F450985
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 473 | 223 | 472 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10185420|Ga0081455_101854202 |
| Length | 339 |
| Sequence | MPSLRNVIIIGSGPAGLTAALYSARANLQPLLIEGIEAGGQLMLTTMVENFPGYRDGIMGPDLMAEMRAQAERFGTEIVQGNVTSVDLGSQPMVVKTSEHDYQSKTIIIATGASARLLGLPSERALMGHGVSTCATCDGYFFRGQDIAVVGGGDSAMEEAIFLTRFASKVTVVHRRGTLRASKIMQDKARANDKIAWQLDSEVEEIKDGGKGEVTSMVLRNKRTGGRTEVPVSGVFVAIGHTPNTSMFQGQLELDRNGYIMTHDGSKTSVAGVFACGDVQDHIYRQAITAAGTGCMAALDAEWYLRDNPAVPTPEALEGTGDLAEQQWAPAMPQPTRSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 139 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 140 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 141 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 142 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 143 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 144 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 150 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 155 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 161 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 162 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 163 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 164 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 184 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 185 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 188 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 189 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 220 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 222 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.42 |
| Nodule | 0 |
| Rhizoplane | 2.75 |
| Rhizosphere | 96.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10006372 | 3300002459 | Bacteria | 2404 |
| 2 | Ga0065712_10003970 | 3300005290 | Bacteria | 5176 |
| 3 | Ga0065715_10285746 | 3300005293 | Bacteria | 1075 |
| 4 | Ga0070658_10083883 | 3300005327 | Bacteria | 2620 |
| 5 | Ga0070676_10316703 | 3300005328 | Bacteria | 1062 |
| 6 | Ga0070690_100005710 | 3300005330 | Bacteria | 7009 |
| 7 | Ga0070690_100217162 | 3300005330 | Bacteria | 1338 |
| 8 | Ga0070670_100040942 | 3300005331 | Bacteria | 3982 |
| 9 | Ga0070677_10144203 | 3300005333 | Bacteria | 1102 |
| 10 | Ga0070666_10212756 | 3300005335 | Bacteria | 1362 |
| 11 | Ga0070680_100023646 | 3300005336 | Bacteria | 4904 |
| 12 | Ga0070680_100434571 | 3300005336 | Bacteria | 1120 |
| 13 | Ga0070687_100018562 | 3300005343 | Bacteria | 3220 |
| 14 | Ga0070669_100025806 | 3300005353 | Bacteria | 4222 |
| 15 | Ga0070675_100000647 | 3300005354 | Bacteria | 24078 |
| 16 | Ga0070671_100108853 | 3300005355 | Bacteria | 2327 |
| 17 | Ga0070674_100002099 | 3300005356 | Bacteria | 10928 |
| 18 | Ga0070674_100022357 | 3300005356 | Bacteria | 4078 |
| 19 | Ga0070674_100023188 | 3300005356 | Bacteria | 4014 |
| 20 | Ga0070674_100070434 | 3300005356 | Bacteria | 2471 |
| 21 | Ga0070674_100166586 | 3300005356 | Bacteria | 1677 |
| 22 | Ga0070673_100115092 | 3300005364 | Bacteria | 2236 |
| 23 | Ga0070673_100404620 | 3300005364 | Bacteria | 1221 |
| 24 | Ga0070659_100106334 | 3300005366 | Bacteria | 2262 |
| 25 | Ga0070667_100013351 | 3300005367 | Bacteria | 6787 |
| 26 | Ga0070709_10070578 | 3300005434 | Bacteria | 2252 |
| 27 | Ga0070713_100004221 | 3300005436 | Bacteria | 9600 |
| 28 | Ga0070701_10173203 | 3300005438 | Bacteria | 1258 |
| 29 | Ga0070705_100198998 | 3300005440 | Bacteria | 1372 |
| 30 | Ga0070700_100024762 | 3300005441 | Bacteria | 3528 |
| 31 | Ga0070694_100000539 | 3300005444 | Bacteria | 20865 |
| 32 | Ga0070694_100023467 | 3300005444 | Bacteria | 3968 |
| 33 | Ga0070694_100045982 | 3300005444 | Bacteria | 2928 |
| 34 | Ga0070708_100032541 | 3300005445 | Bacteria | 4524 |
| 35 | Ga0070708_100044610 | 3300005445 | Bacteria | 3900 |
| 36 | Ga0070708_100067071 | 3300005445 | Bacteria | 3221 |
| 37 | Ga0070708_100078623 | 3300005445 | Bacteria | 2982 |
| 38 | Ga0070708_100085018 | 3300005445 | Bacteria | 2870 |
| 39 | Ga0070708_100124773 | 3300005445 | Bacteria | 2379 |
| 40 | Ga0070678_100449915 | 3300005456 | Bacteria | 1128 |
| 41 | Ga0070662_100116918 | 3300005457 | Bacteria | 2039 |
| 42 | Ga0070662_100294011 | 3300005457 | Bacteria | 1317 |
| 43 | Ga0070681_10199354 | 3300005458 | Bacteria | 1920 |
| 44 | Ga0070681_10433715 | 3300005458 | Bacteria | 1226 |
| 45 | Ga0068867_100309444 | 3300005459 | Bacteria | 1305 |
| 46 | Ga0070706_100044948 | 3300005467 | Bacteria | 4079 |
| 47 | Ga0070706_100259175 | 3300005467 | Bacteria | 1623 |
| 48 | Ga0070707_100011796 | 3300005468 | Bacteria | 8160 |
| 49 | Ga0070707_100114939 | 3300005468 | Bacteria | 2611 |
| 50 | Ga0070707_100530767 | 3300005468 | Bacteria | 1139 |
| 51 | Ga0070698_100044431 | 3300005471 | Bacteria | 4549 |
| 52 | Ga0070698_100087101 | 3300005471 | Bacteria | 3109 |
| 53 | Ga0070698_100087554 | 3300005471 | Bacteria | 3100 |
| 54 | Ga0070699_100004615 | 3300005518 | Bacteria | 12188 |
| 55 | Ga0070699_100014596 | 3300005518 | Bacteria | 6756 |
| 56 | Ga0070699_100040142 | 3300005518 | Bacteria | 4053 |
| 57 | Ga0070699_100081083 | 3300005518 | Bacteria | 2828 |
| 58 | Ga0070699_100124876 | 3300005518 | Bacteria | 2265 |
| 59 | Ga0070679_100166303 | 3300005530 | Bacteria | 2179 |
| 60 | Ga0070679_100222756 | 3300005530 | Bacteria | 1847 |
| 61 | Ga0070684_100199325 | 3300005535 | Bacteria | 1823 |
| 62 | Ga0070697_100013459 | 3300005536 | Bacteria | 6419 |
| 63 | Ga0070697_100067271 | 3300005536 | Bacteria | 2930 |
| 64 | Ga0070697_100080212 | 3300005536 | Bacteria | 2688 |
| 65 | Ga0070672_100033003 | 3300005543 | Bacteria | 3915 |
| 66 | Ga0070686_100004247 | 3300005544 | Bacteria | 7893 |
| 67 | Ga0070686_100327751 | 3300005544 | Bacteria | 1144 |
| 68 | Ga0070695_100000815 | 3300005545 | Bacteria | 16797 |
| 69 | Ga0070696_100473446 | 3300005546 | Bacteria | 992 |
| 70 | Ga0070665_100000771 | 3300005548 | Bacteria | 42242 |
| 71 | Ga0070665_100013960 | 3300005548 | Bacteria | 8078 |
| 72 | Ga0070704_100009438 | 3300005549 | Bacteria | 5893 |
| 73 | Ga0070704_100018274 | 3300005549 | Bacteria | 4479 |
| 74 | Ga0070704_100048668 | 3300005549 | Bacteria | 2969 |
| 75 | Ga0070704_100096686 | 3300005549 | Bacteria | 2214 |
| 76 | Ga0068857_100103243 | 3300005577 | Bacteria | 2560 |
| 77 | Ga0068854_100028019 | 3300005578 | Bacteria | 3888 |
| 78 | Ga0068859_100048348 | 3300005617 | Bacteria | 4273 |
| 79 | Ga0068859_100064107 | 3300005617 | Bacteria | 3707 |
| 80 | Ga0068859_100092001 | 3300005617 | Bacteria | 3084 |
| 81 | Ga0068859_100127949 | 3300005617 | Bacteria | 2610 |
| 82 | Ga0068859_100503216 | 3300005617 | Bacteria | 1307 |
| 83 | Ga0068864_100007993 | 3300005618 | Bacteria | 8721 |
| 84 | Ga0068861_100101688 | 3300005719 | Bacteria | 2287 |
| 85 | Ga0068861_100353348 | 3300005719 | Bacteria | 1290 |
| 86 | Ga0068863_100004024 | 3300005841 | Bacteria | 14515 |
| 87 | Ga0068858_100004236 | 3300005842 | Bacteria | 14116 |
| 88 | Ga0068858_100118038 | 3300005842 | Bacteria | 2480 |
| 89 | Ga0068858_100140039 | 3300005842 | Bacteria | 2271 |
| 90 | Ga0068858_100143738 | 3300005842 | Bacteria | 2240 |
| 91 | Ga0068860_100088821 | 3300005843 | Bacteria | 2942 |
| 92 | Ga0068862_100128643 | 3300005844 | Bacteria | 2238 |
| 93 | Ga0068862_100224523 | 3300005844 | Bacteria | 1702 |
| 94 | Ga0081455_10185420 | 3300005937 | Bacteria | 1572 |
| 95 | Ga0081538_10016148 | 3300005981 | Bacteria | 5740 |
| 96 | Ga0075368_10096496 | 3300006042 | Bacteria | 1212 |
| 97 | Ga0075432_10019274 | 3300006058 | Bacteria | 2330 |
| 98 | Ga0097621_100041369 | 3300006237 | Bacteria | 3710 |
| 99 | Ga0097621_100211467 | 3300006237 | Bacteria | 1687 |
| 100 | Ga0097621_100242225 | 3300006237 | Bacteria | 1577 |
| 101 | Ga0068871_100013993 | 3300006358 | Bacteria | 5969 |
| 102 | Ga0075428_100000003 | 3300006844 | Bacteria | 365483 |
| 103 | Ga0075428_100017990 | 3300006844 | Bacteria | 7809 |
