F450985

General Info

Members Datasets Scaffolds Average Seq Length
473 223 472 315

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10185420|Ga0081455_101854202
Length 339
Sequence MPSLRNVIIIGSGPAGLTAALYSARANLQPLLIEGIEAGGQLMLTTMVENFPGYRDGIMGPDLMAEMRAQAERFGTEIVQGNVTSVDLGSQPMVVKTSEHDYQSKTIIIATGASARLLGLPSERALMGHGVSTCATCDGYFFRGQDIAVVGGGDSAMEEAIFLTRFASKVTVVHRRGTLRASKIMQDKARANDKIAWQLDSEVEEIKDGGKGEVTSMVLRNKRTGGRTEVPVSGVFVAIGHTPNTSMFQGQLELDRNGYIMTHDGSKTSVAGVFACGDVQDHIYRQAITAAGTGCMAALDAEWYLRDNPAVPTPEALEGTGDLAEQQWAPAMPQPTRSV

Samples

Sample ID Description Type Environment
1 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
139 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
140 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
141 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 2.75
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10006372 3300002459 Bacteria 2404
2 Ga0065712_10003970 3300005290 Bacteria 5176
3 Ga0065715_10285746 3300005293 Bacteria 1075
4 Ga0070658_10083883 3300005327 Bacteria 2620
5 Ga0070676_10316703 3300005328 Bacteria 1062
6 Ga0070690_100005710 3300005330 Bacteria 7009
7 Ga0070690_100217162 3300005330 Bacteria 1338
8 Ga0070670_100040942 3300005331 Bacteria 3982
9 Ga0070677_10144203 3300005333 Bacteria 1102
10 Ga0070666_10212756 3300005335 Bacteria 1362
11 Ga0070680_100023646 3300005336 Bacteria 4904
12 Ga0070680_100434571 3300005336 Bacteria 1120
13 Ga0070687_100018562 3300005343 Bacteria 3220
14 Ga0070669_100025806 3300005353 Bacteria 4222
15 Ga0070675_100000647 3300005354 Bacteria 24078
16 Ga0070671_100108853 3300005355 Bacteria 2327
17 Ga0070674_100002099 3300005356 Bacteria 10928
18 Ga0070674_100022357 3300005356 Bacteria 4078
19 Ga0070674_100023188 3300005356 Bacteria 4014
20 Ga0070674_100070434 3300005356 Bacteria 2471
21 Ga0070674_100166586 3300005356 Bacteria 1677
22 Ga0070673_100115092 3300005364 Bacteria 2236
23 Ga0070673_100404620 3300005364 Bacteria 1221
24 Ga0070659_100106334 3300005366 Bacteria 2262
25 Ga0070667_100013351 3300005367 Bacteria 6787
26 Ga0070709_10070578 3300005434 Bacteria 2252
27 Ga0070713_100004221 3300005436 Bacteria 9600
28 Ga0070701_10173203 3300005438 Bacteria 1258
29 Ga0070705_100198998 3300005440 Bacteria 1372
30 Ga0070700_100024762 3300005441 Bacteria 3528
31 Ga0070694_100000539 3300005444 Bacteria 20865
32 Ga0070694_100023467 3300005444 Bacteria 3968
33 Ga0070694_100045982 3300005444 Bacteria 2928
34 Ga0070708_100032541 3300005445 Bacteria 4524
35 Ga0070708_100044610 3300005445 Bacteria 3900
36 Ga0070708_100067071 3300005445 Bacteria 3221
37 Ga0070708_100078623 3300005445 Bacteria 2982
38 Ga0070708_100085018 3300005445 Bacteria 2870
39 Ga0070708_100124773 3300005445 Bacteria 2379
40 Ga0070678_100449915 3300005456 Bacteria 1128
41 Ga0070662_100116918 3300005457 Bacteria 2039
42 Ga0070662_100294011 3300005457 Bacteria 1317
43 Ga0070681_10199354 3300005458 Bacteria 1920
44 Ga0070681_10433715 3300005458 Bacteria 1226
45 Ga0068867_100309444 3300005459 Bacteria 1305
46 Ga0070706_100044948 3300005467 Bacteria 4079
47 Ga0070706_100259175 3300005467 Bacteria 1623
48 Ga0070707_100011796 3300005468 Bacteria 8160
49 Ga0070707_100114939 3300005468 Bacteria 2611
50 Ga0070707_100530767 3300005468 Bacteria 1139
51 Ga0070698_100044431 3300005471 Bacteria 4549
52 Ga0070698_100087101 3300005471 Bacteria 3109
53 Ga0070698_100087554 3300005471 Bacteria 3100
54 Ga0070699_100004615 3300005518 Bacteria 12188
55 Ga0070699_100014596 3300005518 Bacteria 6756
56 Ga0070699_100040142 3300005518 Bacteria 4053
57 Ga0070699_100081083 3300005518 Bacteria 2828
58 Ga0070699_100124876 3300005518 Bacteria 2265
59 Ga0070679_100166303 3300005530 Bacteria 2179
60 Ga0070679_100222756 3300005530 Bacteria 1847
61 Ga0070684_100199325 3300005535 Bacteria 1823
62 Ga0070697_100013459 3300005536 Bacteria 6419
63 Ga0070697_100067271 3300005536 Bacteria 2930
64 Ga0070697_100080212 3300005536 Bacteria 2688
65 Ga0070672_100033003 3300005543 Bacteria 3915
66 Ga0070686_100004247 3300005544 Bacteria 7893
67 Ga0070686_100327751 3300005544 Bacteria 1144
68 Ga0070695_100000815 3300005545 Bacteria 16797
69 Ga0070696_100473446 3300005546 Bacteria 992
70 Ga0070665_100000771 3300005548 Bacteria 42242
71 Ga0070665_100013960 3300005548 Bacteria 8078
72 Ga0070704_100009438 3300005549 Bacteria 5893
73 Ga0070704_100018274 3300005549 Bacteria 4479
74 Ga0070704_100048668 3300005549 Bacteria 2969
75 Ga0070704_100096686 3300005549 Bacteria 2214
76 Ga0068857_100103243 3300005577 Bacteria 2560
77 Ga0068854_100028019 3300005578 Bacteria 3888
78 Ga0068859_100048348 3300005617 Bacteria 4273
79 Ga0068859_100064107 3300005617 Bacteria 3707
80 Ga0068859_100092001 3300005617 Bacteria 3084
81 Ga0068859_100127949 3300005617 Bacteria 2610
82 Ga0068859_100503216 3300005617 Bacteria 1307
83 Ga0068864_100007993 3300005618 Bacteria 8721
84 Ga0068861_100101688 3300005719 Bacteria 2287
85 Ga0068861_100353348 3300005719 Bacteria 1290
86 Ga0068863_100004024 3300005841 Bacteria 14515
87 Ga0068858_100004236 3300005842 Bacteria 14116
88 Ga0068858_100118038 3300005842 Bacteria 2480
89 Ga0068858_100140039 3300005842 Bacteria 2271
90 Ga0068858_100143738 3300005842 Bacteria 2240
91 Ga0068860_100088821 3300005843 Bacteria 2942
92 Ga0068862_100128643 3300005844 Bacteria 2238
93 Ga0068862_100224523 3300005844 Bacteria 1702
94 Ga0081455_10185420 3300005937 Bacteria 1572
95 Ga0081538_10016148 3300005981 Bacteria 5740
96 Ga0075368_10096496 3300006042 Bacteria 1212
97 Ga0075432_10019274 3300006058 Bacteria 2330
98 Ga0097621_100041369 3300006237 Bacteria 3710
99 Ga0097621_100211467 3300006237 Bacteria 1687
100 Ga0097621_100242225 3300006237 Bacteria 1577
101 Ga0068871_100013993 3300006358 Bacteria 5969
102 Ga0075428_100000003 3300006844 Bacteria 365483
103 Ga0075428_100017990 3300006844 Bacteria 7809
104 Ga0075428_100108374 3300006844 Bacteria 3027
105 Ga0075428_100456412 3300006844 Bacteria 1369
106 Ga0075430_100026510 3300006846 Bacteria 4929
107 Ga0075430_100181583 3300006846 Bacteria 1750
108 Ga0075431_100000072 3300006847 Bacteria 58754
109 Ga0075431_100040671 3300006847 Bacteria 4791
110 Ga0075431_100155698 3300006847 Bacteria 2351
111 Ga0075433_10003370 3300006852 Bacteria 12351
112 Ga0075433_10014649 3300006852 Bacteria 6413
113 Ga0075433_10038914 3300006852 Bacteria 4110
114 Ga0075433_10039426 3300006852 Bacteria 4084
115 Ga0075433_10085132 3300006852 Bacteria 2791
116 Ga0075433_10146340 3300006852 Bacteria 2100
117 Ga0075433_10322403 3300006852 Bacteria 1367
118 Ga0075433_10345290 3300006852 Bacteria 1315
119 Ga0075434_100007059 3300006871 Bacteria 10368
120 Ga0075434_100010070 3300006871 Bacteria 8852
121 Ga0075434_100019748 3300006871 Bacteria 6524
122 Ga0075434_100032830 3300006871 Bacteria 5120
123 Ga0075434_100061070 3300006871 Bacteria 3749
124 Ga0075434_100113712 3300006871 Bacteria 2719
125 Ga0075429_100016367 3300006880 Bacteria 6427
126 Ga0075429_100091375 3300006880 Bacteria 2656
127 Ga0068865_100145859 3300006881 Bacteria 1790
128 Ga0068865_100154425 3300006881 Bacteria 1744
129 Ga0068865_100317958 3300006881 Bacteria 1251
130 Ga0075436_100003909 3300006914 Bacteria 10209
131 Ga0075436_100027045 3300006914 Bacteria 3950
132 Ga0075436_100034357 3300006914 Bacteria 3496
133 Ga0075436_100055301 3300006914 Bacteria 2740
134 Ga0075436_100161975 3300006914 Bacteria 1577
135 Ga0075436_100313134 3300006914 Bacteria 1127
136 Ga0097620_100048349 3300006931 Bacteria 4273
137 Ga0097620_100064105 3300006931 Bacteria 3707
138 Ga0097620_100091999 3300006931 Bacteria 3084
139 Ga0097620_100127949 3300006931 Bacteria 2610
140 Ga0097620_100503226 3300006931 Bacteria 1307
141 Ga0075435_100000111 3300007076 Bacteria 44957
142 Ga0075435_100000810 3300007076 Bacteria 19471
143 Ga0075435_100009027 3300007076 Bacteria 7189
144 Ga0075435_100015330 3300007076 Bacteria 5759
145 Ga0075435_100093793 3300007076 Bacteria 2480
146 Ga0075435_100192920 3300007076 Bacteria 1725
