Ga0495641_0283648 Ga0495641_0283648_128_454 99
116 3300046462 Ga0495651_0752119 Ga0495651_0752119_188_514 99
117 3300046536 Ga0495587_0465882 Ga0495587_0465882_240_566 99
118 3300046536 Ga0495587_0614165 Ga0495587_0614165_261_587 99
119 3300046537 Ga0495598_0204131 Ga0495598_0204131_360_686 99
120 3300046539 Ga0495621_0052358 Ga0495621_0052358_522_848 99
121 3300046615 Ga0495656_0046437 Ga0495656_0046437_194_520 99
122 3300046678 Ga0495599_0088202 Ga0495599_0088202_1013_1339 99
123 3300047471 Ga0495684_0746838 Ga0495684_0746838_246_572 99
124 3300048905 Ga0496102_0758915 Ga0496102_0758915_31_357 99
125 3300048909 Ga0496106_0796231 Ga0496106_0796231_31_357 99
126 3300048913 Ga0496110_0702028 Ga0496110_0702028_68_394 99
127 3300049569 Ga0501032_0005991 Ga0501032_0005991_4789_5115 99
128 3300049569 Ga0501032_0081965 Ga0501032_0081965_817_1143 99
129 3300049570 Ga0501033_0420350 Ga0501033_0420350_335_661 99
130 3300049571 Ga0501034_0002713 Ga0501034_0002713_5299_5625 99
131 3300049571 Ga0501034_0007399 Ga0501034_0007399_1446_1772 99
132 3300049571 Ga0501034_0149414 Ga0501034_0149414_589_915 99
133 3300049571 Ga0501034_0238654 Ga0501034_0238654_708_1034 99
134 3300049571 Ga0501034_0621240 Ga0501034_0621240_50_376 99
135 3300049572 Ga0501036_0008367 Ga0501036_0008367_550_876 99
136 3300049572 Ga0501036_0094108 Ga0501036_0094108_1402_1728 99
137 3300049572 Ga0501036_0231547 Ga0501036_0231547_43_369 99
138 3300049572 Ga0501036_1105352 Ga0501036_1105352_137_463 99
139 3300049572 Ga0501036_1609633 Ga0501036_1609633_67_396 99
140 3300049573 Ga0501037_0048350 Ga0501037_0048350_50_376 99
141 3300049573 Ga0501037_0139243 Ga0501037_0139243_631_957 99
142 3300049573 Ga0501037_0343967 Ga0501037_0343967_212_538 99
143 3300049573 Ga0501037_0572743 Ga0501037_0572743_208_534 99
144 3300049574 Ga0501038_0001132 Ga0501038_0001132_6011_6337 99
145 3300049574 Ga0501038_0104093 Ga0501038_0104093_203_529 99
146 3300049574 Ga0501038_0146525 Ga0501038_0146525_950_1276 99
147 3300049575 Ga0501039_0006632 Ga0501039_0006632_5816_6142 99
148 3300049579 Ga0501043_0022838 Ga0501043_0022838_238_564 99
149 3300049579 Ga0501043_0461035 Ga0501043_0461035_10_336 99
150 3300049580 Ga0501046_0001492 Ga0501046_0001492_1972_2298 99
151 3300049580 Ga0501046_1172897 Ga0501046_1172897_22_348 99
152 3300049581 Ga0501047_0000936 Ga0501047_0000936_3978_4304 99
153 3300049581 Ga0501047_0194365 Ga0501047_0194365_78_404 99
154 3300049581 Ga0501047_0309174 Ga0501047_0309174_981_1307 99
155 3300049581 Ga0501047_0420704 Ga0501047_0420704_38_364 99
156 3300049581 Ga0501047_0455975 Ga0501047_0455975_569_895 99
157 3300049582 Ga0501048_0047611 Ga0501048_0047611_2189_2515 99
158 3300049582 Ga0501048_0286915 Ga0501048_0286915_281_607 99
159 3300049584 Ga0501068_0008328 Ga0501068_0008328_4815_5141 99
160 3300049584 Ga0501068_0119992 Ga0501068_0119992_291_617 99
161 3300049585 Ga0501069_0081628 Ga0501069_0081628_920_1246 99
162 3300049585 Ga0501069_0183562 Ga0501069_0183562_854_1180 99