| 104 | Ga0075428_100108374 | 3300006844 | Bacteria | 3027 |
| 105 | Ga0075428_100456412 | 3300006844 | Bacteria | 1369 |
| 106 | Ga0075430_100026510 | 3300006846 | Bacteria | 4929 |
| 107 | Ga0075430_100181583 | 3300006846 | Bacteria | 1750 |
| 108 | Ga0075431_100000072 | 3300006847 | Bacteria | 58754 |
| 109 | Ga0075431_100040671 | 3300006847 | Bacteria | 4791 |
| 110 | Ga0075431_100155698 | 3300006847 | Bacteria | 2351 |
| 111 | Ga0075433_10003370 | 3300006852 | Bacteria | 12351 |
| 112 | Ga0075433_10014649 | 3300006852 | Bacteria | 6413 |
| 113 | Ga0075433_10038914 | 3300006852 | Bacteria | 4110 |
| 114 | Ga0075433_10039426 | 3300006852 | Bacteria | 4084 |
| 115 | Ga0075433_10085132 | 3300006852 | Bacteria | 2791 |
| 116 | Ga0075433_10146340 | 3300006852 | Bacteria | 2100 |
| 117 | Ga0075433_10322403 | 3300006852 | Bacteria | 1367 |
| 118 | Ga0075433_10345290 | 3300006852 | Bacteria | 1315 |
| 119 | Ga0075434_100007059 | 3300006871 | Bacteria | 10368 |
| 120 | Ga0075434_100010070 | 3300006871 | Bacteria | 8852 |
| 121 | Ga0075434_100019748 | 3300006871 | Bacteria | 6524 |
| 122 | Ga0075434_100032830 | 3300006871 | Bacteria | 5120 |
| 123 | Ga0075434_100061070 | 3300006871 | Bacteria | 3749 |
| 124 | Ga0075434_100113712 | 3300006871 | Bacteria | 2719 |
| 125 | Ga0075429_100016367 | 3300006880 | Bacteria | 6427 |
| 126 | Ga0075429_100091375 | 3300006880 | Bacteria | 2656 |
| 127 | Ga0068865_100145859 | 3300006881 | Bacteria | 1790 |
| 128 | Ga0068865_100154425 | 3300006881 | Bacteria | 1744 |
| 129 | Ga0068865_100317958 | 3300006881 | Bacteria | 1251 |
| 130 | Ga0075436_100003909 | 3300006914 | Bacteria | 10209 |
| 131 | Ga0075436_100027045 | 3300006914 | Bacteria | 3950 |
| 132 | Ga0075436_100034357 | 3300006914 | Bacteria | 3496 |
| 133 | Ga0075436_100055301 | 3300006914 | Bacteria | 2740 |
| 134 | Ga0075436_100161975 | 3300006914 | Bacteria | 1577 |
| 135 | Ga0075436_100313134 | 3300006914 | Bacteria | 1127 |
| 136 | Ga0097620_100048349 | 3300006931 | Bacteria | 4273 |
| 137 | Ga0097620_100064105 | 3300006931 | Bacteria | 3707 |
| 138 | Ga0097620_100091999 | 3300006931 | Bacteria | 3084 |
| 139 | Ga0097620_100127949 | 3300006931 | Bacteria | 2610 |
| 140 | Ga0097620_100503226 | 3300006931 | Bacteria | 1307 |
| 141 | Ga0075435_100000111 | 3300007076 | Bacteria | 44957 |
| 142 | Ga0075435_100000810 | 3300007076 | Bacteria | 19471 |
| 143 | Ga0075435_100009027 | 3300007076 | Bacteria | 7189 |
| 144 | Ga0075435_100015330 | 3300007076 | Bacteria | 5759 |
| 145 | Ga0075435_100093793 | 3300007076 | Bacteria | 2480 |
| 146 | Ga0075435_100192920 | 3300007076 | Bacteria | 1725 |
| 147 | Ga0075435_100395655 | 3300007076 | Bacteria | 1188 |
| 148 | Ga0075435_100435800 | 3300007076 | Bacteria | 1129 |
| 149 | Ga0075435_100482169 | 3300007076 | Bacteria | 1071 |
| 150 | Ga0099794_10038222 | 3300007265 | Bacteria | 2273 |
| 151 | Ga0105240_10059583 | 3300009093 | Bacteria | 4763 |
| 152 | Ga0105240_10185190 | 3300009093 | Bacteria | 2453 |
| 153 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 154 | Ga0111539_10000238 | 3300009094 | Bacteria | 65613 |
| 155 | Ga0111539_10000827 | 3300009094 | Bacteria | 40203 |
| 156 | Ga0111539_10004174 | 3300009094 | Bacteria | 18954 |
| 157 | Ga0111539_10032764 | 3300009094 | Bacteria | 6311 |
| 158 | Ga0111539_10176809 | 3300009094 | Bacteria | 2493 |
| 159 | Ga0111539_10591834 | 3300009094 | Bacteria | 1292 |
| 160 | Ga0111539_10765107 | 3300009094 | Bacteria | 1124 |
| 161 | Ga0105245_10275849 | 3300009098 | Bacteria | 1642 |
| 162 | Ga0105247_10026129 | 3300009101 | Bacteria | 3525 |
| 163 | Ga0105247_10159485 | 3300009101 | Bacteria | 1492 |
| 164 | Ga0114129_10002549 | 3300009147 | Bacteria | 25304 |
| 165 | Ga0114129_10010179 | 3300009147 | Bacteria | 13406 |
| 166 | Ga0114129_10046703 | 3300009147 | Bacteria | 6085 |
| 167 | Ga0114129_10084789 | 3300009147 | Bacteria | 4398 |
| 168 | Ga0114129_10084958 | 3300009147 | Bacteria | 4392 |
| 169 | Ga0114129_10096563 | 3300009147 | Bacteria | 4091 |
| 170 | Ga0114129_10183420 | 3300009147 | Bacteria | 2846 |
| 171 | Ga0114129_10268434 | 3300009147 | Bacteria | 2284 |
| 172 | Ga0114129_10300457 | 3300009147 | Bacteria | 2140 |
| 173 | Ga0114129_10302351 | 3300009147 | Bacteria | 2132 |
| 174 | Ga0114129_10359084 | 3300009147 | Bacteria | 1928 |
| 175 | Ga0114129_10407818 | 3300009147 | Bacteria | 1790 |
| 176 | Ga0114129_10490390 | 3300009147 | Bacteria | 1606 |
| 177 | Ga0105243_10009141 | 3300009148 | Bacteria | 7567 |
| 178 | Ga0105241_10071097 | 3300009174 | Bacteria | 2701 |
| 179 | Ga0105242_10032323 | 3300009176 | Bacteria | 4184 |
| 180 | Ga0105242_10094726 | 3300009176 | Bacteria | 2519 |
| 181 | Ga0105248_10022329 | 3300009177 | Bacteria | 7018 |
| 182 | Ga0105248_10033931 | 3300009177 | Bacteria | 5703 |
| 183 | Ga0105248_10079589 | 3300009177 | Bacteria | 3683 |
| 184 | Ga0105248_10125883 | 3300009177 | Bacteria | 2891 |
| 185 | Ga0105248_10166242 | 3300009177 | Bacteria | 2487 |
| 186 | Ga0105248_10220601 | 3300009177 | Bacteria | 2135 |
| 187 | Ga0105248_10255673 | 3300009177 | Bacteria | 1972 |
| 188 | Ga0105248_10655231 | 3300009177 | Bacteria | 1185 |
| 189 | Ga0105249_10045298 | 3300009553 | Bacteria | 4000 |
| 190 | Ga0105249_10160666 | 3300009553 | Bacteria | 2171 |
| 191 | Ga0105249_10173772 | 3300009553 | Bacteria | 2091 |
| 192 | Ga0157371_10269845 | 3300013102 | Bacteria | 1228 |
| 193 | Ga0157374_10002165 | 3300013296 | Bacteria | 16562 |
| 194 | Ga0157374_10035609 | 3300013296 | Bacteria | 4555 |
| 195 | Ga0157374_10152617 | 3300013296 | Bacteria | 2246 |
| 196 | Ga0157378_10004845 | 3300013297 | Bacteria | 11800 |
| 197 | Ga0157378_10593507 | 3300013297 | Bacteria | 1118 |
| 198 | Ga0163162_10066865 | 3300013306 | Bacteria | 3644 |
| 199 | Ga0163162_10102842 | 3300013306 | Bacteria | 2950 |
| 200 | Ga0163162_10464174 | 3300013306 | Bacteria | 1398 |
| 201 | Ga0157375_10303562 | 3300013308 | Bacteria | 1760 |
| 202 | Ga0163163_10014722 | 3300014325 | Bacteria | 7196 |
| 203 | Ga0163163_10070744 | 3300014325 | Bacteria | 3475 |
| 204 | Ga0163163_10078025 | 3300014325 | Bacteria | 3308 |
| 205 | Ga0157380_10000913 | 3300014326 | Bacteria | 18608 |
| 206 | Ga0157380_10004916 | 3300014326 | Bacteria | 9317 |
| 207 | Ga0157380_10102203 | 3300014326 | Bacteria | 2390 |
| 208 | Ga0157380_10260463 | 3300014326 | Bacteria | 1575 |
| 209 | Ga0157377_10172127 | 3300014745 | Bacteria | 1355 |
| 210 | Ga0157379_10012693 | 3300014968 | Bacteria | 7363 |
| 211 | Ga0157379_10053981 | 3300014968 | Bacteria | 3590 |
| 212 | Ga0157376_10018030 | 3300014969 | Bacteria | 5400 |
| 213 | Ga0157376_10035742 | 3300014969 | Bacteria | 4021 |
| 214 | Ga0157376_10046931 | 3300014969 | Bacteria | 3565 |
| 215 | Ga0207680_10152108 | 3300025903 | Bacteria | 1543 |
| 216 | Ga0207699_10037693 | 3300025906 | Bacteria | 2765 |
| 217 | Ga0207643_10172458 | 3300025908 | Bacteria | 1306 |
| 218 | Ga0207684_10004177 | 3300025910 | Bacteria | 13717 |
| 219 | Ga0207684_10033331 | 3300025910 | Bacteria | 4379 |
| 220 | Ga0207684_10122656 | 3300025910 | Bacteria | 2228 |
| 221 | Ga0207654_10017021 | 3300025911 | Bacteria | 3794 |
| 222 | Ga0207707_10217647 | 3300025912 | Bacteria | 1663 |
| 223 | Ga0207695_10126163 | 3300025913 | Bacteria | 2521 |
| 224 | Ga0207660_10085505 | 3300025917 | Bacteria | 2327 |
| 225 | Ga0207662_10006467 | 3300025918 | Bacteria | 6327 |
| 226 | Ga0207657_10008966 | 3300025919 | Bacteria | 10106 |
| 227 | Ga0207646_10019571 | 3300025922 | Bacteria | 6288 |
| 228 | Ga0207646_10037673 | 3300025922 | Bacteria | 4359 |
| 229 | Ga0207646_10052394 | 3300025922 | Bacteria | 3651 |
| 230 | Ga0207646_10168120 | 3300025922 | Bacteria | 1980 |
| 231 | Ga0207646_10395510 | 3300025922 | Bacteria | 1248 |
| 232 | Ga0207646_10451241 | 3300025922 | Bacteria | 1160 |
| 233 | Ga0207681_10007925 | 3300025923 | Bacteria | 6495 |