147 Ga0075435_100395655 3300007076 Bacteria 1188
148 Ga0075435_100435800 3300007076 Bacteria 1129
149 Ga0075435_100482169 3300007076 Bacteria 1071
150 Ga0099794_10038222 3300007265 Bacteria 2273
151 Ga0105240_10059583 3300009093 Bacteria 4763
152 Ga0105240_10185190 3300009093 Bacteria 2453
153 Ga0111539_10000001 3300009094 Bacteria 1035431
154 Ga0111539_10000238 3300009094 Bacteria 65613
155 Ga0111539_10000827 3300009094 Bacteria 40203
156 Ga0111539_10004174 3300009094 Bacteria 18954
157 Ga0111539_10032764 3300009094 Bacteria 6311
158 Ga0111539_10176809 3300009094 Bacteria 2493
159 Ga0111539_10591834 3300009094 Bacteria 1292
160 Ga0111539_10765107 3300009094 Bacteria 1124
161 Ga0105245_10275849 3300009098 Bacteria 1642
162 Ga0105247_10026129 3300009101 Bacteria 3525
163 Ga0105247_10159485 3300009101 Bacteria 1492
164 Ga0114129_10002549 3300009147 Bacteria 25304
165 Ga0114129_10010179 3300009147 Bacteria 13406
166 Ga0114129_10046703 3300009147 Bacteria 6085
167 Ga0114129_10084789 3300009147 Bacteria 4398
168 Ga0114129_10084958 3300009147 Bacteria 4392
169 Ga0114129_10096563 3300009147 Bacteria 4091
170 Ga0114129_10183420 3300009147 Bacteria 2846
171 Ga0114129_10268434 3300009147 Bacteria 2284
172 Ga0114129_10300457 3300009147 Bacteria 2140
173 Ga0114129_10302351 3300009147 Bacteria 2132
174 Ga0114129_10359084 3300009147 Bacteria 1928
175 Ga0114129_10407818 3300009147 Bacteria 1790
176 Ga0114129_10490390 3300009147 Bacteria 1606
177 Ga0105243_10009141 3300009148 Bacteria 7567
178 Ga0105241_10071097 3300009174 Bacteria 2701
179 Ga0105242_10032323 3300009176 Bacteria 4184
180 Ga0105242_10094726 3300009176 Bacteria 2519
181 Ga0105248_10022329 3300009177 Bacteria 7018
182 Ga0105248_10033931 3300009177 Bacteria 5703
183 Ga0105248_10079589 3300009177 Bacteria 3683
184 Ga0105248_10125883 3300009177 Bacteria 2891
185 Ga0105248_10166242 3300009177 Bacteria 2487
186 Ga0105248_10220601 3300009177 Bacteria 2135
187 Ga0105248_10255673 3300009177 Bacteria 1972
188 Ga0105248_10655231 3300009177 Bacteria 1185
189 Ga0105249_10045298 3300009553 Bacteria 4000
190 Ga0105249_10160666 3300009553 Bacteria 2171
191 Ga0105249_10173772 3300009553 Bacteria 2091
192 Ga0157371_10269845 3300013102 Bacteria 1228
193 Ga0157374_10002165 3300013296 Bacteria 16562
194 Ga0157374_10035609 3300013296 Bacteria 4555
195 Ga0157374_10152617 3300013296 Bacteria 2246
196 Ga0157378_10004845 3300013297 Bacteria 11800
197 Ga0157378_10593507 3300013297 Bacteria 1118
198 Ga0163162_10066865 3300013306 Bacteria 3644
199 Ga0163162_10102842 3300013306 Bacteria 2950
200 Ga0163162_10464174 3300013306 Bacteria 1398
201 Ga0157375_10303562 3300013308 Bacteria 1760
202 Ga0163163_10014722 3300014325 Bacteria 7196
203 Ga0163163_10070744 3300014325 Bacteria 3475
204 Ga0163163_10078025 3300014325 Bacteria 3308
205 Ga0157380_10000913 3300014326 Bacteria 18608
206 Ga0157380_10004916 3300014326 Bacteria 9317
207 Ga0157380_10102203 3300014326 Bacteria 2390
208 Ga0157380_10260463 3300014326 Bacteria 1575
209 Ga0157377_10172127 3300014745 Bacteria 1355
210 Ga0157379_10012693 3300014968 Bacteria 7363
211 Ga0157379_10053981 3300014968 Bacteria 3590
212 Ga0157376_10018030 3300014969 Bacteria 5400
213 Ga0157376_10035742 3300014969 Bacteria 4021
214 Ga0157376_10046931 3300014969 Bacteria 3565
215 Ga0207680_10152108 3300025903 Bacteria 1543
216 Ga0207699_10037693 3300025906 Bacteria 2765
217 Ga0207643_10172458 3300025908 Bacteria 1306
218 Ga0207684_10004177 3300025910 Bacteria 13717
219 Ga0207684_10033331 3300025910 Bacteria 4379
220 Ga0207684_10122656 3300025910 Bacteria 2228
221 Ga0207654_10017021 3300025911 Bacteria 3794
222 Ga0207707_10217647 3300025912 Bacteria 1663
223 Ga0207695_10126163 3300025913 Bacteria 2521
224 Ga0207660_10085505 3300025917 Bacteria 2327
225 Ga0207662_10006467 3300025918 Bacteria 6327
226 Ga0207657_10008966 3300025919 Bacteria 10106
227 Ga0207646_10019571 3300025922 Bacteria 6288
228 Ga0207646_10037673 3300025922 Bacteria 4359
229 Ga0207646_10052394 3300025922 Bacteria 3651
230 Ga0207646_10168120 3300025922 Bacteria 1980
231 Ga0207646_10395510 3300025922 Bacteria 1248
232 Ga0207646_10451241 3300025922 Bacteria 1160
233 Ga0207681_10007925 3300025923 Bacteria 6495
234 Ga0207659_10001565 3300025926 Bacteria 13581
235 Ga0207687_10159403 3300025927 Bacteria 1730
236 Ga0207700_10124554 3300025928 Bacteria 2094
237 Ga0207644_10200932 3300025931 Bacteria 1572
238 Ga0207686_10016274 3300025934 Bacteria 4172
239 Ga0207670_10223894 3300025936 Bacteria 1441
240 Ga0207670_10242670 3300025936 Bacteria 1389
241 Ga0207669_10022483 3300025937 Bacteria 3351
242 Ga0207669_10034198 3300025937 Bacteria 2877
243 Ga0207669_10159512 3300025937 Bacteria 1591
244 Ga0207669_10216488 3300025937 Bacteria 1402
245 Ga0207704_10042950 3300025938 Bacteria 2665
246 Ga0207704_10166574 3300025938 Bacteria 1575
247 Ga0207665_10050700 3300025939 Bacteria 2792
248 Ga0207691_10285907 3300025940 Bacteria 1418
249 Ga0207711_10022277 3300025941 Bacteria 5297
250 Ga0207711_10053644 3300025941 Bacteria 3457
251 Ga0207711_10167153 3300025941 Bacteria 1994
252 Ga0207711_10228384 3300025941 Bacteria 1704
253 Ga0207711_10372907 3300025941 Bacteria 1323
254 Ga0207711_10562836 3300025941 Bacteria 1063
255 Ga0207689_10022865 3300025942 Bacteria 5251
256 Ga0207679_10067882 3300025945 Bacteria 2677
257 Ga0207667_10402344 3300025949 Bacteria 1394
258 Ga0207651_10277997 3300025960 Bacteria 1382
259 Ga0207712_10093761 3300025961 Bacteria 2216
260 Ga0207712_10284136 3300025961 Bacteria 1351
261 Ga0207640_10019459 3300025981 Bacteria 4011
262 Ga0207640_10046696 3300025981 Bacteria 2789
263 Ga0207703_10029761 3300026035 Bacteria 4310
264 Ga0207703_10089247 3300026035 Bacteria 2589
265 Ga0207703_10117230 3300026035 Bacteria 2281
266 Ga0207703_10201146 3300026035 Bacteria 1770
267 Ga0207703_10451909 3300026035 Bacteria 1200
268 Ga0207708_10128649 3300026075 Bacteria 1978
269 Ga0207708_10510761 3300026075 Bacteria 1008
270 Ga0207702_10090609 3300026078 Bacteria 2676
271 Ga0207641_10001443 3300026088 Bacteria 23349
272 Ga0207641_10359227 3300026088 Bacteria 1390
273 Ga0207648_10058005 3300026089 Bacteria 3377
274 Ga0207648_10105958 3300026089 Bacteria 2466
275 Ga0207648_10160594 3300026089 Bacteria 1985
276 Ga0207676_10005302 3300026095 Bacteria 9133
277 Ga0207676_10013484 3300026095 Bacteria 5872
278 Ga0207674_10097991 3300026116 Bacteria 2916
279 Ga0207675_100009768 3300026118 Bacteria 8982
280 Ga0207675_100029092 3300026118 Bacteria 5149
281 Ga0207683_10242964 3300026121 Bacteria 1642
282 Ga0209974_10016911 3300027876 Bacteria 2421
283 Ga0207428_10000002 3300027907 Bacteria 854851
284 Ga0207428_10000054 3300027907 Bacteria 175237
285 Ga0207428_10002086 3300027907 Bacteria 20130
286 Ga0207428_10003212 3300027907 Bacteria 15972
287 Ga0207428_10042966 3300027907 Bacteria 3653
288 Ga0207428_10090168 3300027907 Bacteria 2382
289 Ga0268266_10003281 3300028379 Bacteria 16279
290 Ga0268265_10017146 3300028380 Bacteria 4991
291 Ga0268265_10205765 3300028380 Bacteria 1711
292 Ga0268264_10104327 3300028381 Bacteria 2471
293 Ga0268264_10143714 3300028381 Bacteria 2131
294 Ga0307408_100119672 3300031548 Bacteria 2038
295 Ga0307408_100224354 3300031548 Bacteria 1535
296 Ga0307410_10064510 3300031852 Bacteria 2517
297 Ga0307406_10095276 3300031901 Bacteria 2014
298 Ga0307407_10060086 3300031903 Bacteria 2217
299 Ga0307416_100571314 3300032002 Bacteria 1207
300 Ga0373930_0000697 3300034816 Bacteria 4719
301 Ga0373948_0002506 3300034817 Bacteria 2727
302 Ga0373958_0018223 3300034819 Bacteria 1270
303 Ga0373959_0001519 3300034820 Bacteria 3698
304 Ga0373938_0002592 3300034957 Bacteria 2914
305 Ga0373929_0013702 3300035085 Bacteria 1557
306 Ga0373949_0004859 3300035090 Bacteria 3043
307 Ga0373951_0015273 3300035091 Bacteria 1728
308 Ga0373923_0109693 3300035111 Bacteria 1224
309 Ga0373932_0001911 3300035112 Bacteria 5562
310 Ga0373936_0090375 3300035113 Bacteria 1283