163 3300049586 Ga0501070_0261869 Ga0501070_0261869_50_376 99
164 3300049586 Ga0501070_0368668 Ga0501070_0368668_196_522 99
165 3300049588 Ga0501072_0099446 Ga0501072_0099446_1513_1839 99
166 3300049588 Ga0501072_0417772 Ga0501072_0417772_545_871 99
167 3300049589 Ga0501073_0124178 Ga0501073_0124178_420_746 99
168 3300049589 Ga0501073_0201217 Ga0501073_0201217_884_1210 99
169 3300049589 Ga0501073_0232790 Ga0501073_0232790_874_1200 99
170 3300049589 Ga0501073_0907705 Ga0501073_0907705_209_535 99
171 3300049589 Ga0501073_0907806 Ga0501073_0907806_92_418 99
172 3300049591 Ga0501075_0853917 Ga0501075_0853917_237_566 99
173 3300049592 Ga0501076_0583620 Ga0501076_0583620_314_643 99
174 3300049592 Ga0501076_0583913 Ga0501076_0583913_149_475 99
175 3300049592 Ga0501076_1462963 Ga0501076_1462963_222_548 99
176 3300049593 Ga0501077_0057227 Ga0501077_0057227_377_703 99
177 3300049741 Ga0501079_0150731 Ga0501079_0150731_622_948 99
178 3300049742 Ga0501080_0001608 Ga0501080_0001608_2520_2846 99
179 3300049742 Ga0501080_0041187 Ga0501080_0041187_142_468 99
180 3300049742 Ga0501080_0366464 Ga0501080_0366464_154_480 99
181 3300049743 Ga0501081_0421888 Ga0501081_0421888_636_968 99
182 3300049744 Ga0501083_0006416 Ga0501083_0006416_6527_6853 99
183 3300049744 Ga0501083_0006619 Ga0501083_0006619_7261_7587 99
184 3300049744 Ga0501083_0906876 Ga0501083_0906876_82_408 99
185 3300049822 Ga0501035_0108626 Ga0501035_0108626_473_799 99
186 3300049823 Ga0501044_0001462 Ga0501044_0001462_4698_5024 99
187 3300049823 Ga0501044_0376458 Ga0501044_0376458_349_675 99
188 3300049823 Ga0501044_0725638 Ga0501044_0725638_304_630 99
189 3300050510 nmdc:mga06r32_1289881_c1 nmdc:mga06r32_1289881_c1_230_556 99
190 3300050511 nmdc:mga08y16_1299221_c1 nmdc:mga08y16_1299221_c1_140_466 99
191 3300050511 nmdc:mga08y16_392430_c1 nmdc:mga08y16_392430_c1_942_1268 99
192 3300050511 nmdc:mga08y16_871_c1 nmdc:mga08y16_871_c1_24874_25200 99
193 3300050512 nmdc:mga0n895_444272_c1 nmdc:mga0n895_444272_c1_52_381 99
194 3300050513 nmdc:mga0rr50_408343_c1 nmdc:mga0rr50_408343_c1_631_960 99
195 3300050515 nmdc:mga0a205_93937_c1 nmdc:mga0a205_93937_c1_1265_1594 99
196 3300053077 Ga0495601_0157295 Ga0495601_0157295_936_1262 99
197 3300053084 Ga0495595_0530902 Ga0495595_0530902_51_377 99
198 3300053085 Ga0495619_1072262 Ga0495619_1072262_164_490 99
199 3300054114 Ga0501084_0037964 Ga0501084_0037964_2536_2862 99
200 3300054114 Ga0501084_0242750 Ga0501084_0242750_1109_1435 99
201 3300060353 Ga0501082_0005541 Ga0501082_0005541_7364_7690 99
202 3300060353 Ga0501082_0203736 Ga0501082_0203736_659_985 99
203 3300060353 Ga0501082_0339799 Ga0501082_0339799_955_1284 99
204 3300060353 Ga0501082_0552133 Ga0501082_0552133_532_858 99
205 3300060353 Ga0501082_0764555 Ga0501082_0764555_297_623 99
206 3300060353 Ga0501082_0896793 Ga0501082_0896793_407_733 99
207 3300061734 Ga0530510_0345151 Ga0530510_0345151_306_632 99
208 3300005354 Ga0070675_100582300 Ga0070675_1005823002 101
209 3300005549 Ga0070704_100356563 Ga0070704_1003565632 101