| 234 | Ga0207659_10001565 | 3300025926 | Bacteria | 13581 |
| 235 | Ga0207687_10159403 | 3300025927 | Bacteria | 1730 |
| 236 | Ga0207700_10124554 | 3300025928 | Bacteria | 2094 |
| 237 | Ga0207644_10200932 | 3300025931 | Bacteria | 1572 |
| 238 | Ga0207686_10016274 | 3300025934 | Bacteria | 4172 |
| 239 | Ga0207670_10223894 | 3300025936 | Bacteria | 1441 |
| 240 | Ga0207670_10242670 | 3300025936 | Bacteria | 1389 |
| 241 | Ga0207669_10022483 | 3300025937 | Bacteria | 3351 |
| 242 | Ga0207669_10034198 | 3300025937 | Bacteria | 2877 |
| 243 | Ga0207669_10159512 | 3300025937 | Bacteria | 1591 |
| 244 | Ga0207669_10216488 | 3300025937 | Bacteria | 1402 |
| 245 | Ga0207704_10042950 | 3300025938 | Bacteria | 2665 |
| 246 | Ga0207704_10166574 | 3300025938 | Bacteria | 1575 |
| 247 | Ga0207665_10050700 | 3300025939 | Bacteria | 2792 |
| 248 | Ga0207691_10285907 | 3300025940 | Bacteria | 1418 |
| 249 | Ga0207711_10022277 | 3300025941 | Bacteria | 5297 |
| 250 | Ga0207711_10053644 | 3300025941 | Bacteria | 3457 |
| 251 | Ga0207711_10167153 | 3300025941 | Bacteria | 1994 |
| 252 | Ga0207711_10228384 | 3300025941 | Bacteria | 1704 |
| 253 | Ga0207711_10372907 | 3300025941 | Bacteria | 1323 |
| 254 | Ga0207711_10562836 | 3300025941 | Bacteria | 1063 |
| 255 | Ga0207689_10022865 | 3300025942 | Bacteria | 5251 |
| 256 | Ga0207679_10067882 | 3300025945 | Bacteria | 2677 |
| 257 | Ga0207667_10402344 | 3300025949 | Bacteria | 1394 |
| 258 | Ga0207651_10277997 | 3300025960 | Bacteria | 1382 |
| 259 | Ga0207712_10093761 | 3300025961 | Bacteria | 2216 |
| 260 | Ga0207712_10284136 | 3300025961 | Bacteria | 1351 |
| 261 | Ga0207640_10019459 | 3300025981 | Bacteria | 4011 |
| 262 | Ga0207640_10046696 | 3300025981 | Bacteria | 2789 |
| 263 | Ga0207703_10029761 | 3300026035 | Bacteria | 4310 |
| 264 | Ga0207703_10089247 | 3300026035 | Bacteria | 2589 |
| 265 | Ga0207703_10117230 | 3300026035 | Bacteria | 2281 |
| 266 | Ga0207703_10201146 | 3300026035 | Bacteria | 1770 |
| 267 | Ga0207703_10451909 | 3300026035 | Bacteria | 1200 |
| 268 | Ga0207708_10128649 | 3300026075 | Bacteria | 1978 |
| 269 | Ga0207708_10510761 | 3300026075 | Bacteria | 1008 |
| 270 | Ga0207702_10090609 | 3300026078 | Bacteria | 2676 |
| 271 | Ga0207641_10001443 | 3300026088 | Bacteria | 23349 |
| 272 | Ga0207641_10359227 | 3300026088 | Bacteria | 1390 |
| 273 | Ga0207648_10058005 | 3300026089 | Bacteria | 3377 |
| 274 | Ga0207648_10105958 | 3300026089 | Bacteria | 2466 |
| 275 | Ga0207648_10160594 | 3300026089 | Bacteria | 1985 |
| 276 | Ga0207676_10005302 | 3300026095 | Bacteria | 9133 |
| 277 | Ga0207676_10013484 | 3300026095 | Bacteria | 5872 |
| 278 | Ga0207674_10097991 | 3300026116 | Bacteria | 2916 |
| 279 | Ga0207675_100009768 | 3300026118 | Bacteria | 8982 |
| 280 | Ga0207675_100029092 | 3300026118 | Bacteria | 5149 |
| 281 | Ga0207683_10242964 | 3300026121 | Bacteria | 1642 |
| 282 | Ga0209974_10016911 | 3300027876 | Bacteria | 2421 |
| 283 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 284 | Ga0207428_10000054 | 3300027907 | Bacteria | 175237 |
| 285 | Ga0207428_10002086 | 3300027907 | Bacteria | 20130 |
| 286 | Ga0207428_10003212 | 3300027907 | Bacteria | 15972 |
| 287 | Ga0207428_10042966 | 3300027907 | Bacteria | 3653 |
| 288 | Ga0207428_10090168 | 3300027907 | Bacteria | 2382 |
| 289 | Ga0268266_10003281 | 3300028379 | Bacteria | 16279 |
| 290 | Ga0268265_10017146 | 3300028380 | Bacteria | 4991 |
| 291 | Ga0268265_10205765 | 3300028380 | Bacteria | 1711 |
| 292 | Ga0268264_10104327 | 3300028381 | Bacteria | 2471 |
| 293 | Ga0268264_10143714 | 3300028381 | Bacteria | 2131 |
| 294 | Ga0307408_100119672 | 3300031548 | Bacteria | 2038 |
| 295 | Ga0307408_100224354 | 3300031548 | Bacteria | 1535 |
| 296 | Ga0307410_10064510 | 3300031852 | Bacteria | 2517 |
| 297 | Ga0307406_10095276 | 3300031901 | Bacteria | 2014 |
| 298 | Ga0307407_10060086 | 3300031903 | Bacteria | 2217 |
| 299 | Ga0307416_100571314 | 3300032002 | Bacteria | 1207 |
| 300 | Ga0373930_0000697 | 3300034816 | Bacteria | 4719 |
| 301 | Ga0373948_0002506 | 3300034817 | Bacteria | 2727 |
| 302 | Ga0373958_0018223 | 3300034819 | Bacteria | 1270 |
| 303 | Ga0373959_0001519 | 3300034820 | Bacteria | 3698 |
| 304 | Ga0373938_0002592 | 3300034957 | Bacteria | 2914 |
| 305 | Ga0373929_0013702 | 3300035085 | Bacteria | 1557 |
| 306 | Ga0373949_0004859 | 3300035090 | Bacteria | 3043 |
| 307 | Ga0373951_0015273 | 3300035091 | Bacteria | 1728 |
| 308 | Ga0373923_0109693 | 3300035111 | Bacteria | 1224 |
| 309 | Ga0373932_0001911 | 3300035112 | Bacteria | 5562 |
| 310 | Ga0373936_0090375 | 3300035113 | Bacteria | 1283 |
| 311 | Ga0373939_0020814 | 3300035114 | Bacteria | 1787 |
| 312 | Ga0373941_0003424 | 3300035115 | Bacteria | 3592 |
| 313 | Ga0373960_0001571 | 3300035121 | Bacteria | 5097 |
| 314 | Ga0373946_0016584 | 3300035171 | Bacteria | 2808 |
| 315 | Ga0373961_0001372 | 3300035241 | Bacteria | 7304 |
| 316 | Ga0373962_0021861 | 3300035242 | Bacteria | 1691 |
| 317 | Ga0373924_0071867 | 3300035410 | Bacteria | 1460 |
| 318 | Ga0373931_0015000 | 3300035691 | Bacteria | 3797 |
| 319 | Ga0373931_0049040 | 3300035691 | Bacteria | 2240 |
| 320 | Ga0373931_0069862 | 3300035691 | Bacteria | 1914 |
| 321 | Ga0373927_0119777 | 3300035695 | Bacteria | 1718 |
| 322 | Ga0373937_0297260 | 3300036401 | Bacteria | 1526 |
| 323 | Ga0373937_0341205 | 3300036401 | Bacteria | 1419 |
| 324 | Ga0373925_0007435 | 3300037068 | Bacteria | 7992 |
| 325 | Ga0451577_0000844 | 3300042876 | Bacteria | 45822 |
| 326 | Ga0451577_0067126 | 3300042876 | Bacteria | 3199 |
| 327 | Ga0453683_0157238 | 3300044673 | Bacteria | 1437 |
| 328 | Ga0453684_0130822 | 3300044712 | Bacteria | 3011 |
| 329 | Ga0451576_0001424 | 3300045051 | Bacteria | 40965 |
| 330 | Ga0451576_0345179 | 3300045051 | Bacteria | 1559 |
| 331 | Ga0495592_0018363 | 3300046454 | Bacteria | 5318 |
| 332 | Ga0495629_0070779 | 3300046459 | Bacteria | 2434 |
| 333 | Ga0495580_0001114 | 3300046472 | Bacteria | 23622 |
| 334 | Ga0495582_0127316 | 3300046473 | Bacteria | 1438 |
| 335 | Ga0495639_0167267 | 3300046475 | Bacteria | 1066 |
| 336 | Ga0495608_0062166 | 3300046511 | Bacteria | 2454 |
| 337 | Ga0495628_0084785 | 3300046516 | Bacteria | 2458 |
| 338 | Ga0495628_0423207 | 3300046516 | Bacteria | 970 |
| 339 | Ga0495630_0006053 | 3300046517 | Bacteria | 8570 |
| 340 | Ga0495645_0172974 | 3300046543 | Bacteria | 1485 |
| 341 | Ga0495667_0099656 | 3300046559 | Bacteria | 1880 |
| 342 | Ga0495657_0194358 | 3300046675 | Bacteria | 1239 |
| 343 | Ga0495647_0039820 | 3300046681 | Bacteria | 1783 |
| 344 | Ga0495669_0109870 | 3300046684 | Bacteria | 1287 |
| 345 | Ga0495613_0001615 | 3300046689 | Bacteria | 17153 |
| 346 | Ga0495600_0042052 | 3300046809 | Bacteria | 2978 |
| 347 | Ga0495604_0079335 | 3300047317 | Bacteria | 2462 |
| 348 | Ga0495674_0010439 | 3300047319 | Bacteria | 8793 |
| 349 | Ga0496101_0000773 | 3300048904 | Bacteria | 18926 |
| 350 | Ga0496102_0032067 | 3300048905 | Bacteria | 4719 |
| 351 | Ga0496104_0048058 | 3300048907 | Bacteria | 4023 |
| 352 | Ga0496104_0133289 | 3300048907 | Bacteria | 2387 |
| 353 | Ga0496104_0364203 | 3300048907 | Bacteria | 1358 |
| 354 | Ga0496106_0134316 | 3300048909 | Bacteria | 1942 |
| 355 | Ga0496108_0006865 | 3300048911 | Bacteria | 9212 |
| 356 | Ga0496109_0572768 | 3300048912 | Bacteria | 1064 |
| 357 | Ga0496112_0005637 | 3300048915 | Bacteria | 10867 |
| 358 | Ga0496112_0466922 | 3300048915 | Bacteria | 1199 |
| 359 | Ga0496112_0758114 | 3300048915 | Bacteria | 896 |
| 360 | Ga0496114_0000233 | 3300048917 | Bacteria | 40546 |
| 361 | Ga0496114_0031034 | 3300048917 | Bacteria | 4396 |
| 362 | Ga0501033_0107401 | 3300049570 | Bacteria | 2033 |
| 363 | Ga0501033_0144496 | 3300049570 | Bacteria | 1719 |
| 364 | Ga0501036_0061562 | 3300049572 | Bacteria | 3179 |
| 365 | Ga0501038_0071937 | 3300049574 | Bacteria | 2932 |