311 Ga0373939_0020814 3300035114 Bacteria 1787
312 Ga0373941_0003424 3300035115 Bacteria 3592
313 Ga0373960_0001571 3300035121 Bacteria 5097
314 Ga0373946_0016584 3300035171 Bacteria 2808
315 Ga0373961_0001372 3300035241 Bacteria 7304
316 Ga0373962_0021861 3300035242 Bacteria 1691
317 Ga0373924_0071867 3300035410 Bacteria 1460
318 Ga0373931_0015000 3300035691 Bacteria 3797
319 Ga0373931_0049040 3300035691 Bacteria 2240
320 Ga0373931_0069862 3300035691 Bacteria 1914
321 Ga0373927_0119777 3300035695 Bacteria 1718
322 Ga0373937_0297260 3300036401 Bacteria 1526
323 Ga0373937_0341205 3300036401 Bacteria 1419
324 Ga0373925_0007435 3300037068 Bacteria 7992
325 Ga0451577_0000844 3300042876 Bacteria 45822
326 Ga0451577_0067126 3300042876 Bacteria 3199
327 Ga0453683_0157238 3300044673 Bacteria 1437
328 Ga0453684_0130822 3300044712 Bacteria 3011
329 Ga0451576_0001424 3300045051 Bacteria 40965
330 Ga0451576_0345179 3300045051 Bacteria 1559
331 Ga0495592_0018363 3300046454 Bacteria 5318
332 Ga0495629_0070779 3300046459 Bacteria 2434
333 Ga0495580_0001114 3300046472 Bacteria 23622
334 Ga0495582_0127316 3300046473 Bacteria 1438
335 Ga0495639_0167267 3300046475 Bacteria 1066
336 Ga0495608_0062166 3300046511 Bacteria 2454
337 Ga0495628_0084785 3300046516 Bacteria 2458
338 Ga0495628_0423207 3300046516 Bacteria 970
339 Ga0495630_0006053 3300046517 Bacteria 8570
340 Ga0495645_0172974 3300046543 Bacteria 1485
341 Ga0495667_0099656 3300046559 Bacteria 1880
342 Ga0495657_0194358 3300046675 Bacteria 1239
343 Ga0495647_0039820 3300046681 Bacteria 1783
344 Ga0495669_0109870 3300046684 Bacteria 1287
345 Ga0495613_0001615 3300046689 Bacteria 17153
346 Ga0495600_0042052 3300046809 Bacteria 2978
347 Ga0495604_0079335 3300047317 Bacteria 2462
348 Ga0495674_0010439 3300047319 Bacteria 8793
349 Ga0496101_0000773 3300048904 Bacteria 18926
350 Ga0496102_0032067 3300048905 Bacteria 4719
351 Ga0496104_0048058 3300048907 Bacteria 4023
352 Ga0496104_0133289 3300048907 Bacteria 2387
353 Ga0496104_0364203 3300048907 Bacteria 1358
354 Ga0496106_0134316 3300048909 Bacteria 1942
355 Ga0496108_0006865 3300048911 Bacteria 9212
356 Ga0496109_0572768 3300048912 Bacteria 1064
357 Ga0496112_0005637 3300048915 Bacteria 10867
358 Ga0496112_0466922 3300048915 Bacteria 1199
359 Ga0496112_0758114 3300048915 Bacteria 896
360 Ga0496114_0000233 3300048917 Bacteria 40546
361 Ga0496114_0031034 3300048917 Bacteria 4396
362 Ga0501033_0107401 3300049570 Bacteria 2033
363 Ga0501033_0144496 3300049570 Bacteria 1719
364 Ga0501036_0061562 3300049572 Bacteria 3179
365 Ga0501038_0071937 3300049574 Bacteria 2932
366 Ga0501038_0240299 3300049574 Bacteria 1438
367 Ga0501039_0092433 3300049575 Bacteria 2358
368 Ga0501040_0021277 3300049576 Bacteria 4330
369 Ga0501040_0028487 3300049576 Bacteria 3766
370 Ga0501040_0076392 3300049576 Bacteria 2316
371 Ga0501040_0108644 3300049576 Bacteria 1939
372 Ga0501041_0002515 3300049577 Bacteria 10444
373 Ga0501070_0398624 3300049586 Bacteria 1113
374 Ga0501071_0017276 3300049587 Bacteria 4973
375 Ga0501071_0080197 3300049587 Bacteria 2386
376 Ga0501071_0097470 3300049587 Bacteria 2165
377 Ga0501072_0026622 3300049588 Bacteria 4509
378 Ga0501074_0069357 3300049590 Bacteria 2535
379 Ga0501075_0009690 3300049591 Bacteria 6748
380 Ga0501075_0026565 3300049591 Bacteria 4264
381 Ga0501075_0081303 3300049591 Bacteria 2453
382 Ga0501075_0102530 3300049591 Bacteria 2173
383 Ga0501076_0038133 3300049592 Bacteria 3772
384 Ga0501076_0038921 3300049592 Bacteria 3732
385 Ga0501077_0014912 3300049593 Bacteria 4886
386 Ga0501077_0043188 3300049593 Bacteria 2865
387 Ga0501077_0053586 3300049593 Bacteria 2561
388 Ga0501077_0162010 3300049593 Bacteria 1420
389 Ga0501079_0007858 3300049741 Bacteria 8078
390 Ga0501079_0010024 3300049741 Bacteria 7193
391 Ga0501079_0026677 3300049741 Bacteria 4430
392 Ga0501079_0197626 3300049741 Bacteria 1570
393 Ga0501079_0265235 3300049741 Bacteria 1342
394 Ga0501079_0330709 3300049741 Bacteria 1193
395 Ga0501080_0044140 3300049742 Bacteria 4150
396 Ga0501081_0001773 3300049743 Bacteria 13376
397 Ga0501081_0034017 3300049743 Bacteria 3466
398 Ga0501081_0039120 3300049743 Bacteria 3244
399 Ga0501081_0344660 3300049743 Bacteria 1097
400 Ga0501083_0052702 3300049744 Bacteria 2733
401 Ga0501035_0252700 3300049822 Bacteria 1496
402 Ga0501045_0007431 3300049824 Bacteria 7614
403 Ga0501045_0067297 3300049824 Bacteria 2630
404 nmdc:mga05p37_13544_c1 3300050507 Bacteria 9778
405 nmdc:mga05p37_15680_c1 3300050507 Bacteria 9109
406 nmdc:mga05p37_235466_c1 3300050507 Bacteria 2204
407 nmdc:mga05p37_240666_c1 3300050507 Bacteria 2176
408 nmdc:mga05p37_248946_c1 3300050507 Bacteria 2132
409 nmdc:mga05p37_254865_c1 3300050507 Bacteria 2103
410 nmdc:mga05p37_317095_c1 3300050507 Bacteria 1846
411 nmdc:mga05p37_346570_c1 3300050507 Bacteria 1750
412 nmdc:mga05p37_421673_c1 3300050507 Bacteria 1553
413 nmdc:mga05p37_45139_c1 3300050507 Bacteria 5422
414 nmdc:mga05p37_626998_c1 3300050507 Bacteria 1209
415 nmdc:mga09592_30220_c1 3300050508 Bacteria 4507
416 nmdc:mga09592_69037_c1 3300050508 Bacteria 2998
417 nmdc:mga06r32_173064_c1 3300050510 Bacteria 2143
418 nmdc:mga06r32_352149_c1 3300050510 Bacteria 1457
419 nmdc:mga06r32_75691_c1 3300050510 Bacteria 3267
420 nmdc:mga06r32_80538_c1 3300050510 Bacteria 3169
421 nmdc:mga06r32_987_c1 3300050510 Bacteria 25489
422 nmdc:mga08y16_101662_c1 3300050511 Bacteria 2993
423 nmdc:mga08y16_1197_c1 3300050511 Bacteria 25596
424 nmdc:mga08y16_13575_c1 3300050511 Bacteria 8573
425 nmdc:mga08y16_20418_c1 3300050511 Bacteria 6992
426 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
427 nmdc:mga08y16_44855_c1 3300050511 Bacteria 4634
428 nmdc:mga0n895_127624_c1 3300050512 Bacteria 2567
429 nmdc:mga0n895_18764_c1 3300050512 Bacteria 6410
430 nmdc:mga0n895_289970_c1 3300050512 Bacteria 1659
431 nmdc:mga0n895_362399_c1 3300050512 Bacteria 1468
432 nmdc:mga0n895_45488_c1 3300050512 Bacteria 4284
433 nmdc:mga0n895_46427_c1 3300050512 Bacteria 4244
434 nmdc:mga0n895_5949_c1 3300050512 Bacteria 10264
435 nmdc:mga0n895_87429_c1 3300050512 Bacteria 3114
436 nmdc:mga0rr50_168777_c1 3300050513 Bacteria 1781
437 nmdc:mga0rr50_215406_c1 3300050513 Bacteria 1584
438 nmdc:mga0rr50_30525_c1 3300050513 Bacteria 3817
439 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
440 nmdc:mga0rr50_40183_c1 3300050513 Bacteria 3400
441 nmdc:mga0rr50_43000_c1 3300050513 Bacteria 3303
442 nmdc:mga0rr50_5622_c1 3300050513 Bacteria 7505
443 nmdc:mga0rr50_62931_c1 3300050513 Bacteria 2801
444 nmdc:mga08x19_239783_c1 3300050514 Bacteria 1250
445 nmdc:mga08x19_262152_c1 3300050514 Bacteria 1195
446 nmdc:mga08x19_627_c1 3300050514 Bacteria 22773
447 nmdc:mga08x19_96312_c1 3300050514 Bacteria 1959
448 nmdc:mga0a205_10023_c1 3300050515 Bacteria 8693
449 nmdc:mga0a205_1085_c1 3300050515 Bacteria 22566
450 nmdc:mga0a205_130443_c1 3300050515 Bacteria 2414
451 nmdc:mga0a205_257415_c1 3300050515 Bacteria 1623
452 nmdc:mga0a205_273574_c1 3300050515 Bacteria 1565
453 nmdc:mga0a205_307759_c1 3300050515 Bacteria 1457
454 nmdc:mga0a205_45151_c1 3300050515 Bacteria 4248
455 nmdc:mga0a205_57111_c1 3300050515 Bacteria 3769
456 nmdc:mga0a205_58999_c1 3300050515 Bacteria 3707
457 nmdc:mga0a205_66025_c1 3300050515 Bacteria 3496
458 Ga0495601_0002222 3300053077 Bacteria 10929
459 Ga0495655_0086779 3300053083 Bacteria 905
460 Ga0495619_0022423 3300053085 Bacteria 4041
461 Ga0495619_0198688 3300053085 Bacteria 1388
462 Ga0500556_0005539 3300053104 Bacteria 3566
463 Ga0501084_0037230 3300054114 Bacteria 4064
464 Ga0501084_0219316 3300054114 Bacteria 1605
465 Ga0501084_0342409 3300054114 Bacteria 1263
466 Ga0590071_023702 3300059421 Bacteria 1453
467 Ga0501082_0016127 3300060353 Bacteria 6426
468 Ga0501082_0027944 3300060353 Bacteria 4859
469 Ga0501082_0209844 3300060353 Bacteria 1694
470 Ga0530510_0000169 3300061734 Bacteria 39699
471 Ga0530510_0021607 3300061734 Bacteria 4578
472 Ga0530510_0054422 3300061734 Bacteria 2891