210 3300005617 Ga0068859_100259160 Ga0068859_1002591603 101
211 3300006931 Ga0097620_100259164 Ga0097620_1002591642 101
212 3300013306 Ga0163162_10564305 Ga0163162_105643052 101
213 3300035119 Ga0373956_0602839 Ga0373956_0602839_33_365 101
214 3300041486 Ga0451807_0417392 Ga0451807_0417392_264_602 101
215 3300046454 Ga0495592_0101022 Ga0495592_0101022_351_683 101
216 3300046536 Ga0495587_0237549 Ga0495587_0237549_209_541 101
217 3300046543 Ga0495645_0231205 Ga0495645_0231205_442_774 101
218 3300048917 Ga0496114_1586337 Ga0496114_1586337_199_531 101
219 3300049591 Ga0501075_0296003 Ga0501075_0296003_45_386 101
220 3300005289 Ga0065704_10344253 Ga0065704_103442532 102
221 3300005290 Ga0065712_10261990 Ga0065712_102619902 102
222 3300005290 Ga0065712_10368332 Ga0065712_103683322 102
223 3300005293 Ga0065715_10093446 Ga0065715_100934462 102
224 3300005293 Ga0065715_10362048 Ga0065715_103620482 102
225 3300005295 Ga0065707_10000711 Ga0065707_100007116 102
226 3300005295 Ga0065707_10559015 Ga0065707_105590151 102
227 3300005295 Ga0065707_10757287 Ga0065707_107572871 102
228 3300005331 Ga0070670_100451754 Ga0070670_1004517541 102
229 3300005331 Ga0070670_101679230 Ga0070670_1016792302 102
230 3300005333 Ga0070677_10505383 Ga0070677_105053832 102
231 3300005333 Ga0070677_10622797 Ga0070677_106227971 102
232 3300005338 Ga0068868_101037508 Ga0068868_1010375082 102
233 3300005340 Ga0070689_101299618 Ga0070689_1012996182 102
234 3300005345 Ga0070692_10966790 Ga0070692_109667901 102
235 3300005353 Ga0070669_101120958 Ga0070669_1011209582 102
236 3300005354 Ga0070675_100350590 Ga0070675_1003505902 102
237 3300005356 Ga0070674_100127242 Ga0070674_1001272423 102
238 3300005356 Ga0070674_100443409 Ga0070674_1004434092 102
239 3300005364 Ga0070673_100862370 Ga0070673_1008623702 102
240 3300005406 Ga0070703_10030749 Ga0070703_100307493 102
241 3300005406 Ga0070703_10105413 Ga0070703_101054132 102
242 3300005438 Ga0070701_10220153 Ga0070701_102201532 102
243 3300005441 Ga0070700_100678281 Ga0070700_1006782811 102
244 3300005441 Ga0070700_100966343 Ga0070700_1009663432 102
245 3300005444 Ga0070694_101174938 Ga0070694_1011749381 102
246 3300005445 Ga0070708_100738640 Ga0070708_1007386402 102
247 3300005456 Ga0070678_100754708 Ga0070678_1007547082 102
248 3300005457 Ga0070662_100287132 Ga0070662_1002871323 102
249 3300005468 Ga0070707_100162935 Ga0070707_1001629353 102
250 3300005545 Ga0070695_100117770 Ga0070695_1001177704 102
251 3300005545 Ga0070695_101541166 Ga0070695_1015411661 102
252 3300005548 Ga0070665_100767668 Ga0070665_1007676682 102
253 3300005549 Ga0070704_100059365 Ga0070704_1000593652 102
254 3300005549 Ga0070704_100829043 Ga0070704_1008290431 102
255 3300005617 Ga0068859_100004386 Ga0068859_1000043865 102
256 3300005617 Ga0068859_100206163 Ga0068859_1002061634 102
257 3300005719 Ga0068861_100218789 Ga0068861_1002187892 102
258 3300005719 Ga0068861_100229287 Ga0068861_1002292873 102
259 3300005719 Ga0068861_100310529 Ga0068861_1003105292 102