| 366 | Ga0501038_0240299 | 3300049574 | Bacteria | 1438 |
| 367 | Ga0501039_0092433 | 3300049575 | Bacteria | 2358 |
| 368 | Ga0501040_0021277 | 3300049576 | Bacteria | 4330 |
| 369 | Ga0501040_0028487 | 3300049576 | Bacteria | 3766 |
| 370 | Ga0501040_0076392 | 3300049576 | Bacteria | 2316 |
| 371 | Ga0501040_0108644 | 3300049576 | Bacteria | 1939 |
| 372 | Ga0501041_0002515 | 3300049577 | Bacteria | 10444 |
| 373 | Ga0501070_0398624 | 3300049586 | Bacteria | 1113 |
| 374 | Ga0501071_0017276 | 3300049587 | Bacteria | 4973 |
| 375 | Ga0501071_0080197 | 3300049587 | Bacteria | 2386 |
| 376 | Ga0501071_0097470 | 3300049587 | Bacteria | 2165 |
| 377 | Ga0501072_0026622 | 3300049588 | Bacteria | 4509 |
| 378 | Ga0501074_0069357 | 3300049590 | Bacteria | 2535 |
| 379 | Ga0501075_0009690 | 3300049591 | Bacteria | 6748 |
| 380 | Ga0501075_0026565 | 3300049591 | Bacteria | 4264 |
| 381 | Ga0501075_0081303 | 3300049591 | Bacteria | 2453 |
| 382 | Ga0501075_0102530 | 3300049591 | Bacteria | 2173 |
| 383 | Ga0501076_0038133 | 3300049592 | Bacteria | 3772 |
| 384 | Ga0501076_0038921 | 3300049592 | Bacteria | 3732 |
| 385 | Ga0501077_0014912 | 3300049593 | Bacteria | 4886 |
| 386 | Ga0501077_0043188 | 3300049593 | Bacteria | 2865 |
| 387 | Ga0501077_0053586 | 3300049593 | Bacteria | 2561 |
| 388 | Ga0501077_0162010 | 3300049593 | Bacteria | 1420 |
| 389 | Ga0501079_0007858 | 3300049741 | Bacteria | 8078 |
| 390 | Ga0501079_0010024 | 3300049741 | Bacteria | 7193 |
| 391 | Ga0501079_0026677 | 3300049741 | Bacteria | 4430 |
| 392 | Ga0501079_0197626 | 3300049741 | Bacteria | 1570 |
| 393 | Ga0501079_0265235 | 3300049741 | Bacteria | 1342 |
| 394 | Ga0501079_0330709 | 3300049741 | Bacteria | 1193 |
| 395 | Ga0501080_0044140 | 3300049742 | Bacteria | 4150 |
| 396 | Ga0501081_0001773 | 3300049743 | Bacteria | 13376 |
| 397 | Ga0501081_0034017 | 3300049743 | Bacteria | 3466 |
| 398 | Ga0501081_0039120 | 3300049743 | Bacteria | 3244 |
| 399 | Ga0501081_0344660 | 3300049743 | Bacteria | 1097 |
| 400 | Ga0501083_0052702 | 3300049744 | Bacteria | 2733 |
| 401 | Ga0501035_0252700 | 3300049822 | Bacteria | 1496 |
| 402 | Ga0501045_0007431 | 3300049824 | Bacteria | 7614 |
| 403 | Ga0501045_0067297 | 3300049824 | Bacteria | 2630 |
| 404 | nmdc:mga05p37_13544_c1 | 3300050507 | Bacteria | 9778 |
| 405 | nmdc:mga05p37_15680_c1 | 3300050507 | Bacteria | 9109 |
| 406 | nmdc:mga05p37_235466_c1 | 3300050507 | Bacteria | 2204 |
| 407 | nmdc:mga05p37_240666_c1 | 3300050507 | Bacteria | 2176 |
| 408 | nmdc:mga05p37_248946_c1 | 3300050507 | Bacteria | 2132 |
| 409 | nmdc:mga05p37_254865_c1 | 3300050507 | Bacteria | 2103 |
| 410 | nmdc:mga05p37_317095_c1 | 3300050507 | Bacteria | 1846 |
| 411 | nmdc:mga05p37_346570_c1 | 3300050507 | Bacteria | 1750 |
| 412 | nmdc:mga05p37_421673_c1 | 3300050507 | Bacteria | 1553 |
| 413 | nmdc:mga05p37_45139_c1 | 3300050507 | Bacteria | 5422 |
| 414 | nmdc:mga05p37_626998_c1 | 3300050507 | Bacteria | 1209 |
| 415 | nmdc:mga09592_30220_c1 | 3300050508 | Bacteria | 4507 |
| 416 | nmdc:mga09592_69037_c1 | 3300050508 | Bacteria | 2998 |
| 417 | nmdc:mga06r32_173064_c1 | 3300050510 | Bacteria | 2143 |
| 418 | nmdc:mga06r32_352149_c1 | 3300050510 | Bacteria | 1457 |
| 419 | nmdc:mga06r32_75691_c1 | 3300050510 | Bacteria | 3267 |
| 420 | nmdc:mga06r32_80538_c1 | 3300050510 | Bacteria | 3169 |
| 421 | nmdc:mga06r32_987_c1 | 3300050510 | Bacteria | 25489 |
| 422 | nmdc:mga08y16_101662_c1 | 3300050511 | Bacteria | 2993 |
| 423 | nmdc:mga08y16_1197_c1 | 3300050511 | Bacteria | 25596 |
| 424 | nmdc:mga08y16_13575_c1 | 3300050511 | Bacteria | 8573 |
| 425 | nmdc:mga08y16_20418_c1 | 3300050511 | Bacteria | 6992 |
| 426 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 427 | nmdc:mga08y16_44855_c1 | 3300050511 | Bacteria | 4634 |
| 428 | nmdc:mga0n895_127624_c1 | 3300050512 | Bacteria | 2567 |
| 429 | nmdc:mga0n895_18764_c1 | 3300050512 | Bacteria | 6410 |
| 430 | nmdc:mga0n895_289970_c1 | 3300050512 | Bacteria | 1659 |
| 431 | nmdc:mga0n895_362399_c1 | 3300050512 | Bacteria | 1468 |
| 432 | nmdc:mga0n895_45488_c1 | 3300050512 | Bacteria | 4284 |
| 433 | nmdc:mga0n895_46427_c1 | 3300050512 | Bacteria | 4244 |
| 434 | nmdc:mga0n895_5949_c1 | 3300050512 | Bacteria | 10264 |
| 435 | nmdc:mga0n895_87429_c1 | 3300050512 | Bacteria | 3114 |
| 436 | nmdc:mga0rr50_168777_c1 | 3300050513 | Bacteria | 1781 |
| 437 | nmdc:mga0rr50_215406_c1 | 3300050513 | Bacteria | 1584 |
| 438 | nmdc:mga0rr50_30525_c1 | 3300050513 | Bacteria | 3817 |
| 439 | nmdc:mga0rr50_3_c1 | 3300050513 | Bacteria | 353622 |
| 440 | nmdc:mga0rr50_40183_c1 | 3300050513 | Bacteria | 3400 |
| 441 | nmdc:mga0rr50_43000_c1 | 3300050513 | Bacteria | 3303 |
| 442 | nmdc:mga0rr50_5622_c1 | 3300050513 | Bacteria | 7505 |
| 443 | nmdc:mga0rr50_62931_c1 | 3300050513 | Bacteria | 2801 |
| 444 | nmdc:mga08x19_239783_c1 | 3300050514 | Bacteria | 1250 |
| 445 | nmdc:mga08x19_262152_c1 | 3300050514 | Bacteria | 1195 |
| 446 | nmdc:mga08x19_627_c1 | 3300050514 | Bacteria | 22773 |
| 447 | nmdc:mga08x19_96312_c1 | 3300050514 | Bacteria | 1959 |
| 448 | nmdc:mga0a205_10023_c1 | 3300050515 | Bacteria | 8693 |
| 449 | nmdc:mga0a205_1085_c1 | 3300050515 | Bacteria | 22566 |
| 450 | nmdc:mga0a205_130443_c1 | 3300050515 | Bacteria | 2414 |
| 451 | nmdc:mga0a205_257415_c1 | 3300050515 | Bacteria | 1623 |
| 452 | nmdc:mga0a205_273574_c1 | 3300050515 | Bacteria | 1565 |
| 453 | nmdc:mga0a205_307759_c1 | 3300050515 | Bacteria | 1457 |
| 454 | nmdc:mga0a205_45151_c1 | 3300050515 | Bacteria | 4248 |
| 455 | nmdc:mga0a205_57111_c1 | 3300050515 | Bacteria | 3769 |
| 456 | nmdc:mga0a205_58999_c1 | 3300050515 | Bacteria | 3707 |
| 457 | nmdc:mga0a205_66025_c1 | 3300050515 | Bacteria | 3496 |
| 458 | Ga0495601_0002222 | 3300053077 | Bacteria | 10929 |
| 459 | Ga0495655_0086779 | 3300053083 | Bacteria | 905 |
| 460 | Ga0495619_0022423 | 3300053085 | Bacteria | 4041 |
| 461 | Ga0495619_0198688 | 3300053085 | Bacteria | 1388 |
| 462 | Ga0500556_0005539 | 3300053104 | Bacteria | 3566 |
| 463 | Ga0501084_0037230 | 3300054114 | Bacteria | 4064 |
| 464 | Ga0501084_0219316 | 3300054114 | Bacteria | 1605 |
| 465 | Ga0501084_0342409 | 3300054114 | Bacteria | 1263 |
| 466 | Ga0590071_023702 | 3300059421 | Bacteria | 1453 |
| 467 | Ga0501082_0016127 | 3300060353 | Bacteria | 6426 |
| 468 | Ga0501082_0027944 | 3300060353 | Bacteria | 4859 |
| 469 | Ga0501082_0209844 | 3300060353 | Bacteria | 1694 |
| 470 | Ga0530510_0000169 | 3300061734 | Bacteria | 39699 |
| 471 | Ga0530510_0021607 | 3300061734 | Bacteria | 4578 |
| 472 | Ga0530510_0054422 | 3300061734 | Bacteria | 2891 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046516 | Ga0495628_0423207 | Ga0495628_0423207_175_948 | 254 |
| 2 | 3300046459 | Ga0495629_0070779 | Ga0495629_0070779_27_848 | 272 |
| 3 | 3300053083 | Ga0495655_0086779 | Ga0495655_0086779_14_835 | 272 |
| 4 | 3300049574 | Ga0501038_0240299 | Ga0501038_0240299_576_1421 | 279 |
| 5 | 3300049593 | Ga0501077_0043188 | Ga0501077_0043188_10_855 | 279 |
| 6 | 3300049741 | Ga0501079_0330709 | Ga0501079_0330709_19_864 | 279 |
| 7 | 3300050510 | nmdc:mga06r32_352149_c1 | nmdc:mga06r32_352149_c1_364_1212 | 280 |
| 8 | 3300046475 | Ga0495639_0167267 | Ga0495639_0167267_30_884 | 283 |
| 9 | 3300048915 | Ga0496112_0758114 | Ga0496112_0758114_30_884 | 283 |
| 10 | 3300005518 | Ga0070699_100124876 | Ga0070699_1001248762 | 296 |
| 11 | 3300005843 | Ga0068860_100088821 | Ga0068860_1000888213 | 296 |
| 12 | 3300005549 | Ga0070704_100018274 | Ga0070704_1000182742 | 301 |
| 13 | 3300050512 | nmdc:mga0n895_289970_c1 | nmdc:mga0n895_289970_c1_526_1452 | 305 |
| 14 | 3300049570 | Ga0501033_0144496 | Ga0501033_0144496_301_1230 | 306 |
| 15 | 3300005333 | Ga0070677_10144203 | Ga0070677_101442031 | 307 |
| 16 | 3300009101 | Ga0105247_10026129 | Ga0105247_100261294 | 307 |
| 17 | 3300009177 | Ga0105248_10033931 | Ga0105248_100339312 | 307 |