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0423207 Ga0495628_0423207_175_948 254
2 3300046459 Ga0495629_0070779 Ga0495629_0070779_27_848 272
3 3300053083 Ga0495655_0086779 Ga0495655_0086779_14_835 272
4 3300049574 Ga0501038_0240299 Ga0501038_0240299_576_1421 279
5 3300049593 Ga0501077_0043188 Ga0501077_0043188_10_855 279
6 3300049741 Ga0501079_0330709 Ga0501079_0330709_19_864 279
7 3300050510 nmdc:mga06r32_352149_c1 nmdc:mga06r32_352149_c1_364_1212 280
8 3300046475 Ga0495639_0167267 Ga0495639_0167267_30_884 283
9 3300048915 Ga0496112_0758114 Ga0496112_0758114_30_884 283
10 3300005518 Ga0070699_100124876 Ga0070699_1001248762 296
11 3300005843 Ga0068860_100088821 Ga0068860_1000888213 296
12 3300005549 Ga0070704_100018274 Ga0070704_1000182742 301
13 3300050512 nmdc:mga0n895_289970_c1 nmdc:mga0n895_289970_c1_526_1452 305
14 3300049570 Ga0501033_0144496 Ga0501033_0144496_301_1230 306
15 3300005333 Ga0070677_10144203 Ga0070677_101442031 307
16 3300009101 Ga0105247_10026129 Ga0105247_100261294 307
17 3300009177 Ga0105248_10033931 Ga0105248_100339312 307
18 3300014325 Ga0163163_10070744 Ga0163163_100707443 307
19 3300014968 Ga0157379_10012693 Ga0157379_100126932 307
20 3300036401 Ga0373937_0341205 Ga0373937_0341205_461_1384 307
21 3300049741 Ga0501079_0026677 Ga0501079_0026677_1493_2422 307
22 3300049824 Ga0501045_0067297 Ga0501045_0067297_1106_2038 307
23 3300006852 Ga0075433_10085132 Ga0075433_100851322 308
24 3300006871 Ga0075434_100032830 Ga0075434_1000328303 308
25 3300007076 Ga0075435_100395655 Ga0075435_1003956551 308
26 3300009147 Ga0114129_10300457 Ga0114129_103004572 308
27 3300050507 nmdc:mga05p37_235466_c1 nmdc:mga05p37_235466_c1_765_1697 308
28 3300050513 nmdc:mga0rr50_168777_c1 nmdc:mga0rr50_168777_c1_475_1407 308
29 3300050515 nmdc:mga0a205_130443_c1 nmdc:mga0a205_130443_c1_1178_2110 308
30 iso_pu_bacteria 2997451912 2997459013 308
31 3300005445 Ga0070708_100032541 Ga0070708_1000325412 309
32 3300006846 Ga0075430_100026510 Ga0075430_1000265104 309
33 3300006846 Ga0075430_100181583 Ga0075430_1001815832 309
34 3300006852 Ga0075433_10038914 Ga0075433_100389145 309
35 3300006871 Ga0075434_100019748 Ga0075434_1000197483 309
36 3300006880 Ga0075429_100091375 Ga0075429_1000913754 309
37 3300007076 Ga0075435_100482169 Ga0075435_1004821691 309
38 3300009094 Ga0111539_10591834 Ga0111539_105918342 309
39 3300009147 Ga0114129_10084958 Ga0114129_100849585 309
40 3300009147 Ga0114129_10183420 Ga0114129_101834204 309
41 3300009147 Ga0114129_10359084 Ga0114129_103590842 309
42 3300027907 Ga0207428_10003212 Ga0207428_1000321214 309
43 3300035691 Ga0373931_0069862 Ga0373931_0069862_262_1197 309
44 3300042876 Ga0451577_0067126 Ga0451577_0067126_1486_2421 309
45 3300049575 Ga0501039_0092433 Ga0501039_0092433_1124_2059 309
46 3300049576 Ga0501040_0028487 Ga0501040_0028487_2108_3043 309
47 3300049577 Ga0501041_0002515 Ga0501041_0002515_7689_8624 309
48 3300049587 Ga0501071_0097470 Ga0501071_0097470_716_1651 309
49 3300049591 Ga0501075_0026565 Ga0501075_0026565_90_1025 309
50 3300049592 Ga0501076_0038133 Ga0501076_0038133_177_1112 309
51 3300049592 Ga0501076_0038921 Ga0501076_0038921_84_1019 309
52 3300049593 Ga0501077_0014912 Ga0501077_0014912_2124_3059 309
53 3300049593 Ga0501077_0162010 Ga0501077_0162010_302_1237 309
54 3300049741 Ga0501079_0007858 Ga0501079_0007858_2006_2941 309
55 3300049743 Ga0501081_0001773 Ga0501081_0001773_2814_3749 309
56 3300049824 Ga0501045_0007431 Ga0501045_0007431_3962_4897 309
57 3300050507 nmdc:mga05p37_317095_c1 nmdc:mga05p37_317095_c1_398_1333 309
58 3300050508 nmdc:mga09592_69037_c1 nmdc:mga09592_69037_c1_1506_2441 309
59 3300050510 nmdc:mga06r32_173064_c1 nmdc:mga06r32_173064_c1_1075_2010 309
60 3300050511 nmdc:mga08y16_44855_c1 nmdc:mga08y16_44855_c1_2933_3868 309
61 3300050512 nmdc:mga0n895_127624_c1 nmdc:mga0n895_127624_c1_550_1479 309
62 3300050512 nmdc:mga0n895_46427_c1 nmdc:mga0n895_46427_c1_2857_3792 309
63 3300050515 nmdc:mga0a205_45151_c1 nmdc:mga0a205_45151_c1_440_1375 309
64 3300060353 Ga0501082_0016127 Ga0501082_0016127_465_1400 309
65 3300061734 Ga0530510_0000169 Ga0530510_0000169_16975_17910 309
66 3300061734 Ga0530510_0021607 Ga0530510_0021607_3502_4437 309
67 3300005440 Ga0070705_100198998 Ga0070705_1001989982 310
68 3300005444 Ga0070694_100023467 Ga0070694_1000234674 310
69 3300005445 Ga0070708_100067071 Ga0070708_1000670714 310
70 3300005445 Ga0070708_100085018 Ga0070708_1000850182 310
71 3300005458 Ga0070681_10199354 Ga0070681_101993543 310
72 3300005467 Ga0070706_100044948 Ga0070706_1000449485 310
73 3300005468 Ga0070707_100011796 Ga0070707_1000117964 310
74 3300005468 Ga0070707_100114939 Ga0070707_1001149391 310
75 3300005471 Ga0070698_100044431 Ga0070698_1000444314 310
76 3300005471 Ga0070698_100087101 Ga0070698_1000871012 310
77 3300005518 Ga0070699_100014596 Ga0070699_1000145965 310
78 3300005518 Ga0070699_100040142 Ga0070699_1000401425 310
79 3300005536 Ga0070697_100067271 Ga0070697_1000672714 310
80 3300007076 Ga0075435_100192920 Ga0075435_1001929203 310
81 3300025910 Ga0207684_10004177 Ga0207684_1000417713 310
82 3300025910 Ga0207684_10033331 Ga0207684_100333313 310
83 3300025922 Ga0207646_10451241 Ga0207646_104512412 310
84 3300027876 Ga0209974_10016911 Ga0209974_100169111 310
85 3300031548 Ga0307408_100119672 Ga0307408_1001196722 310
86 3300031548 Ga0307408_100224354 Ga0307408_1002243541 310
87 3300032002 Ga0307416_100571314 Ga0307416_1005713141 310
88 3300035691 Ga0373931_0015000 Ga0373931_0015000_170_1108 310
89 3300046472 Ga0495580_0001114 Ga0495580_0001114_15258_16196 310
90 3300048905 Ga0496102_0032067 Ga0496102_0032067_2286_3224 310
91 3300049570 Ga0501033_0107401 Ga0501033_0107401_504_1442 310
92 3300049572 Ga0501036_0061562 Ga0501036_0061562_1646_2608 310
93 3300049574 Ga0501038_0071937 Ga0501038_0071937_316_1278 310
94 3300049576 Ga0501040_0021277 Ga0501040_0021277_576_1523 310
95 3300049576 Ga0501040_0076392 Ga0501040_0076392_1276_2214 310
96 3300049586 Ga0501070_0398624 Ga0501070_0398624_22_960 310
97 3300049587 Ga0501071_0017276 Ga0501071_0017276_2132_3070 310
98 3300049587 Ga0501071_0080197 Ga0501071_0080197_701_1663 310
99 3300049588 Ga0501072_0026622 Ga0501072_0026622_1597_2559 310
100 3300049590 Ga0501074_0069357 Ga0501074_0069357_628_1566 310
101 3300049591 Ga0501075_0081303 Ga0501075_0081303_1177_2115 310
102 3300049591 Ga0501075_0102530 Ga0501075_0102530_972_1934 310
103 3300049593 Ga0501077_0053586 Ga0501077_0053586_392_1330 310
104 3300049741 Ga0501079_0010024 Ga0501079_0010024_2154_3116 310
105 3300049741 Ga0501079_0265235 Ga0501079_0265235_288_1226 310
106 3300049742 Ga0501080_0044140 Ga0501080_0044140_1741_2703 310
107 3300049743 Ga0501081_0034017 Ga0501081_0034017_575_1513 310
108 3300049743 Ga0501081_0039120 Ga0501081_0039120_1904_2866 310
109 3300049743 Ga0501081_0344660 Ga0501081_0344660_107_1045 310
110 3300049744 Ga0501083_0052702 Ga0501083_0052702_800_1762 310
111 3300049822 Ga0501035_0252700 Ga0501035_0252700_386_1348 310
112 3300050513 nmdc:mga0rr50_215406_c1 nmdc:mga0rr50_215406_c1_354_1292 310
113 3300054114 Ga0501084_0037230 Ga0501084_0037230_1359_2321 310
114 3300054114 Ga0501084_0219316 Ga0501084_0219316_303_1241 310
115 3300059421 Ga0590071_023702 Ga0590071_023702_173_1135 310
116 3300060353 Ga0501082_0209844 Ga0501082_0209844_490_1452 310
117 3300061734 Ga0530510_0054422 Ga0530510_0054422_563_1525 310