260 3300005840 Ga0068870_10110085 Ga0068870_101100852 102
261 3300005844 Ga0068862_100755352 Ga0068862_1007553522 102
262 3300005844 Ga0068862_100925842 Ga0068862_1009258422 102
263 3300006048 Ga0075363_100821135 Ga0075363_1008211352 102
264 3300006178 Ga0075367_10005554 Ga0075367_100055543 102
265 3300006195 Ga0075366_10038270 Ga0075366_100382703 102
266 3300006195 Ga0075366_10414622 Ga0075366_104146221 102
267 3300006237 Ga0097621_100204832 Ga0097621_1002048323 102
268 3300006358 Ga0068871_100947528 Ga0068871_1009475282 102
269 3300006844 Ga0075428_100000010 Ga0075428_10000001062 102
270 3300006852 Ga0075433_10436283 Ga0075433_104362831 102
271 3300006880 Ga0075429_101088051 Ga0075429_1010880512 102
272 3300006931 Ga0097620_100004386 Ga0097620_1000043865 102
273 3300006931 Ga0097620_100206164 Ga0097620_1002061642 102
274 3300007076 Ga0075435_100085533 Ga0075435_1000855334 102
275 3300009094 Ga0111539_10000001 Ga0111539_10000001138 102
276 3300009094 Ga0111539_10448985 Ga0111539_104489852 102
277 3300009094 Ga0111539_11007087 Ga0111539_110070872 102
278 3300009147 Ga0114129_12470777 Ga0114129_124707772 102
279 3300009176 Ga0105242_12025187 Ga0105242_120251871 102
280 3300009553 Ga0105249_11043369 Ga0105249_110433692 102
281 3300014326 Ga0157380_10042450 Ga0157380_100424502 102
282 3300014326 Ga0157380_10099635 Ga0157380_100996354 102
283 3300014326 Ga0157380_10346978 Ga0157380_103469782 102
284 3300014326 Ga0157380_10773869 Ga0157380_107738692 102
285 3300014326 Ga0157380_11078505 Ga0157380_110785052 102
286 3300014326 Ga0157380_11403677 Ga0157380_114036772 102
287 3300025885 Ga0207653_10131922 Ga0207653_101319222 102
288 3300025893 Ga0207682_10026896 Ga0207682_100268962 102
289 3300025901 Ga0207688_10882883 Ga0207688_108828832 102
290 3300025908 Ga0207643_10247341 Ga0207643_102473412 102
291 3300025910 Ga0207684_10299070 Ga0207684_102990701 102
292 3300025922 Ga0207646_10093021 Ga0207646_100930213 102
293 3300025923 Ga0207681_10855984 Ga0207681_108559842 102
294 3300025925 Ga0207650_10410230 Ga0207650_104102302 102
295 3300025926 Ga0207659_10094851 Ga0207659_100948512 102
296 3300025933 Ga0207706_10533746 Ga0207706_105337462 102
297 3300025936 Ga0207670_11095240 Ga0207670_110952402 102
298 3300025937 Ga0207669_10185573 Ga0207669_101855732 102
299 3300025941 Ga0207711_11278687 Ga0207711_112786872 102
300 3300025960 Ga0207651_11280645 Ga0207651_112806452 102
301 3300025972 Ga0207668_10626692 Ga0207668_106266922 102
302 3300026023 Ga0207677_11289403 Ga0207677_112894032 102
303 3300026075 Ga0207708_10186508 Ga0207708_101865083 102
304 3300026118 Ga0207675_100216116 Ga0207675_1002161164 102
305 3300026118 Ga0207675_100348925 Ga0207675_1003489252 102
306 3300026118 Ga0207675_100839603 Ga0207675_1008396032 102
307 3300027907 Ga0207428_10000002 Ga0207428_10000002151 102
308 3300028379 Ga0268266_11479658 Ga0268266_114796582 102
309 3300028380 Ga0268265_10624147 Ga0268265_106241472 102
310 3300028381 Ga0268264_12098535 Ga0268264_120985351 102
311 3300028381 Ga0268264_12105186 Ga0268264_121051862 102