| 18 | 3300014325 | Ga0163163_10070744 | Ga0163163_100707443 | 307 |
| 19 | 3300014968 | Ga0157379_10012693 | Ga0157379_100126932 | 307 |
| 20 | 3300036401 | Ga0373937_0341205 | Ga0373937_0341205_461_1384 | 307 |
| 21 | 3300049741 | Ga0501079_0026677 | Ga0501079_0026677_1493_2422 | 307 |
| 22 | 3300049824 | Ga0501045_0067297 | Ga0501045_0067297_1106_2038 | 307 |
| 23 | 3300006852 | Ga0075433_10085132 | Ga0075433_100851322 | 308 |
| 24 | 3300006871 | Ga0075434_100032830 | Ga0075434_1000328303 | 308 |
| 25 | 3300007076 | Ga0075435_100395655 | Ga0075435_1003956551 | 308 |
| 26 | 3300009147 | Ga0114129_10300457 | Ga0114129_103004572 | 308 |
| 27 | 3300050507 | nmdc:mga05p37_235466_c1 | nmdc:mga05p37_235466_c1_765_1697 | 308 |
| 28 | 3300050513 | nmdc:mga0rr50_168777_c1 | nmdc:mga0rr50_168777_c1_475_1407 | 308 |
| 29 | 3300050515 | nmdc:mga0a205_130443_c1 | nmdc:mga0a205_130443_c1_1178_2110 | 308 |
| 30 | iso_pu_bacteria | 2997451912 | 2997459013 | 308 |
| 31 | 3300005445 | Ga0070708_100032541 | Ga0070708_1000325412 | 309 |
| 32 | 3300006846 | Ga0075430_100026510 | Ga0075430_1000265104 | 309 |
| 33 | 3300006846 | Ga0075430_100181583 | Ga0075430_1001815832 | 309 |
| 34 | 3300006852 | Ga0075433_10038914 | Ga0075433_100389145 | 309 |
| 35 | 3300006871 | Ga0075434_100019748 | Ga0075434_1000197483 | 309 |
| 36 | 3300006880 | Ga0075429_100091375 | Ga0075429_1000913754 | 309 |
| 37 | 3300007076 | Ga0075435_100482169 | Ga0075435_1004821691 | 309 |
| 38 | 3300009094 | Ga0111539_10591834 | Ga0111539_105918342 | 309 |
| 39 | 3300009147 | Ga0114129_10084958 | Ga0114129_100849585 | 309 |
| 40 | 3300009147 | Ga0114129_10183420 | Ga0114129_101834204 | 309 |
| 41 | 3300009147 | Ga0114129_10359084 | Ga0114129_103590842 | 309 |
| 42 | 3300027907 | Ga0207428_10003212 | Ga0207428_1000321214 | 309 |
| 43 | 3300035691 | Ga0373931_0069862 | Ga0373931_0069862_262_1197 | 309 |
| 44 | 3300042876 | Ga0451577_0067126 | Ga0451577_0067126_1486_2421 | 309 |
| 45 | 3300049575 | Ga0501039_0092433 | Ga0501039_0092433_1124_2059 | 309 |
| 46 | 3300049576 | Ga0501040_0028487 | Ga0501040_0028487_2108_3043 | 309 |
| 47 | 3300049577 | Ga0501041_0002515 | Ga0501041_0002515_7689_8624 | 309 |
| 48 | 3300049587 | Ga0501071_0097470 | Ga0501071_0097470_716_1651 | 309 |
| 49 | 3300049591 | Ga0501075_0026565 | Ga0501075_0026565_90_1025 | 309 |
| 50 | 3300049592 | Ga0501076_0038133 | Ga0501076_0038133_177_1112 | 309 |
| 51 | 3300049592 | Ga0501076_0038921 | Ga0501076_0038921_84_1019 | 309 |
| 52 | 3300049593 | Ga0501077_0014912 | Ga0501077_0014912_2124_3059 | 309 |
| 53 | 3300049593 | Ga0501077_0162010 | Ga0501077_0162010_302_1237 | 309 |
| 54 | 3300049741 | Ga0501079_0007858 | Ga0501079_0007858_2006_2941 | 309 |
| 55 | 3300049743 | Ga0501081_0001773 | Ga0501081_0001773_2814_3749 | 309 |
| 56 | 3300049824 | Ga0501045_0007431 | Ga0501045_0007431_3962_4897 | 309 |
| 57 | 3300050507 | nmdc:mga05p37_317095_c1 | nmdc:mga05p37_317095_c1_398_1333 | 309 |
| 58 | 3300050508 | nmdc:mga09592_69037_c1 | nmdc:mga09592_69037_c1_1506_2441 | 309 |
| 59 | 3300050510 | nmdc:mga06r32_173064_c1 | nmdc:mga06r32_173064_c1_1075_2010 | 309 |
| 60 | 3300050511 | nmdc:mga08y16_44855_c1 | nmdc:mga08y16_44855_c1_2933_3868 | 309 |
| 61 | 3300050512 | nmdc:mga0n895_127624_c1 | nmdc:mga0n895_127624_c1_550_1479 | 309 |
| 62 | 3300050512 | nmdc:mga0n895_46427_c1 | nmdc:mga0n895_46427_c1_2857_3792 | 309 |
| 63 | 3300050515 | nmdc:mga0a205_45151_c1 | nmdc:mga0a205_45151_c1_440_1375 | 309 |
| 64 | 3300060353 | Ga0501082_0016127 | Ga0501082_0016127_465_1400 | 309 |
| 65 | 3300061734 | Ga0530510_0000169 | Ga0530510_0000169_16975_17910 | 309 |
| 66 | 3300061734 | Ga0530510_0021607 | Ga0530510_0021607_3502_4437 | 309 |
| 67 | 3300005440 | Ga0070705_100198998 | Ga0070705_1001989982 | 310 |
| 68 | 3300005444 | Ga0070694_100023467 | Ga0070694_1000234674 | 310 |
| 69 | 3300005445 | Ga0070708_100067071 | Ga0070708_1000670714 | 310 |
| 70 | 3300005445 | Ga0070708_100085018 | Ga0070708_1000850182 | 310 |
| 71 | 3300005458 | Ga0070681_10199354 | Ga0070681_101993543 | 310 |
| 72 | 3300005467 | Ga0070706_100044948 | Ga0070706_1000449485 | 310 |
| 73 | 3300005468 | Ga0070707_100011796 | Ga0070707_1000117964 | 310 |
| 74 | 3300005468 | Ga0070707_100114939 | Ga0070707_1001149391 | 310 |
| 75 | 3300005471 | Ga0070698_100044431 | Ga0070698_1000444314 | 310 |
| 76 | 3300005471 | Ga0070698_100087101 | Ga0070698_1000871012 | 310 |
| 77 | 3300005518 | Ga0070699_100014596 | Ga0070699_1000145965 | 310 |
| 78 | 3300005518 | Ga0070699_100040142 | Ga0070699_1000401425 | 310 |
| 79 | 3300005536 | Ga0070697_100067271 | Ga0070697_1000672714 | 310 |
| 80 | 3300007076 | Ga0075435_100192920 | Ga0075435_1001929203 | 310 |
| 81 | 3300025910 | Ga0207684_10004177 | Ga0207684_1000417713 | 310 |
| 82 | 3300025910 | Ga0207684_10033331 | Ga0207684_100333313 | 310 |
| 83 | 3300025922 | Ga0207646_10451241 | Ga0207646_104512412 | 310 |
| 84 | 3300027876 | Ga0209974_10016911 | Ga0209974_100169111 | 310 |
| 85 | 3300031548 | Ga0307408_100119672 | Ga0307408_1001196722 | 310 |
| 86 | 3300031548 | Ga0307408_100224354 | Ga0307408_1002243541 | 310 |
| 87 | 3300032002 | Ga0307416_100571314 | Ga0307416_1005713141 | 310 |
| 88 | 3300035691 | Ga0373931_0015000 | Ga0373931_0015000_170_1108 | 310 |
| 89 | 3300046472 | Ga0495580_0001114 | Ga0495580_0001114_15258_16196 | 310 |
| 90 | 3300048905 | Ga0496102_0032067 | Ga0496102_0032067_2286_3224 | 310 |
| 91 | 3300049570 | Ga0501033_0107401 | Ga0501033_0107401_504_1442 | 310 |
| 92 | 3300049572 | Ga0501036_0061562 | Ga0501036_0061562_1646_2608 | 310 |
| 93 | 3300049574 | Ga0501038_0071937 | Ga0501038_0071937_316_1278 | 310 |
| 94 | 3300049576 | Ga0501040_0021277 | Ga0501040_0021277_576_1523 | 310 |
| 95 | 3300049576 | Ga0501040_0076392 | Ga0501040_0076392_1276_2214 | 310 |
| 96 | 3300049586 | Ga0501070_0398624 | Ga0501070_0398624_22_960 | 310 |
| 97 | 3300049587 | Ga0501071_0017276 | Ga0501071_0017276_2132_3070 | 310 |
| 98 | 3300049587 | Ga0501071_0080197 | Ga0501071_0080197_701_1663 | 310 |
| 99 | 3300049588 | Ga0501072_0026622 | Ga0501072_0026622_1597_2559 | 310 |
| 100 | 3300049590 | Ga0501074_0069357 | Ga0501074_0069357_628_1566 | 310 |
| 101 | 3300049591 | Ga0501075_0081303 | Ga0501075_0081303_1177_2115 | 310 |
| 102 | 3300049591 | Ga0501075_0102530 | Ga0501075_0102530_972_1934 | 310 |
| 103 | 3300049593 | Ga0501077_0053586 | Ga0501077_0053586_392_1330 | 310 |
| 104 | 3300049741 | Ga0501079_0010024 | Ga0501079_0010024_2154_3116 | 310 |
| 105 | 3300049741 | Ga0501079_0265235 | Ga0501079_0265235_288_1226 | 310 |
| 106 | 3300049742 | Ga0501080_0044140 | Ga0501080_0044140_1741_2703 | 310 |
| 107 | 3300049743 | Ga0501081_0034017 | Ga0501081_0034017_575_1513 | 310 |
| 108 | 3300049743 | Ga0501081_0039120 | Ga0501081_0039120_1904_2866 | 310 |
| 109 | 3300049743 | Ga0501081_0344660 | Ga0501081_0344660_107_1045 | 310 |
| 110 | 3300049744 | Ga0501083_0052702 | Ga0501083_0052702_800_1762 | 310 |
| 111 | 3300049822 | Ga0501035_0252700 | Ga0501035_0252700_386_1348 | 310 |
| 112 | 3300050513 | nmdc:mga0rr50_215406_c1 | nmdc:mga0rr50_215406_c1_354_1292 | 310 |
| 113 | 3300054114 | Ga0501084_0037230 | Ga0501084_0037230_1359_2321 | 310 |
| 114 | 3300054114 | Ga0501084_0219316 | Ga0501084_0219316_303_1241 | 310 |
| 115 | 3300059421 | Ga0590071_023702 | Ga0590071_023702_173_1135 | 310 |
| 116 | 3300060353 | Ga0501082_0209844 | Ga0501082_0209844_490_1452 | 310 |
| 117 | 3300061734 | Ga0530510_0054422 | Ga0530510_0054422_563_1525 | 310 |
| 118 | 3300005336 | Ga0070680_100023646 | Ga0070680_1000236462 | 311 |
| 119 | 3300005336 | Ga0070680_100434571 | Ga0070680_1004345711 | 311 |
| 120 | 3300005445 | Ga0070708_100044610 | Ga0070708_1000446105 | 311 |
| 121 | 3300005457 | Ga0070662_100294011 | Ga0070662_1002940111 | 311 |
| 122 | 3300005467 | Ga0070706_100259175 | Ga0070706_1002591752 | 311 |
| 123 | 3300005471 | Ga0070698_100087554 | Ga0070698_1000875542 | 311 |