118 3300005336 Ga0070680_100023646 Ga0070680_1000236462 311
119 3300005336 Ga0070680_100434571 Ga0070680_1004345711 311
120 3300005445 Ga0070708_100044610 Ga0070708_1000446105 311
121 3300005457 Ga0070662_100294011 Ga0070662_1002940111 311
122 3300005467 Ga0070706_100259175 Ga0070706_1002591752 311
123 3300005471 Ga0070698_100087554 Ga0070698_1000875542 311
124 3300005536 Ga0070697_100080212 Ga0070697_1000802122 311
125 3300005549 Ga0070704_100048668 Ga0070704_1000486683 311
126 3300005617 Ga0068859_100092001 Ga0068859_1000920012 311
127 3300005617 Ga0068859_100127949 Ga0068859_1001279494 311
128 3300005844 Ga0068862_100128643 Ga0068862_1001286434 311
129 3300005981 Ga0081538_10016148 Ga0081538_100161486 311
130 3300006847 Ga0075431_100000072 Ga0075431_10000007247 311
131 3300006852 Ga0075433_10003370 Ga0075433_1000337012 311
132 3300006852 Ga0075433_10014649 Ga0075433_100146495 311
133 3300006931 Ga0097620_100091999 Ga0097620_1000919995 311
134 3300006931 Ga0097620_100127949 Ga0097620_1001279491 311
135 3300007265 Ga0099794_10038222 Ga0099794_100382222 311
136 3300009094 Ga0111539_10000238 Ga0111539_1000023850 311
137 3300009147 Ga0114129_10302351 Ga0114129_103023512 311
138 3300009147 Ga0114129_10407818 Ga0114129_104078182 311
139 3300009177 Ga0105248_10220601 Ga0105248_102206014 311
140 3300009553 Ga0105249_10045298 Ga0105249_100452983 311
141 3300013102 Ga0157371_10269845 Ga0157371_102698451 311
142 3300013297 Ga0157378_10004845 Ga0157378_100048452 311
143 3300025910 Ga0207684_10122656 Ga0207684_101226562 311
144 3300025922 Ga0207646_10019571 Ga0207646_100195716 311
145 3300025922 Ga0207646_10168120 Ga0207646_101681201 311
146 3300025941 Ga0207711_10022277 Ga0207711_100222774 311
147 3300025942 Ga0207689_10022865 Ga0207689_100228656 311
148 3300025961 Ga0207712_10093761 Ga0207712_100937613 311
149 3300026075 Ga0207708_10510761 Ga0207708_105107611 311
150 3300026118 Ga0207675_100029092 Ga0207675_1000290925 311
151 3300027907 Ga0207428_10000054 Ga0207428_10000054160 311
152 3300028380 Ga0268265_10017146 Ga0268265_100171466 311
153 3300028381 Ga0268264_10104327 Ga0268264_101043272 311
154 3300042876 Ga0451577_0000844 Ga0451577_0000844_3792_4733 311
155 3300044673 Ga0453683_0157238 Ga0453683_0157238_74_1015 311
156 3300044712 Ga0453684_0130822 Ga0453684_0130822_580_1521 311
157 3300045051 Ga0451576_0001424 Ga0451576_0001424_39522_40463 311
158 3300045051 Ga0451576_0345179 Ga0451576_0345179_156_1097 311
159 3300050507 nmdc:mga05p37_248946_c1 nmdc:mga05p37_248946_c1_217_1158 311
160 3300050507 nmdc:mga05p37_346570_c1 nmdc:mga05p37_346570_c1_293_1231 311
161 3300050510 nmdc:mga06r32_987_c1 nmdc:mga06r32_987_c1_18378_19319 311
162 3300050511 nmdc:mga08y16_1197_c1 nmdc:mga08y16_1197_c1_20395_21336 311
163 3300050515 nmdc:mga0a205_10023_c1 nmdc:mga0a205_10023_c1_2542_3483 311
164 3300050515 nmdc:mga0a205_1085_c1 nmdc:mga0a205_1085_c1_14438_15379 311
165 3300050515 nmdc:mga0a205_257415_c1 nmdc:mga0a205_257415_c1_27_971 311
166 3300054114 Ga0501084_0342409 Ga0501084_0342409_85_1029 311
167 3300005356 Ga0070674_100070434 Ga0070674_1000704343 312
168 3300005444 Ga0070694_100045982 Ga0070694_1000459823 312
169 3300005445 Ga0070708_100078623 Ga0070708_1000786231 312
170 3300005535 Ga0070684_100199325 Ga0070684_1001993253 312
171 3300005842 Ga0068858_100143738 Ga0068858_1001437382 312
172 3300006844 Ga0075428_100017990 Ga0075428_1000179902 312
173 3300006881 Ga0068865_100317958 Ga0068865_1003179582 312
174 3300009093 Ga0105240_10059583 Ga0105240_100595832 312
175 3300009094 Ga0111539_10004174 Ga0111539_100041745 312
176 3300009147 Ga0114129_10268434 Ga0114129_102684342 312
177 3300014326 Ga0157380_10000913 Ga0157380_100009138 312
178 3300014326 Ga0157380_10004916 Ga0157380_100049168 312
179 3300025908 Ga0207643_10172458 Ga0207643_101724582 312
180 3300025913 Ga0207695_10126163 Ga0207695_101261633 312
181 3300025917 Ga0207660_10085505 Ga0207660_100855052 312
182 3300025937 Ga0207669_10216488 Ga0207669_102164882 312
183 3300025938 Ga0207704_10166574 Ga0207704_101665742 312
184 3300026035 Ga0207703_10201146 Ga0207703_102011461 312
185 3300026078 Ga0207702_10090609 Ga0207702_100906093 312
186 3300027907 Ga0207428_10002086 Ga0207428_100020865 312
187 3300027907 Ga0207428_10042966 Ga0207428_100429663 312
188 3300031852 Ga0307410_10064510 Ga0307410_100645103 312
189 3300031901 Ga0307406_10095276 Ga0307406_100952762 312
190 3300031903 Ga0307407_10060086 Ga0307407_100600861 312
191 3300050507 nmdc:mga05p37_254865_c1 nmdc:mga05p37_254865_c1_667_1629 312
192 3300050511 nmdc:mga08y16_101662_c1 nmdc:mga08y16_101662_c1_1823_2797 312
193 3300005327 Ga0070658_10083883 Ga0070658_100838832 313
194 3300005438 Ga0070701_10173203 Ga0070701_101732032 313
195 3300005441 Ga0070700_100024762 Ga0070700_1000247624 313
196 3300005530 Ga0070679_100166303 Ga0070679_1001663032 313
197 3300005842 Ga0068858_100004236 Ga0068858_1000042368 313
198 3300006237 Ga0097621_100211467 Ga0097621_1002114672 313
199 3300006847 Ga0075431_100040671 Ga0075431_1000406713 313
200 3300006847 Ga0075431_100155698 Ga0075431_1001556983 313
201 3300006852 Ga0075433_10146340 Ga0075433_101463402 313
202 3300006880 Ga0075429_100016367 Ga0075429_1000163677 313
203 3300006881 Ga0068865_100154425 Ga0068865_1001544251 313
204 3300006914 Ga0075436_100055301 Ga0075436_1000553013 313
205 3300007076 Ga0075435_100435800 Ga0075435_1004358001 313
206 3300009147 Ga0114129_10084789 Ga0114129_100847894 313
207 3300009177 Ga0105248_10022329 Ga0105248_100223297 313
208 3300009177 Ga0105248_10125883 Ga0105248_101258832 313
209 3300013296 Ga0157374_10035609 Ga0157374_100356094 313
210 3300014969 Ga0157376_10018030 Ga0157376_100180303 313
211 3300025912 Ga0207707_10217647 Ga0207707_102176472 313
212 3300025919 Ga0207657_10008966 Ga0207657_100089666 313
213 3300025936 Ga0207670_10223894 Ga0207670_102238942 313
214 3300025937 Ga0207669_10159512 Ga0207669_101595121 313
215 3300025938 Ga0207704_10042950 Ga0207704_100429503 313
216 3300025941 Ga0207711_10167153 Ga0207711_101671532 313
217 3300026035 Ga0207703_10029761 Ga0207703_100297614 313
218 3300026089 Ga0207648_10105958 Ga0207648_101059583 313
219 3300026121 Ga0207683_10242964 Ga0207683_102429642 313
220 3300050507 nmdc:mga05p37_240666_c1 nmdc:mga05p37_240666_c1_1022_1990 313
221 3300050507 nmdc:mga05p37_421673_c1 nmdc:mga05p37_421673_c1_243_1205 313
222 3300050508 nmdc:mga09592_30220_c1 nmdc:mga09592_30220_c1_2221_3183 313
223 3300050510 nmdc:mga06r32_75691_c1 nmdc:mga06r32_75691_c1_1607_2569 313
224 3300050510 nmdc:mga06r32_80538_c1 nmdc:mga06r32_80538_c1_858_1802 313
225 3300050512 nmdc:mga0n895_87429_c1 nmdc:mga0n895_87429_c1_817_1806 313
226 3300050515 nmdc:mga0a205_307759_c1 nmdc:mga0a205_307759_c1_222_1184 313
227 3300053104 Ga0500556_0005539 Ga0500556_0005539_1182_2141 313
228 3300002459 JGI24751J29686_10006372 JGI24751J29686_100063723 314
229 3300005290 Ga0065712_10003970 Ga0065712_100039703 314
230 3300005293 Ga0065715_10285746 Ga0065715_102857461 314
231 3300005328 Ga0070676_10316703 Ga0070676_103167031 314
232 3300005330 Ga0070690_100005710 Ga0070690_1000057104 314
233 3300005330 Ga0070690_100217162 Ga0070690_1002171621 314
234 3300005331 Ga0070670_100040942 Ga0070670_1000409422 314
235 3300005335 Ga0070666_10212756 Ga0070666_102127561 314
236 3300005343 Ga0070687_100018562 Ga0070687_1000185623 314