312 3300031548 Ga0307408_100032664 Ga0307408_1000326647 102
313 3300031548 Ga0307408_100049179 Ga0307408_1000491794 102
314 3300031548 Ga0307408_100052776 Ga0307408_1000527762 102
315 3300031731 Ga0307405_10107905 Ga0307405_101079052 102
316 3300031731 Ga0307405_10825724 Ga0307405_108257242 102
317 3300031824 Ga0307413_10054878 Ga0307413_100548782 102
318 3300031824 Ga0307413_10416747 Ga0307413_104167472 102
319 3300031852 Ga0307410_10264308 Ga0307410_102643082 102
320 3300031852 Ga0307410_10922886 Ga0307410_109228862 102
321 3300031901 Ga0307406_10146266 Ga0307406_101462662 102
322 3300031903 Ga0307407_10079170 Ga0307407_100791703 102
323 3300031903 Ga0307407_11393117 Ga0307407_113931171 102
324 3300031911 Ga0307412_10087440 Ga0307412_100874404 102
325 3300031911 Ga0307412_10447045 Ga0307412_104470451 102
326 3300031911 Ga0307412_10482829 Ga0307412_104828292 102
327 3300031911 Ga0307412_10517053 Ga0307412_105170532 102
328 3300031995 Ga0307409_100061792 Ga0307409_1000617921 102
329 3300031995 Ga0307409_100131252 Ga0307409_1001312523 102
330 3300031995 Ga0307409_100179559 Ga0307409_1001795594 102
331 3300032002 Ga0307416_100106013 Ga0307416_1001060134 102
332 3300032002 Ga0307416_100155164 Ga0307416_1001551643 102
333 3300032002 Ga0307416_100921856 Ga0307416_1009218562 102
334 3300032002 Ga0307416_101541449 Ga0307416_1015414492 102
335 3300032002 Ga0307416_101566606 Ga0307416_1015666062 102
336 3300032002 Ga0307416_101700428 Ga0307416_1017004282 102
337 3300032005 Ga0307411_10047228 Ga0307411_100472283 102
338 3300032005 Ga0307411_10879973 Ga0307411_108799732 102
339 3300032005 Ga0307411_11585886 Ga0307411_115858862 102
340 3300041512 Ga0451853_2114990 Ga0451853_2114990_245_556 102
341 3300042122 Ga0450920_062702 Ga0450920_062702_351_659 102
342 3300042438 Ga0439459_0114381 Ga0439459_0114381_351_659 102
343 3300049521 Ga0501298_072198 Ga0501298_072198_229_540 102
344 3300049568 Ga0501031_0013288 Ga0501031_0013288_3472_3819 102
345 3300049568 Ga0501031_0782590 Ga0501031_0782590_255_566 102
346 3300049569 Ga0501032_0005211 Ga0501032_0005211_5877_6224 102
347 3300049569 Ga0501032_0080911 Ga0501032_0080911_998_1345 102
348 3300049570 Ga0501033_0003267 Ga0501033_0003267_5272_5619 102
349 3300049570 Ga0501033_0006579 Ga0501033_0006579_7800_8147 102
350 3300049570 Ga0501033_0018774 Ga0501033_0018774_1507_1854 102
351 3300049570 Ga0501033_0417766 Ga0501033_0417766_37_345 102
352 3300049570 Ga0501033_0812153 Ga0501033_0812153_256_567 102
353 3300049571 Ga0501034_0012642 Ga0501034_0012642_992_1303 102
354 3300049571 Ga0501034_0024299 Ga0501034_0024299_476_823 102
355 3300049572 Ga0501036_0004139 Ga0501036_0004139_7800_8147 102
356 3300049572 Ga0501036_0021561 Ga0501036_0021561_4140_4487 102
357 3300049572 Ga0501036_0022618 Ga0501036_0022618_1170_1517 102
358 3300049573 Ga0501037_0002251 Ga0501037_0002251_4181_4528 102
359 3300049573 Ga0501037_0025602 Ga0501037_0025602_1181_1528 102
360 3300049573 Ga0501037_0074856 Ga0501037_0074856_1853_2200 102