| 124 | 3300005536 | Ga0070697_100080212 | Ga0070697_1000802122 | 311 |
| 125 | 3300005549 | Ga0070704_100048668 | Ga0070704_1000486683 | 311 |
| 126 | 3300005617 | Ga0068859_100092001 | Ga0068859_1000920012 | 311 |
| 127 | 3300005617 | Ga0068859_100127949 | Ga0068859_1001279494 | 311 |
| 128 | 3300005844 | Ga0068862_100128643 | Ga0068862_1001286434 | 311 |
| 129 | 3300005981 | Ga0081538_10016148 | Ga0081538_100161486 | 311 |
| 130 | 3300006847 | Ga0075431_100000072 | Ga0075431_10000007247 | 311 |
| 131 | 3300006852 | Ga0075433_10003370 | Ga0075433_1000337012 | 311 |
| 132 | 3300006852 | Ga0075433_10014649 | Ga0075433_100146495 | 311 |
| 133 | 3300006931 | Ga0097620_100091999 | Ga0097620_1000919995 | 311 |
| 134 | 3300006931 | Ga0097620_100127949 | Ga0097620_1001279491 | 311 |
| 135 | 3300007265 | Ga0099794_10038222 | Ga0099794_100382222 | 311 |
| 136 | 3300009094 | Ga0111539_10000238 | Ga0111539_1000023850 | 311 |
| 137 | 3300009147 | Ga0114129_10302351 | Ga0114129_103023512 | 311 |
| 138 | 3300009147 | Ga0114129_10407818 | Ga0114129_104078182 | 311 |
| 139 | 3300009177 | Ga0105248_10220601 | Ga0105248_102206014 | 311 |
| 140 | 3300009553 | Ga0105249_10045298 | Ga0105249_100452983 | 311 |
| 141 | 3300013102 | Ga0157371_10269845 | Ga0157371_102698451 | 311 |
| 142 | 3300013297 | Ga0157378_10004845 | Ga0157378_100048452 | 311 |
| 143 | 3300025910 | Ga0207684_10122656 | Ga0207684_101226562 | 311 |
| 144 | 3300025922 | Ga0207646_10019571 | Ga0207646_100195716 | 311 |
| 145 | 3300025922 | Ga0207646_10168120 | Ga0207646_101681201 | 311 |
| 146 | 3300025941 | Ga0207711_10022277 | Ga0207711_100222774 | 311 |
| 147 | 3300025942 | Ga0207689_10022865 | Ga0207689_100228656 | 311 |
| 148 | 3300025961 | Ga0207712_10093761 | Ga0207712_100937613 | 311 |
| 149 | 3300026075 | Ga0207708_10510761 | Ga0207708_105107611 | 311 |
| 150 | 3300026118 | Ga0207675_100029092 | Ga0207675_1000290925 | 311 |
| 151 | 3300027907 | Ga0207428_10000054 | Ga0207428_10000054160 | 311 |
| 152 | 3300028380 | Ga0268265_10017146 | Ga0268265_100171466 | 311 |
| 153 | 3300028381 | Ga0268264_10104327 | Ga0268264_101043272 | 311 |
| 154 | 3300042876 | Ga0451577_0000844 | Ga0451577_0000844_3792_4733 | 311 |
| 155 | 3300044673 | Ga0453683_0157238 | Ga0453683_0157238_74_1015 | 311 |
| 156 | 3300044712 | Ga0453684_0130822 | Ga0453684_0130822_580_1521 | 311 |
| 157 | 3300045051 | Ga0451576_0001424 | Ga0451576_0001424_39522_40463 | 311 |
| 158 | 3300045051 | Ga0451576_0345179 | Ga0451576_0345179_156_1097 | 311 |
| 159 | 3300050507 | nmdc:mga05p37_248946_c1 | nmdc:mga05p37_248946_c1_217_1158 | 311 |
| 160 | 3300050507 | nmdc:mga05p37_346570_c1 | nmdc:mga05p37_346570_c1_293_1231 | 311 |
| 161 | 3300050510 | nmdc:mga06r32_987_c1 | nmdc:mga06r32_987_c1_18378_19319 | 311 |
| 162 | 3300050511 | nmdc:mga08y16_1197_c1 | nmdc:mga08y16_1197_c1_20395_21336 | 311 |
| 163 | 3300050515 | nmdc:mga0a205_10023_c1 | nmdc:mga0a205_10023_c1_2542_3483 | 311 |
| 164 | 3300050515 | nmdc:mga0a205_1085_c1 | nmdc:mga0a205_1085_c1_14438_15379 | 311 |
| 165 | 3300050515 | nmdc:mga0a205_257415_c1 | nmdc:mga0a205_257415_c1_27_971 | 311 |
| 166 | 3300054114 | Ga0501084_0342409 | Ga0501084_0342409_85_1029 | 311 |
| 167 | 3300005356 | Ga0070674_100070434 | Ga0070674_1000704343 | 312 |
| 168 | 3300005444 | Ga0070694_100045982 | Ga0070694_1000459823 | 312 |
| 169 | 3300005445 | Ga0070708_100078623 | Ga0070708_1000786231 | 312 |
| 170 | 3300005535 | Ga0070684_100199325 | Ga0070684_1001993253 | 312 |
| 171 | 3300005842 | Ga0068858_100143738 | Ga0068858_1001437382 | 312 |
| 172 | 3300006844 | Ga0075428_100017990 | Ga0075428_1000179902 | 312 |
| 173 | 3300006881 | Ga0068865_100317958 | Ga0068865_1003179582 | 312 |
| 174 | 3300009093 | Ga0105240_10059583 | Ga0105240_100595832 | 312 |
| 175 | 3300009094 | Ga0111539_10004174 | Ga0111539_100041745 | 312 |
| 176 | 3300009147 | Ga0114129_10268434 | Ga0114129_102684342 | 312 |
| 177 | 3300014326 | Ga0157380_10000913 | Ga0157380_100009138 | 312 |
| 178 | 3300014326 | Ga0157380_10004916 | Ga0157380_100049168 | 312 |
| 179 | 3300025908 | Ga0207643_10172458 | Ga0207643_101724582 | 312 |
| 180 | 3300025913 | Ga0207695_10126163 | Ga0207695_101261633 | 312 |
| 181 | 3300025917 | Ga0207660_10085505 | Ga0207660_100855052 | 312 |
| 182 | 3300025937 | Ga0207669_10216488 | Ga0207669_102164882 | 312 |
| 183 | 3300025938 | Ga0207704_10166574 | Ga0207704_101665742 | 312 |
| 184 | 3300026035 | Ga0207703_10201146 | Ga0207703_102011461 | 312 |
| 185 | 3300026078 | Ga0207702_10090609 | Ga0207702_100906093 | 312 |
| 186 | 3300027907 | Ga0207428_10002086 | Ga0207428_100020865 | 312 |
| 187 | 3300027907 | Ga0207428_10042966 | Ga0207428_100429663 | 312 |
| 188 | 3300031852 | Ga0307410_10064510 | Ga0307410_100645103 | 312 |
| 189 | 3300031901 | Ga0307406_10095276 | Ga0307406_100952762 | 312 |
| 190 | 3300031903 | Ga0307407_10060086 | Ga0307407_100600861 | 312 |
| 191 | 3300050507 | nmdc:mga05p37_254865_c1 | nmdc:mga05p37_254865_c1_667_1629 | 312 |
| 192 | 3300050511 | nmdc:mga08y16_101662_c1 | nmdc:mga08y16_101662_c1_1823_2797 | 312 |
| 193 | 3300005327 | Ga0070658_10083883 | Ga0070658_100838832 | 313 |
| 194 | 3300005438 | Ga0070701_10173203 | Ga0070701_101732032 | 313 |
| 195 | 3300005441 | Ga0070700_100024762 | Ga0070700_1000247624 | 313 |
| 196 | 3300005530 | Ga0070679_100166303 | Ga0070679_1001663032 | 313 |
| 197 | 3300005842 | Ga0068858_100004236 | Ga0068858_1000042368 | 313 |
| 198 | 3300006237 | Ga0097621_100211467 | Ga0097621_1002114672 | 313 |
| 199 | 3300006847 | Ga0075431_100040671 | Ga0075431_1000406713 | 313 |
| 200 | 3300006847 | Ga0075431_100155698 | Ga0075431_1001556983 | 313 |
| 201 | 3300006852 | Ga0075433_10146340 | Ga0075433_101463402 | 313 |
| 202 | 3300006880 | Ga0075429_100016367 | Ga0075429_1000163677 | 313 |
| 203 | 3300006881 | Ga0068865_100154425 | Ga0068865_1001544251 | 313 |
| 204 | 3300006914 | Ga0075436_100055301 | Ga0075436_1000553013 | 313 |
| 205 | 3300007076 | Ga0075435_100435800 | Ga0075435_1004358001 | 313 |
| 206 | 3300009147 | Ga0114129_10084789 | Ga0114129_100847894 | 313 |
| 207 | 3300009177 | Ga0105248_10022329 | Ga0105248_100223297 | 313 |
| 208 | 3300009177 | Ga0105248_10125883 | Ga0105248_101258832 | 313 |
| 209 | 3300013296 | Ga0157374_10035609 | Ga0157374_100356094 | 313 |
| 210 | 3300014969 | Ga0157376_10018030 | Ga0157376_100180303 | 313 |
| 211 | 3300025912 | Ga0207707_10217647 | Ga0207707_102176472 | 313 |
| 212 | 3300025919 | Ga0207657_10008966 | Ga0207657_100089666 | 313 |
| 213 | 3300025936 | Ga0207670_10223894 | Ga0207670_102238942 | 313 |
| 214 | 3300025937 | Ga0207669_10159512 | Ga0207669_101595121 | 313 |
| 215 | 3300025938 | Ga0207704_10042950 | Ga0207704_100429503 | 313 |
| 216 | 3300025941 | Ga0207711_10167153 | Ga0207711_101671532 | 313 |
| 217 | 3300026035 | Ga0207703_10029761 | Ga0207703_100297614 | 313 |
| 218 | 3300026089 | Ga0207648_10105958 | Ga0207648_101059583 | 313 |
| 219 | 3300026121 | Ga0207683_10242964 | Ga0207683_102429642 | 313 |
| 220 | 3300050507 | nmdc:mga05p37_240666_c1 | nmdc:mga05p37_240666_c1_1022_1990 | 313 |
| 221 | 3300050507 | nmdc:mga05p37_421673_c1 | nmdc:mga05p37_421673_c1_243_1205 | 313 |
| 222 | 3300050508 | nmdc:mga09592_30220_c1 | nmdc:mga09592_30220_c1_2221_3183 | 313 |
| 223 | 3300050510 | nmdc:mga06r32_75691_c1 | nmdc:mga06r32_75691_c1_1607_2569 | 313 |
| 224 | 3300050510 | nmdc:mga06r32_80538_c1 | nmdc:mga06r32_80538_c1_858_1802 | 313 |
| 225 | 3300050512 | nmdc:mga0n895_87429_c1 | nmdc:mga0n895_87429_c1_817_1806 | 313 |
| 226 | 3300050515 | nmdc:mga0a205_307759_c1 | nmdc:mga0a205_307759_c1_222_1184 | 313 |
| 227 | 3300053104 | Ga0500556_0005539 | Ga0500556_0005539_1182_2141 | 313 |
| 228 | 3300002459 | JGI24751J29686_10006372 | JGI24751J29686_100063723 | 314 |
| 229 | 3300005290 | Ga0065712_10003970 | Ga0065712_100039703 | 314 |
| 230 | 3300005293 | Ga0065715_10285746 | Ga0065715_102857461 | 314 |