237 3300005353 Ga0070669_100025806 Ga0070669_1000258062 314
238 3300005354 Ga0070675_100000647 Ga0070675_10000064725 314
239 3300005355 Ga0070671_100108853 Ga0070671_1001088532 314
240 3300005356 Ga0070674_100002099 Ga0070674_1000020997 314
241 3300005356 Ga0070674_100022357 Ga0070674_1000223573 314
242 3300005356 Ga0070674_100023188 Ga0070674_1000231883 314
243 3300005356 Ga0070674_100166586 Ga0070674_1001665861 314
244 3300005364 Ga0070673_100115092 Ga0070673_1001150923 314
245 3300005364 Ga0070673_100404620 Ga0070673_1004046202 314
246 3300005366 Ga0070659_100106334 Ga0070659_1001063343 314
247 3300005367 Ga0070667_100013351 Ga0070667_1000133514 314
248 3300005434 Ga0070709_10070578 Ga0070709_100705782 314
249 3300005436 Ga0070713_100004221 Ga0070713_1000042214 314
250 3300005444 Ga0070694_100000539 Ga0070694_1000005394 314
251 3300005445 Ga0070708_100124773 Ga0070708_1001247731 314
252 3300005456 Ga0070678_100449915 Ga0070678_1004499151 314
253 3300005457 Ga0070662_100116918 Ga0070662_1001169182 314
254 3300005458 Ga0070681_10433715 Ga0070681_104337151 314
255 3300005459 Ga0068867_100309444 Ga0068867_1003094442 314
256 3300005468 Ga0070707_100530767 Ga0070707_1005307671 314
257 3300005518 Ga0070699_100004615 Ga0070699_1000046153 314
258 3300005518 Ga0070699_100081083 Ga0070699_1000810832 314
259 3300005530 Ga0070679_100222756 Ga0070679_1002227561 314
260 3300005536 Ga0070697_100013459 Ga0070697_1000134596 314
261 3300005543 Ga0070672_100033003 Ga0070672_1000330032 314
262 3300005544 Ga0070686_100004247 Ga0070686_1000042474 314
263 3300005544 Ga0070686_100327751 Ga0070686_1003277511 314
264 3300005545 Ga0070695_100000815 Ga0070695_10000081512 314
265 3300005546 Ga0070696_100473446 Ga0070696_1004734461 314
266 3300005548 Ga0070665_100000771 Ga0070665_10000077114 314
267 3300005548 Ga0070665_100013960 Ga0070665_1000139605 314
268 3300005549 Ga0070704_100009438 Ga0070704_1000094385 314
269 3300005549 Ga0070704_100096686 Ga0070704_1000966863 314
270 3300005577 Ga0068857_100103243 Ga0068857_1001032432 314
271 3300005578 Ga0068854_100028019 Ga0068854_1000280192 314
272 3300005617 Ga0068859_100048348 Ga0068859_1000483485 314
273 3300005617 Ga0068859_100064107 Ga0068859_1000641073 314
274 3300005617 Ga0068859_100503216 Ga0068859_1005032161 314
275 3300005618 Ga0068864_100007993 Ga0068864_1000079933 314
276 3300005719 Ga0068861_100101688 Ga0068861_1001016882 314
277 3300005719 Ga0068861_100353348 Ga0068861_1003533481 314
278 3300005841 Ga0068863_100004024 Ga0068863_10000402411 314
279 3300005842 Ga0068858_100118038 Ga0068858_1001180382 314
280 3300005842 Ga0068858_100140039 Ga0068858_1001400393 314
281 3300005844 Ga0068862_100224523 Ga0068862_1002245233 314
282 3300005937 Ga0081455_10185420 Ga0081455_101854202 314
283 3300006042 Ga0075368_10096496 Ga0075368_100964962 314
284 3300006058 Ga0075432_10019274 Ga0075432_100192741 314
285 3300006237 Ga0097621_100041369 Ga0097621_1000413692 314
286 3300006237 Ga0097621_100242225 Ga0097621_1002422251 314
287 3300006358 Ga0068871_100013993 Ga0068871_1000139935 314
288 3300006844 Ga0075428_100000003 Ga0075428_100000003140 314
289 3300006844 Ga0075428_100108374 Ga0075428_1001083742 314
290 3300006844 Ga0075428_100456412 Ga0075428_1004564122 314
291 3300006852 Ga0075433_10039426 Ga0075433_100394264 314
292 3300006852 Ga0075433_10322403 Ga0075433_103224032 314
293 3300006852 Ga0075433_10345290 Ga0075433_103452902 314
294 3300006871 Ga0075434_100007059 Ga0075434_1000070594 314
295 3300006871 Ga0075434_100010070 Ga0075434_1000100705 314
296 3300006871 Ga0075434_100061070 Ga0075434_1000610704 314
297 3300006871 Ga0075434_100113712 Ga0075434_1001137123 314
298 3300006881 Ga0068865_100145859 Ga0068865_1001458591 314
299 3300006914 Ga0075436_100003909 Ga0075436_1000039096 314
300 3300006914 Ga0075436_100027045 Ga0075436_1000270452 314
301 3300006914 Ga0075436_100034357 Ga0075436_1000343573 314
302 3300006914 Ga0075436_100161975 Ga0075436_1001619751 314
303 3300006914 Ga0075436_100313134 Ga0075436_1003131341 314
304 3300006931 Ga0097620_100048349 Ga0097620_1000483495 314
305 3300006931 Ga0097620_100064105 Ga0097620_1000641053 314
306 3300006931 Ga0097620_100503226 Ga0097620_1005032261 314
307 3300007076 Ga0075435_100000111 Ga0075435_1000001116 314
308 3300007076 Ga0075435_100000810 Ga0075435_10000081014 314
309 3300007076 Ga0075435_100009027 Ga0075435_1000090276 314
310 3300007076 Ga0075435_100015330 Ga0075435_1000153302 314
311 3300007076 Ga0075435_100093793 Ga0075435_1000937933 314
312 3300009093 Ga0105240_10185190 Ga0105240_101851901 314
313 3300009094 Ga0111539_10000001 Ga0111539_10000001399 314
314 3300009094 Ga0111539_10000827 Ga0111539_1000082727 314
315 3300009094 Ga0111539_10032764 Ga0111539_100327646 314
316 3300009094 Ga0111539_10176809 Ga0111539_101768092 314
317 3300009094 Ga0111539_10765107 Ga0111539_107651072 314
318 3300009098 Ga0105245_10275849 Ga0105245_102758492 314
319 3300009101 Ga0105247_10159485 Ga0105247_101594852 314
320 3300009147 Ga0114129_10002549 Ga0114129_1000254924 314
321 3300009147 Ga0114129_10010179 Ga0114129_100101798 314
322 3300009147 Ga0114129_10046703 Ga0114129_100467034 314
323 3300009147 Ga0114129_10096563 Ga0114129_100965632 314
324 3300009147 Ga0114129_10490390 Ga0114129_104903901 314
325 3300009148 Ga0105243_10009141 Ga0105243_100091419 314
326 3300009174 Ga0105241_10071097 Ga0105241_100710973 314
327 3300009176 Ga0105242_10032323 Ga0105242_100323233 314
328 3300009176 Ga0105242_10094726 Ga0105242_100947262 314
329 3300009177 Ga0105248_10079589 Ga0105248_100795893 314
330 3300009177 Ga0105248_10166242 Ga0105248_101662423 314
331 3300009177 Ga0105248_10255673 Ga0105248_102556732 314
332 3300009177 Ga0105248_10655231 Ga0105248_106552311 314
333 3300009553 Ga0105249_10160666 Ga0105249_101606662 314
334 3300009553 Ga0105249_10173772 Ga0105249_101737723 314
335 3300013296 Ga0157374_10002165 Ga0157374_100021652 314
336 3300013296 Ga0157374_10152617 Ga0157374_101526173 314
337 3300013297 Ga0157378_10593507 Ga0157378_105935071 314
338 3300013306 Ga0163162_10066865 Ga0163162_100668654 314
339 3300013306 Ga0163162_10102842 Ga0163162_101028422 314
340 3300013306 Ga0163162_10464174 Ga0163162_104641741 314
341 3300013308 Ga0157375_10303562 Ga0157375_103035623 314
342 3300014325 Ga0163163_10014722 Ga0163163_100147224 314
343 3300014325 Ga0163163_10078025 Ga0163163_100780254 314
344 3300014326 Ga0157380_10102203 Ga0157380_101022032 314
345 3300014326 Ga0157380_10260463 Ga0157380_102604632 314
346 3300014745 Ga0157377_10172127 Ga0157377_101721271 314
347 3300014968 Ga0157379_10053981 Ga0157379_100539813 314
348 3300014969 Ga0157376_10035742 Ga0157376_100357423 314
349 3300014969 Ga0157376_10046931 Ga0157376_100469313 314
350 3300025903 Ga0207680_10152108 Ga0207680_101521082 314
351 3300025906 Ga0207699_10037693 Ga0207699_100376933 314
352 3300025911 Ga0207654_10017021 Ga0207654_100170213 314
353 3300025918 Ga0207662_10006467 Ga0207662_100064673 314
354 3300025922 Ga0207646_10037673 Ga0207646_100376733 314
355 3300025922 Ga0207646_10052394 Ga0207646_100523944 314
356 3300025922 Ga0207646_10395510 Ga0207646_103955101 314
357 3300025923 Ga0207681_10007925 Ga0207681_100079256 314
358 3300025926 Ga0207659_10001565 Ga0207659_1000156511 314
359 3300025927 Ga0207687_10159403 Ga0207687_101594032 314
360 3300025928 Ga0207700_10124554 Ga0207700_101245542 314