361 3300049574 Ga0501038_0016576 Ga0501038_0016576_831_1178 102
362 3300049574 Ga0501038_0061632 Ga0501038_0061632_1127_1474 102
363 3300049574 Ga0501038_0454707 Ga0501038_0454707_187_498 102
364 3300049574 Ga0501038_0480223 Ga0501038_0480223_116_463 102
365 3300049575 Ga0501039_0003636 Ga0501039_0003636_2237_2584 102
366 3300049575 Ga0501039_0032267 Ga0501039_0032267_1875_2222 102
367 3300049576 Ga0501040_0281752 Ga0501040_0281752_478_825 102
368 3300049576 Ga0501040_0416202 Ga0501040_0416202_441_788 102
369 3300049576 Ga0501040_0423877 Ga0501040_0423877_51_359 102
370 3300049577 Ga0501041_0178257 Ga0501041_0178257_223_534 102
371 3300049577 Ga0501041_0244801 Ga0501041_0244801_544_852 102
372 3300049578 Ga0501042_0041389 Ga0501042_0041389_952_1299 102
373 3300049578 Ga0501042_0047819 Ga0501042_0047819_2152_2499 102
374 3300049578 Ga0501042_0394928 Ga0501042_0394928_349_657 102
375 3300049579 Ga0501043_0008071 Ga0501043_0008071_6455_6802 102
376 3300049579 Ga0501043_0013788 Ga0501043_0013788_5316_5663 102
377 3300049579 Ga0501043_0059173 Ga0501043_0059173_1392_1739 102
378 3300049579 Ga0501043_0382736 Ga0501043_0382736_692_1003 102
379 3300049580 Ga0501046_0006759 Ga0501046_0006759_4701_5048 102
380 3300049580 Ga0501046_0008708 Ga0501046_0008708_807_1154 102
381 3300049580 Ga0501046_0695256 Ga0501046_0695256_128_439 102
382 3300049581 Ga0501047_0007496 Ga0501047_0007496_476_823 102
383 3300049581 Ga0501047_0295006 Ga0501047_0295006_958_1305 102
384 3300049581 Ga0501047_0820684 Ga0501047_0820684_292_639 102
385 3300049582 Ga0501048_0001779 Ga0501048_0001779_12216_12563 102
386 3300049582 Ga0501048_0022895 Ga0501048_0022895_3230_3577 102
387 3300049582 Ga0501048_0085288 Ga0501048_0085288_932_1279 102
388 3300049582 Ga0501048_0266935 Ga0501048_0266935_455_763 102
389 3300049583 Ga0501067_0000881 Ga0501067_0000881_4382_4729 102
390 3300049583 Ga0501067_0205083 Ga0501067_0205083_185_532 102
391 3300049584 Ga0501068_0001505 Ga0501068_0001505_4470_4817 102
392 3300049584 Ga0501068_0274300 Ga0501068_0274300_660_1007 102
393 3300049585 Ga0501069_0000446 Ga0501069_0000446_13414_13761 102
394 3300049585 Ga0501069_0040112 Ga0501069_0040112_1253_1600 102
395 3300049585 Ga0501069_0202740 Ga0501069_0202740_153_464 102
396 3300049586 Ga0501070_0016601 Ga0501070_0016601_3637_3984 102
397 3300049586 Ga0501070_0081791 Ga0501070_0081791_1318_1665 102
398 3300049586 Ga0501070_0630041 Ga0501070_0630041_375_686 102
399 3300049587 Ga0501071_0001919 Ga0501071_0001919_7131_7478 102
400 3300049587 Ga0501071_0043714 Ga0501071_0043714_1206_1517 102
401 3300049587 Ga0501071_0442162 Ga0501071_0442162_267_578 102
402 3300049588 Ga0501072_0030676 Ga0501072_0030676_3820_4167 102
403 3300049588 Ga0501072_0099391 Ga0501072_0099391_1776_2087 102
404 3300049588 Ga0501072_0296453 Ga0501072_0296453_792_1139 102
405 3300049589 Ga0501073_0000488 Ga0501073_0000488_3884_4231 102
406 3300049589 Ga0501073_0002913 Ga0501073_0002913_4470_4817 102