| 231 | 3300005328 | Ga0070676_10316703 | Ga0070676_103167031 | 314 |
| 232 | 3300005330 | Ga0070690_100005710 | Ga0070690_1000057104 | 314 |
| 233 | 3300005330 | Ga0070690_100217162 | Ga0070690_1002171621 | 314 |
| 234 | 3300005331 | Ga0070670_100040942 | Ga0070670_1000409422 | 314 |
| 235 | 3300005335 | Ga0070666_10212756 | Ga0070666_102127561 | 314 |
| 236 | 3300005343 | Ga0070687_100018562 | Ga0070687_1000185623 | 314 |
| 237 | 3300005353 | Ga0070669_100025806 | Ga0070669_1000258062 | 314 |
| 238 | 3300005354 | Ga0070675_100000647 | Ga0070675_10000064725 | 314 |
| 239 | 3300005355 | Ga0070671_100108853 | Ga0070671_1001088532 | 314 |
| 240 | 3300005356 | Ga0070674_100002099 | Ga0070674_1000020997 | 314 |
| 241 | 3300005356 | Ga0070674_100022357 | Ga0070674_1000223573 | 314 |
| 242 | 3300005356 | Ga0070674_100023188 | Ga0070674_1000231883 | 314 |
| 243 | 3300005356 | Ga0070674_100166586 | Ga0070674_1001665861 | 314 |
| 244 | 3300005364 | Ga0070673_100115092 | Ga0070673_1001150923 | 314 |
| 245 | 3300005364 | Ga0070673_100404620 | Ga0070673_1004046202 | 314 |
| 246 | 3300005366 | Ga0070659_100106334 | Ga0070659_1001063343 | 314 |
| 247 | 3300005367 | Ga0070667_100013351 | Ga0070667_1000133514 | 314 |
| 248 | 3300005434 | Ga0070709_10070578 | Ga0070709_100705782 | 314 |
| 249 | 3300005436 | Ga0070713_100004221 | Ga0070713_1000042214 | 314 |
| 250 | 3300005444 | Ga0070694_100000539 | Ga0070694_1000005394 | 314 |
| 251 | 3300005445 | Ga0070708_100124773 | Ga0070708_1001247731 | 314 |
| 252 | 3300005456 | Ga0070678_100449915 | Ga0070678_1004499151 | 314 |
| 253 | 3300005457 | Ga0070662_100116918 | Ga0070662_1001169182 | 314 |
| 254 | 3300005458 | Ga0070681_10433715 | Ga0070681_104337151 | 314 |
| 255 | 3300005459 | Ga0068867_100309444 | Ga0068867_1003094442 | 314 |
| 256 | 3300005468 | Ga0070707_100530767 | Ga0070707_1005307671 | 314 |
| 257 | 3300005518 | Ga0070699_100004615 | Ga0070699_1000046153 | 314 |
| 258 | 3300005518 | Ga0070699_100081083 | Ga0070699_1000810832 | 314 |
| 259 | 3300005530 | Ga0070679_100222756 | Ga0070679_1002227561 | 314 |
| 260 | 3300005536 | Ga0070697_100013459 | Ga0070697_1000134596 | 314 |
| 261 | 3300005543 | Ga0070672_100033003 | Ga0070672_1000330032 | 314 |
| 262 | 3300005544 | Ga0070686_100004247 | Ga0070686_1000042474 | 314 |
| 263 | 3300005544 | Ga0070686_100327751 | Ga0070686_1003277511 | 314 |
| 264 | 3300005545 | Ga0070695_100000815 | Ga0070695_10000081512 | 314 |
| 265 | 3300005546 | Ga0070696_100473446 | Ga0070696_1004734461 | 314 |
| 266 | 3300005548 | Ga0070665_100000771 | Ga0070665_10000077114 | 314 |
| 267 | 3300005548 | Ga0070665_100013960 | Ga0070665_1000139605 | 314 |
| 268 | 3300005549 | Ga0070704_100009438 | Ga0070704_1000094385 | 314 |
| 269 | 3300005549 | Ga0070704_100096686 | Ga0070704_1000966863 | 314 |
| 270 | 3300005577 | Ga0068857_100103243 | Ga0068857_1001032432 | 314 |
| 271 | 3300005578 | Ga0068854_100028019 | Ga0068854_1000280192 | 314 |
| 272 | 3300005617 | Ga0068859_100048348 | Ga0068859_1000483485 | 314 |
| 273 | 3300005617 | Ga0068859_100064107 | Ga0068859_1000641073 | 314 |
| 274 | 3300005617 | Ga0068859_100503216 | Ga0068859_1005032161 | 314 |
| 275 | 3300005618 | Ga0068864_100007993 | Ga0068864_1000079933 | 314 |
| 276 | 3300005719 | Ga0068861_100101688 | Ga0068861_1001016882 | 314 |
| 277 | 3300005719 | Ga0068861_100353348 | Ga0068861_1003533481 | 314 |
| 278 | 3300005841 | Ga0068863_100004024 | Ga0068863_10000402411 | 314 |
| 279 | 3300005842 | Ga0068858_100118038 | Ga0068858_1001180382 | 314 |
| 280 | 3300005842 | Ga0068858_100140039 | Ga0068858_1001400393 | 314 |
| 281 | 3300005844 | Ga0068862_100224523 | Ga0068862_1002245233 | 314 |
| 282 | 3300005937 | Ga0081455_10185420 | Ga0081455_101854202 | 314 |
| 283 | 3300006042 | Ga0075368_10096496 | Ga0075368_100964962 | 314 |
| 284 | 3300006058 | Ga0075432_10019274 | Ga0075432_100192741 | 314 |
| 285 | 3300006237 | Ga0097621_100041369 | Ga0097621_1000413692 | 314 |
| 286 | 3300006237 | Ga0097621_100242225 | Ga0097621_1002422251 | 314 |
| 287 | 3300006358 | Ga0068871_100013993 | Ga0068871_1000139935 | 314 |
| 288 | 3300006844 | Ga0075428_100000003 | Ga0075428_100000003140 | 314 |
| 289 | 3300006844 | Ga0075428_100108374 | Ga0075428_1001083742 | 314 |
| 290 | 3300006844 | Ga0075428_100456412 | Ga0075428_1004564122 | 314 |
| 291 | 3300006852 | Ga0075433_10039426 | Ga0075433_100394264 | 314 |
| 292 | 3300006852 | Ga0075433_10322403 | Ga0075433_103224032 | 314 |
| 293 | 3300006852 | Ga0075433_10345290 | Ga0075433_103452902 | 314 |
| 294 | 3300006871 | Ga0075434_100007059 | Ga0075434_1000070594 | 314 |
| 295 | 3300006871 | Ga0075434_100010070 | Ga0075434_1000100705 | 314 |
| 296 | 3300006871 | Ga0075434_100061070 | Ga0075434_1000610704 | 314 |
| 297 | 3300006871 | Ga0075434_100113712 | Ga0075434_1001137123 | 314 |
| 298 | 3300006881 | Ga0068865_100145859 | Ga0068865_1001458591 | 314 |
| 299 | 3300006914 | Ga0075436_100003909 | Ga0075436_1000039096 | 314 |
| 300 | 3300006914 | Ga0075436_100027045 | Ga0075436_1000270452 | 314 |
| 301 | 3300006914 | Ga0075436_100034357 | Ga0075436_1000343573 | 314 |
| 302 | 3300006914 | Ga0075436_100161975 | Ga0075436_1001619751 | 314 |
| 303 | 3300006914 | Ga0075436_100313134 | Ga0075436_1003131341 | 314 |
| 304 | 3300006931 | Ga0097620_100048349 | Ga0097620_1000483495 | 314 |
| 305 | 3300006931 | Ga0097620_100064105 | Ga0097620_1000641053 | 314 |
| 306 | 3300006931 | Ga0097620_100503226 | Ga0097620_1005032261 | 314 |
| 307 | 3300007076 | Ga0075435_100000111 | Ga0075435_1000001116 | 314 |
| 308 | 3300007076 | Ga0075435_100000810 | Ga0075435_10000081014 | 314 |
| 309 | 3300007076 | Ga0075435_100009027 | Ga0075435_1000090276 | 314 |
| 310 | 3300007076 | Ga0075435_100015330 | Ga0075435_1000153302 | 314 |
| 311 | 3300007076 | Ga0075435_100093793 | Ga0075435_1000937933 | 314 |
| 312 | 3300009093 | Ga0105240_10185190 | Ga0105240_101851901 | 314 |
| 313 | 3300009094 | Ga0111539_10000001 | Ga0111539_10000001399 | 314 |
| 314 | 3300009094 | Ga0111539_10000827 | Ga0111539_1000082727 | 314 |
| 315 | 3300009094 | Ga0111539_10032764 | Ga0111539_100327646 | 314 |
| 316 | 3300009094 | Ga0111539_10176809 | Ga0111539_101768092 | 314 |
| 317 | 3300009094 | Ga0111539_10765107 | Ga0111539_107651072 | 314 |
| 318 | 3300009098 | Ga0105245_10275849 | Ga0105245_102758492 | 314 |
| 319 | 3300009101 | Ga0105247_10159485 | Ga0105247_101594852 | 314 |
| 320 | 3300009147 | Ga0114129_10002549 | Ga0114129_1000254924 | 314 |
| 321 | 3300009147 | Ga0114129_10010179 | Ga0114129_100101798 | 314 |
| 322 | 3300009147 | Ga0114129_10046703 | Ga0114129_100467034 | 314 |
| 323 | 3300009147 | Ga0114129_10096563 | Ga0114129_100965632 | 314 |
| 324 | 3300009147 | Ga0114129_10490390 | Ga0114129_104903901 | 314 |
| 325 | 3300009148 | Ga0105243_10009141 | Ga0105243_100091419 | 314 |
| 326 | 3300009174 | Ga0105241_10071097 | Ga0105241_100710973 | 314 |
| 327 | 3300009176 | Ga0105242_10032323 | Ga0105242_100323233 | 314 |
| 328 | 3300009176 | Ga0105242_10094726 | Ga0105242_100947262 | 314 |
| 329 | 3300009177 | Ga0105248_10079589 | Ga0105248_100795893 | 314 |
| 330 | 3300009177 | Ga0105248_10166242 | Ga0105248_101662423 | 314 |
| 331 | 3300009177 | Ga0105248_10255673 | Ga0105248_102556732 | 314 |
| 332 | 3300009177 | Ga0105248_10655231 | Ga0105248_106552311 | 314 |
| 333 | 3300009553 | Ga0105249_10160666 | Ga0105249_101606662 | 314 |
| 334 | 3300009553 | Ga0105249_10173772 | Ga0105249_101737723 | 314 |
| 335 | 3300013296 | Ga0157374_10002165 | Ga0157374_100021652 | 314 |
| 336 | 3300013296 | Ga0157374_10152617 | Ga0157374_101526173 | 314 |
| 337 | 3300013297 | Ga0157378_10593507 | Ga0157378_105935071 | 314 |
| 338 | 3300013306 | Ga0163162_10066865 | Ga0163162_100668654 | 314 |
| 339 | 3300013306 | Ga0163162_10102842 | Ga0163162_101028422 | 314 |
| 340 | 3300013306 | Ga0163162_10464174 | Ga0163162_104641741 | 314 |