361 3300025931 Ga0207644_10200932 Ga0207644_102009322 314
362 3300025934 Ga0207686_10016274 Ga0207686_100162743 314
363 3300025936 Ga0207670_10242670 Ga0207670_102426701 314
364 3300025937 Ga0207669_10022483 Ga0207669_100224833 314
365 3300025937 Ga0207669_10034198 Ga0207669_100341983 314
366 3300025939 Ga0207665_10050700 Ga0207665_100507002 314
367 3300025940 Ga0207691_10285907 Ga0207691_102859071 314
368 3300025941 Ga0207711_10053644 Ga0207711_100536443 314
369 3300025941 Ga0207711_10228384 Ga0207711_102283841 314
370 3300025941 Ga0207711_10372907 Ga0207711_103729071 314
371 3300025941 Ga0207711_10562836 Ga0207711_105628361 314
372 3300025945 Ga0207679_10067882 Ga0207679_100678822 314
373 3300025949 Ga0207667_10402344 Ga0207667_104023441 314
374 3300025960 Ga0207651_10277997 Ga0207651_102779971 314
375 3300025961 Ga0207712_10284136 Ga0207712_102841362 314
376 3300025981 Ga0207640_10019459 Ga0207640_100194593 314
377 3300025981 Ga0207640_10046696 Ga0207640_100466963 314
378 3300026035 Ga0207703_10089247 Ga0207703_100892473 314
379 3300026035 Ga0207703_10117230 Ga0207703_101172302 314
380 3300026035 Ga0207703_10451909 Ga0207703_104519092 314
381 3300026075 Ga0207708_10128649 Ga0207708_101286493 314
382 3300026088 Ga0207641_10001443 Ga0207641_1000144312 314
383 3300026088 Ga0207641_10359227 Ga0207641_103592272 314
384 3300026089 Ga0207648_10058005 Ga0207648_100580052 314
385 3300026089 Ga0207648_10160594 Ga0207648_101605942 314
386 3300026095 Ga0207676_10005302 Ga0207676_100053024 314
387 3300026095 Ga0207676_10013484 Ga0207676_100134846 314
388 3300026116 Ga0207674_10097991 Ga0207674_100979912 314
389 3300026118 Ga0207675_100009768 Ga0207675_1000097688 314
390 3300027907 Ga0207428_10000002 Ga0207428_10000002410 314
391 3300027907 Ga0207428_10090168 Ga0207428_100901682 314
392 3300028379 Ga0268266_10003281 Ga0268266_1000328112 314
393 3300028380 Ga0268265_10205765 Ga0268265_102057651 314
394 3300028381 Ga0268264_10143714 Ga0268264_101437142 314
395 3300034816 Ga0373930_0000697 Ga0373930_0000697_3217_4164 314
396 3300034817 Ga0373948_0002506 Ga0373948_0002506_1255_2202 314
397 3300034819 Ga0373958_0018223 Ga0373958_0018223_312_1259 314
398 3300034820 Ga0373959_0001519 Ga0373959_0001519_1283_2230 314
399 3300034957 Ga0373938_0002592 Ga0373938_0002592_1394_2341 314
400 3300035085 Ga0373929_0013702 Ga0373929_0013702_576_1523 314
401 3300035090 Ga0373949_0004859 Ga0373949_0004859_1548_2495 314
402 3300035091 Ga0373951_0015273 Ga0373951_0015273_431_1378 314
403 3300035111 Ga0373923_0109693 Ga0373923_0109693_35_1000 314
404 3300035112 Ga0373932_0001911 Ga0373932_0001911_3632_4579 314
405 3300035113 Ga0373936_0090375 Ga0373936_0090375_199_1164 314
406 3300035114 Ga0373939_0020814 Ga0373939_0020814_711_1658 314
407 3300035115 Ga0373941_0003424 Ga0373941_0003424_1165_2112 314
408 3300035121 Ga0373960_0001571 Ga0373960_0001571_3947_4894 314
409 3300035171 Ga0373946_0016584 Ga0373946_0016584_1682_2647 314
410 3300035241 Ga0373961_0001372 Ga0373961_0001372_5825_6772 314
411 3300035242 Ga0373962_0021861 Ga0373962_0021861_527_1474 314
412 3300035410 Ga0373924_0071867 Ga0373924_0071867_219_1184 314
413 3300035691 Ga0373931_0049040 Ga0373931_0049040_445_1392 314
414 3300035695 Ga0373927_0119777 Ga0373927_0119777_189_1154 314
415 3300036401 Ga0373937_0297260 Ga0373937_0297260_548_1492 314
416 3300037068 Ga0373925_0007435 Ga0373925_0007435_4603_5568 314
417 3300046454 Ga0495592_0018363 Ga0495592_0018363_3577_4536 314
418 3300046473 Ga0495582_0127316 Ga0495582_0127316_134_1081 314
419 3300046511 Ga0495608_0062166 Ga0495608_0062166_314_1279 314
420 3300046516 Ga0495628_0084785 Ga0495628_0084785_847_1812 314
421 3300046517 Ga0495630_0006053 Ga0495630_0006053_488_1453 314
422 3300046543 Ga0495645_0172974 Ga0495645_0172974_479_1444 314
423 3300046559 Ga0495667_0099656 Ga0495667_0099656_567_1532 314
424 3300046675 Ga0495657_0194358 Ga0495657_0194358_142_1107 314
425 3300046681 Ga0495647_0039820 Ga0495647_0039820_42_989 314
426 3300046684 Ga0495669_0109870 Ga0495669_0109870_290_1237 314
427 3300046689 Ga0495613_0001615 Ga0495613_0001615_1737_2702 314
428 3300046809 Ga0495600_0042052 Ga0495600_0042052_1221_2186 314
429 3300047317 Ga0495604_0079335 Ga0495604_0079335_741_1685 314
430 3300047319 Ga0495674_0010439 Ga0495674_0010439_1400_2365 314
431 3300048904 Ga0496101_0000773 Ga0496101_0000773_11682_12647 314
432 3300048907 Ga0496104_0048058 Ga0496104_0048058_381_1346 314
433 3300048907 Ga0496104_0133289 Ga0496104_0133289_1314_2258 314
434 3300048907 Ga0496104_0364203 Ga0496104_0364203_201_1148 314
435 3300048909 Ga0496106_0134316 Ga0496106_0134316_733_1680 314
436 3300048911 Ga0496108_0006865 Ga0496108_0006865_382_1329 314
437 3300048912 Ga0496109_0572768 Ga0496109_0572768_106_1053 314
438 3300048915 Ga0496112_0005637 Ga0496112_0005637_1390_2337 314
439 3300048915 Ga0496112_0466922 Ga0496112_0466922_207_1151 314
440 3300048917 Ga0496114_0000233 Ga0496114_0000233_34214_35179 314
441 3300048917 Ga0496114_0031034 Ga0496114_0031034_611_1558 314
442 3300049576 Ga0501040_0108644 Ga0501040_0108644_686_1657 314
443 3300049591 Ga0501075_0009690 Ga0501075_0009690_1675_2646 314
444 3300049741 Ga0501079_0197626 Ga0501079_0197626_176_1147 314
445 3300050507 nmdc:mga05p37_13544_c1 nmdc:mga05p37_13544_c1_8373_9320 314
446 3300050507 nmdc:mga05p37_15680_c1 nmdc:mga05p37_15680_c1_877_1824 314
447 3300050507 nmdc:mga05p37_45139_c1 nmdc:mga05p37_45139_c1_2412_3359 314
448 3300050507 nmdc:mga05p37_626998_c1 nmdc:mga05p37_626998_c1_10_957 314
449 3300050511 nmdc:mga08y16_13575_c1 nmdc:mga08y16_13575_c1_5418_6365 314
450 3300050511 nmdc:mga08y16_20418_c1 nmdc:mga08y16_20418_c1_831_1778 314
451 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_429932_430912 314
452 3300050512 nmdc:mga0n895_18764_c1 nmdc:mga0n895_18764_c1_3739_4686 314
453 3300050512 nmdc:mga0n895_362399_c1 nmdc:mga0n895_362399_c1_205_1152 314
454 3300050512 nmdc:mga0n895_45488_c1 nmdc:mga0n895_45488_c1_133_1080 314
455 3300050512 nmdc:mga0n895_5949_c1 nmdc:mga0n895_5949_c1_5254_6201 314
456 3300050513 nmdc:mga0rr50_30525_c1 nmdc:mga0rr50_30525_c1_1381_2331 314
457 3300050513 nmdc:mga0rr50_3_c1 nmdc:mga0rr50_3_c1_6820_7767 314
458 3300050513 nmdc:mga0rr50_40183_c1 nmdc:mga0rr50_40183_c1_511_1458 314
459 3300050513 nmdc:mga0rr50_43000_c1 nmdc:mga0rr50_43000_c1_1970_2917 314
460 3300050513 nmdc:mga0rr50_5622_c1 nmdc:mga0rr50_5622_c1_5775_6722 314
461 3300050513 nmdc:mga0rr50_62931_c1 nmdc:mga0rr50_62931_c1_1203_2150 314
462 3300050514 nmdc:mga08x19_239783_c1 nmdc:mga08x19_239783_c1_231_1178 314
463 3300050514 nmdc:mga08x19_262152_c1 nmdc:mga08x19_262152_c1_41_988 314
464 3300050514 nmdc:mga08x19_627_c1 nmdc:mga08x19_627_c1_3726_4673 314
465 3300050514 nmdc:mga08x19_96312_c1 nmdc:mga08x19_96312_c1_264_1214 314
466 3300050515 nmdc:mga0a205_273574_c1 nmdc:mga0a205_273574_c1_510_1457 314
467 3300050515 nmdc:mga0a205_57111_c1 nmdc:mga0a205_57111_c1_1787_2734 314
468 3300050515 nmdc:mga0a205_58999_c1 nmdc:mga0a205_58999_c1_1810_2757 314
469 3300050515 nmdc:mga0a205_66025_c1 nmdc:mga0a205_66025_c1_1049_1996 314
470 3300053077 Ga0495601_0002222 Ga0495601_0002222_2529_3494 314
471 3300053085 Ga0495619_0022423 Ga0495619_0022423_2681_3646 314
472 3300053085 Ga0495619_0198688 Ga0495619_0198688_320_1267 314
473 3300060353 Ga0501082_0027944 Ga0501082_0027944_2985_3956 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