407 3300049589 Ga0501073_0217044 Ga0501073_0217044_88_399 102
408 3300049589 Ga0501073_0469871 Ga0501073_0469871_385_732 102
409 3300049590 Ga0501074_0001142 Ga0501074_0001142_8030_8377 102
410 3300049590 Ga0501074_0002832 Ga0501074_0002832_3759_4106 102
411 3300049590 Ga0501074_0114508 Ga0501074_0114508_847_1158 102
412 3300049590 Ga0501074_0261853 Ga0501074_0261853_678_1025 102
413 3300049591 Ga0501075_0289017 Ga0501075_0289017_610_921 102
414 3300049591 Ga0501075_0353653 Ga0501075_0353653_518_829 102
415 3300049592 Ga0501076_0037177 Ga0501076_0037177_1449_1760 102
416 3300049592 Ga0501076_0119345 Ga0501076_0119345_1288_1635 102
417 3300049592 Ga0501076_0484436 Ga0501076_0484436_333_680 102
418 3300049592 Ga0501076_0558002 Ga0501076_0558002_558_866 102
419 3300049593 Ga0501077_0148343 Ga0501077_0148343_1085_1396 102
420 3300049650 Ga0501199_039886 Ga0501199_039886_14_325 102
421 3300049651 Ga0501201_053107 Ga0501201_053107_61_372 102
422 3300049653 Ga0501206_053428 Ga0501206_053428_51_362 102
423 3300049679 Ga0501249_034532 Ga0501249_034532_52_363 102
424 3300049683 Ga0501253_059000 Ga0501253_059000_280_591 102
425 3300049704 Ga0501221_135822 Ga0501221_135822_189_500 102
426 3300049708 Ga0501245_048530 Ga0501245_048530_59_370 102
427 3300049741 Ga0501079_0008289 Ga0501079_0008289_358_705 102
428 3300049741 Ga0501079_0021446 Ga0501079_0021446_613_960 102
429 3300049741 Ga0501079_0028340 Ga0501079_0028340_3670_4017 102
430 3300049741 Ga0501079_0450106 Ga0501079_0450106_178_489 102
431 3300049741 Ga0501079_1202362 Ga0501079_1202362_257_568 102
432 3300049742 Ga0501080_0005855 Ga0501080_0005855_7666_8013 102
433 3300049742 Ga0501080_0050478 Ga0501080_0050478_355_702 102
434 3300049742 Ga0501080_0053573 Ga0501080_0053573_461_808 102
435 3300049742 Ga0501080_0553814 Ga0501080_0553814_504_815 102
436 3300049742 Ga0501080_0628282 Ga0501080_0628282_209_520 102
437 3300049743 Ga0501081_0120427 Ga0501081_0120427_1529_1840 102
438 3300049743 Ga0501081_0217864 Ga0501081_0217864_612_920 102
439 3300049743 Ga0501081_0608650 Ga0501081_0608650_103_450 102
440 3300049744 Ga0501083_0004799 Ga0501083_0004799_4044_4391 102
441 3300049744 Ga0501083_0015256 Ga0501083_0015256_2954_3301 102
442 3300049744 Ga0501083_0018712 Ga0501083_0018712_913_1260 102
443 3300049765 Ga0501268_145478 Ga0501268_145478_87_398 102
444 3300049769 Ga0501272_033141 Ga0501272_033141_86_397 102
445 3300049822 Ga0501035_0010875 Ga0501035_0010875_1111_1458 102
446 3300049822 Ga0501035_0232815 Ga0501035_0232815_290_637 102
447 3300049822 Ga0501035_0262227 Ga0501035_0262227_958_1305 102
448 3300049823 Ga0501044_0006946 Ga0501044_0006946_825_1172 102
449 3300049823 Ga0501044_0723105 Ga0501044_0723105_290_637 102
450 3300049823 Ga0501044_0931388 Ga0501044_0931388_202_549 102
451 3300049824 Ga0501045_0001053 Ga0501045_0001053_9250_9597 102
452 3300049824 Ga0501045_0018000 Ga0501045_0018000_622_930 102
453 3300049824 Ga0501045_0068898 Ga0501045_0068898_1563_1874 102
454 3300049824 Ga0501045_0277097 Ga0501045_0277097_570_917 102