146

224

0.97

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

5

294

0.92

PF00890

FAD_binding_2

FAD binding domain

6

46

0.9

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

58

277

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uwy-assembly1.cif.gz_A-2 the crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005 0.9433 1 308
5uwy-assembly1.cif.gz_A-2 the crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005 0.9404 1 308
4gcm-assembly1.cif.gz_A crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. aureus mu50 at 1.80 a resolution 0.9382 6 306
2q7v-assembly1.cif.gz_B crystal structure of deinococcus radiodurans thioredoxin reductase 0.9364 6 308
5uth-assembly1.cif.gz_A crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad 0.9342 3 306
ID Description Score Start End Superfamily
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9689 116 240 3.50.50.60
2q0kA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9638 116 240 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9613 116 240 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9583 116 240 3.50.50.60
2q0kA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9563 116 240 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3C0YJU2-F1-model_v4 deleted 0.996 134 203
AF-A0A3C0YJU2-F1-model_v4 deleted 0.9821 134 203
AF-A0A3D5UWY6-F1-model_v4 Thioredoxin-disulfide reductase 0.9803 141 232 GO:0016491
AF-K1UEN0-F1-model_v4 Protein containing Pyridine nucleotide-disulfide oxidoreductase, NAD-binding region domain protein (EC 1.-.-.-) 0.9741 139 206 GO:0016491
AF-A0A7H4N4U0-F1-model_v4 Alkyl hydroperoxide reductase protein F (EC 1.8.1.-) 0.9664 118 200 GO:0016668

Feature Viewer

pLDDT pTM Quality
88.54 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map