455 3300050493 nmdc:mga0k408_24571_c1 nmdc:mga0k408_24571_c1_910_1224 102
456 3300050493 nmdc:mga0k408_655678_c1 nmdc:mga0k408_655678_c1_125_439 102
457 3300050509 nmdc:mga0qj67_1162234_c1 nmdc:mga0qj67_1162234_c1_30_341 102
458 3300050510 nmdc:mga06r32_1160199_c1 nmdc:mga06r32_1160199_c1_31_342 102
459 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_161443_161754 102
460 3300050511 nmdc:mga08y16_68375_c1 nmdc:mga08y16_68375_c1_676_1017 102
461 3300050513 nmdc:mga0rr50_99512_c1 nmdc:mga0rr50_99512_c1_369_677 102
462 3300050515 nmdc:mga0a205_298528_c1 nmdc:mga0a205_298528_c1_421_729 102
463 3300054114 Ga0501084_0010098 Ga0501084_0010098_6130_6477 102
464 3300054114 Ga0501084_0032364 Ga0501084_0032364_3680_4027 102
465 3300054114 Ga0501084_0041444 Ga0501084_0041444_3408_3719 102
466 3300054114 Ga0501084_0201556 Ga0501084_0201556_1119_1466 102
467 3300054114 Ga0501084_0533350 Ga0501084_0533350_462_770 102
468 3300060353 Ga0501082_0009747 Ga0501082_0009747_2460_2807 102
469 3300060353 Ga0501082_0010859 Ga0501082_0010859_3578_3925 102
470 3300060353 Ga0501082_0051524 Ga0501082_0051524_620_928 102
471 3300060353 Ga0501082_0572118 Ga0501082_0572118_211_558 102
472 3300061734 Ga0530510_0088674 Ga0530510_0088674_1347_1655 102
473 3300061734 Ga0530510_0954823 Ga0530510_0954823_244_558 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11950

DUF3467

Protein of unknown function (DUF3467)

6

105

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wii-assembly3.cif.gz_B complement c3b in complex with factor h domains 1-4 0.6326 22 78
5fo7-assembly1.cif.gz_B crystal structure of human complement c3b at 2.8 angstrom resolution 0.6303 24 78
2qki-assembly2.cif.gz_F human c3c in complex with the inhibitor compstatin 0.6189 24 78
6bz0-assembly2.cif.gz_C 1.83 angstrom resolution crystal structure of dihydrolipoyl dehydrogenase from acinetobacter baumannii in complex with fad. 0.6081 24 42
1i8d-assembly1.cif.gz_B crystal structure of riboflavin synthase 0.6045 21 40
ID Description Score Start End Superfamily
af_P47140_80_304_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7334 29 71 3.90.190.10
af_K7VAH5_1_253_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6465 23 69 2.130.10.10
af_M9PAZ8_182_369_2.130.10.30 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 0.6256 21 45 2.130.10.30
6bz0A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6234 24 42 3.50.50.60
af_K7L296_1_116_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.6206 24 71 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A2V8BTY7-F1-model_v4 DUF3467 domain-containing protein 0.7856 1 99
AF-A0A7X3QC05-F1-model_v4 DUF3467 domain-containing protein 0.7773 1 102
AF-A0A7X3QC05-F1-model_v4 DUF3467 domain-containing protein 0.7708 1 102
AF-A0A7Z9T9M2-F1-model_v4 DUF3467 domain-containing protein 0.7693 1 102
AF-A0A7Z9T9M2-F1-model_v4 DUF3467 domain-containing protein 0.7629 1 102

Feature Viewer

pLDDT pTM Quality
82.67 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map