| 341 | 3300013308 | Ga0157375_10303562 | Ga0157375_103035623 | 314 |
| 342 | 3300014325 | Ga0163163_10014722 | Ga0163163_100147224 | 314 |
| 343 | 3300014325 | Ga0163163_10078025 | Ga0163163_100780254 | 314 |
| 344 | 3300014326 | Ga0157380_10102203 | Ga0157380_101022032 | 314 |
| 345 | 3300014326 | Ga0157380_10260463 | Ga0157380_102604632 | 314 |
| 346 | 3300014745 | Ga0157377_10172127 | Ga0157377_101721271 | 314 |
| 347 | 3300014968 | Ga0157379_10053981 | Ga0157379_100539813 | 314 |
| 348 | 3300014969 | Ga0157376_10035742 | Ga0157376_100357423 | 314 |
| 349 | 3300014969 | Ga0157376_10046931 | Ga0157376_100469313 | 314 |
| 350 | 3300025903 | Ga0207680_10152108 | Ga0207680_101521082 | 314 |
| 351 | 3300025906 | Ga0207699_10037693 | Ga0207699_100376933 | 314 |
| 352 | 3300025911 | Ga0207654_10017021 | Ga0207654_100170213 | 314 |
| 353 | 3300025918 | Ga0207662_10006467 | Ga0207662_100064673 | 314 |
| 354 | 3300025922 | Ga0207646_10037673 | Ga0207646_100376733 | 314 |
| 355 | 3300025922 | Ga0207646_10052394 | Ga0207646_100523944 | 314 |
| 356 | 3300025922 | Ga0207646_10395510 | Ga0207646_103955101 | 314 |
| 357 | 3300025923 | Ga0207681_10007925 | Ga0207681_100079256 | 314 |
| 358 | 3300025926 | Ga0207659_10001565 | Ga0207659_1000156511 | 314 |
| 359 | 3300025927 | Ga0207687_10159403 | Ga0207687_101594032 | 314 |
| 360 | 3300025928 | Ga0207700_10124554 | Ga0207700_101245542 | 314 |
| 361 | 3300025931 | Ga0207644_10200932 | Ga0207644_102009322 | 314 |
| 362 | 3300025934 | Ga0207686_10016274 | Ga0207686_100162743 | 314 |
| 363 | 3300025936 | Ga0207670_10242670 | Ga0207670_102426701 | 314 |
| 364 | 3300025937 | Ga0207669_10022483 | Ga0207669_100224833 | 314 |
| 365 | 3300025937 | Ga0207669_10034198 | Ga0207669_100341983 | 314 |
| 366 | 3300025939 | Ga0207665_10050700 | Ga0207665_100507002 | 314 |
| 367 | 3300025940 | Ga0207691_10285907 | Ga0207691_102859071 | 314 |
| 368 | 3300025941 | Ga0207711_10053644 | Ga0207711_100536443 | 314 |
| 369 | 3300025941 | Ga0207711_10228384 | Ga0207711_102283841 | 314 |
| 370 | 3300025941 | Ga0207711_10372907 | Ga0207711_103729071 | 314 |
| 371 | 3300025941 | Ga0207711_10562836 | Ga0207711_105628361 | 314 |
| 372 | 3300025945 | Ga0207679_10067882 | Ga0207679_100678822 | 314 |
| 373 | 3300025949 | Ga0207667_10402344 | Ga0207667_104023441 | 314 |
| 374 | 3300025960 | Ga0207651_10277997 | Ga0207651_102779971 | 314 |
| 375 | 3300025961 | Ga0207712_10284136 | Ga0207712_102841362 | 314 |
| 376 | 3300025981 | Ga0207640_10019459 | Ga0207640_100194593 | 314 |
| 377 | 3300025981 | Ga0207640_10046696 | Ga0207640_100466963 | 314 |
| 378 | 3300026035 | Ga0207703_10089247 | Ga0207703_100892473 | 314 |
| 379 | 3300026035 | Ga0207703_10117230 | Ga0207703_101172302 | 314 |
| 380 | 3300026035 | Ga0207703_10451909 | Ga0207703_104519092 | 314 |
| 381 | 3300026075 | Ga0207708_10128649 | Ga0207708_101286493 | 314 |
| 382 | 3300026088 | Ga0207641_10001443 | Ga0207641_1000144312 | 314 |
| 383 | 3300026088 | Ga0207641_10359227 | Ga0207641_103592272 | 314 |
| 384 | 3300026089 | Ga0207648_10058005 | Ga0207648_100580052 | 314 |
| 385 | 3300026089 | Ga0207648_10160594 | Ga0207648_101605942 | 314 |
| 386 | 3300026095 | Ga0207676_10005302 | Ga0207676_100053024 | 314 |
| 387 | 3300026095 | Ga0207676_10013484 | Ga0207676_100134846 | 314 |
| 388 | 3300026116 | Ga0207674_10097991 | Ga0207674_100979912 | 314 |
| 389 | 3300026118 | Ga0207675_100009768 | Ga0207675_1000097688 | 314 |
| 390 | 3300027907 | Ga0207428_10000002 | Ga0207428_10000002410 | 314 |
| 391 | 3300027907 | Ga0207428_10090168 | Ga0207428_100901682 | 314 |
| 392 | 3300028379 | Ga0268266_10003281 | Ga0268266_1000328112 | 314 |
| 393 | 3300028380 | Ga0268265_10205765 | Ga0268265_102057651 | 314 |
| 394 | 3300028381 | Ga0268264_10143714 | Ga0268264_101437142 | 314 |
| 395 | 3300034816 | Ga0373930_0000697 | Ga0373930_0000697_3217_4164 | 314 |
| 396 | 3300034817 | Ga0373948_0002506 | Ga0373948_0002506_1255_2202 | 314 |
| 397 | 3300034819 | Ga0373958_0018223 | Ga0373958_0018223_312_1259 | 314 |
| 398 | 3300034820 | Ga0373959_0001519 | Ga0373959_0001519_1283_2230 | 314 |
| 399 | 3300034957 | Ga0373938_0002592 | Ga0373938_0002592_1394_2341 | 314 |
| 400 | 3300035085 | Ga0373929_0013702 | Ga0373929_0013702_576_1523 | 314 |
| 401 | 3300035090 | Ga0373949_0004859 | Ga0373949_0004859_1548_2495 | 314 |
| 402 | 3300035091 | Ga0373951_0015273 | Ga0373951_0015273_431_1378 | 314 |
| 403 | 3300035111 | Ga0373923_0109693 | Ga0373923_0109693_35_1000 | 314 |
| 404 | 3300035112 | Ga0373932_0001911 | Ga0373932_0001911_3632_4579 | 314 |
| 405 | 3300035113 | Ga0373936_0090375 | Ga0373936_0090375_199_1164 | 314 |
| 406 | 3300035114 | Ga0373939_0020814 | Ga0373939_0020814_711_1658 | 314 |
| 407 | 3300035115 | Ga0373941_0003424 | Ga0373941_0003424_1165_2112 | 314 |
| 408 | 3300035121 | Ga0373960_0001571 | Ga0373960_0001571_3947_4894 | 314 |
| 409 | 3300035171 | Ga0373946_0016584 | Ga0373946_0016584_1682_2647 | 314 |
| 410 | 3300035241 | Ga0373961_0001372 | Ga0373961_0001372_5825_6772 | 314 |
| 411 | 3300035242 | Ga0373962_0021861 | Ga0373962_0021861_527_1474 | 314 |
| 412 | 3300035410 | Ga0373924_0071867 | Ga0373924_0071867_219_1184 | 314 |
| 413 | 3300035691 | Ga0373931_0049040 | Ga0373931_0049040_445_1392 | 314 |
| 414 | 3300035695 | Ga0373927_0119777 | Ga0373927_0119777_189_1154 | 314 |
| 415 | 3300036401 | Ga0373937_0297260 | Ga0373937_0297260_548_1492 | 314 |
| 416 | 3300037068 | Ga0373925_0007435 | Ga0373925_0007435_4603_5568 | 314 |
| 417 | 3300046454 | Ga0495592_0018363 | Ga0495592_0018363_3577_4536 | 314 |
| 418 | 3300046473 | Ga0495582_0127316 | Ga0495582_0127316_134_1081 | 314 |
| 419 | 3300046511 | Ga0495608_0062166 | Ga0495608_0062166_314_1279 | 314 |
| 420 | 3300046516 | Ga0495628_0084785 | Ga0495628_0084785_847_1812 | 314 |
| 421 | 3300046517 | Ga0495630_0006053 | Ga0495630_0006053_488_1453 | 314 |
| 422 | 3300046543 | Ga0495645_0172974 | Ga0495645_0172974_479_1444 | 314 |
| 423 | 3300046559 | Ga0495667_0099656 | Ga0495667_0099656_567_1532 | 314 |
| 424 | 3300046675 | Ga0495657_0194358 | Ga0495657_0194358_142_1107 | 314 |
| 425 | 3300046681 | Ga0495647_0039820 | Ga0495647_0039820_42_989 | 314 |
| 426 | 3300046684 | Ga0495669_0109870 | Ga0495669_0109870_290_1237 | 314 |
| 427 | 3300046689 | Ga0495613_0001615 | Ga0495613_0001615_1737_2702 | 314 |
| 428 | 3300046809 | Ga0495600_0042052 | Ga0495600_0042052_1221_2186 | 314 |
| 429 | 3300047317 | Ga0495604_0079335 | Ga0495604_0079335_741_1685 | 314 |
| 430 | 3300047319 | Ga0495674_0010439 | Ga0495674_0010439_1400_2365 | 314 |
| 431 | 3300048904 | Ga0496101_0000773 | Ga0496101_0000773_11682_12647 | 314 |
| 432 | 3300048907 | Ga0496104_0048058 | Ga0496104_0048058_381_1346 | 314 |
| 433 | 3300048907 | Ga0496104_0133289 | Ga0496104_0133289_1314_2258 | 314 |
| 434 | 3300048907 | Ga0496104_0364203 | Ga0496104_0364203_201_1148 | 314 |
| 435 | 3300048909 | Ga0496106_0134316 | Ga0496106_0134316_733_1680 | 314 |
| 436 | 3300048911 | Ga0496108_0006865 | Ga0496108_0006865_382_1329 | 314 |
| 437 | 3300048912 | Ga0496109_0572768 | Ga0496109_0572768_106_1053 | 314 |
| 438 | 3300048915 | Ga0496112_0005637 | Ga0496112_0005637_1390_2337 | 314 |
| 439 | 3300048915 | Ga0496112_0466922 | Ga0496112_0466922_207_1151 | 314 |
| 440 | 3300048917 | Ga0496114_0000233 | Ga0496114_0000233_34214_35179 | 314 |
| 441 | 3300048917 | Ga0496114_0031034 | Ga0496114_0031034_611_1558 | 314 |
| 442 | 3300049576 | Ga0501040_0108644 | Ga0501040_0108644_686_1657 | 314 |
| 443 | 3300049591 | Ga0501075_0009690 | Ga0501075_0009690_1675_2646 | 314 |
| 444 | 3300049741 | Ga0501079_0197626 | Ga0501079_0197626_176_1147 | 314 |
| 445 | 3300050507 | nmdc:mga05p37_13544_c1 | nmdc:mga05p37_13544_c1_8373_9320 | 314 |
| 446 | 3300050507 | nmdc:mga05p37_15680_c1 | nmdc:mga05p37_15680_c1_877_1824 | 314 |
| 447 | 3300050507 | nmdc:mga05p37_45139_c1 | nmdc:mga05p37_45139_c1_2412_3359 | 314 |
| 448 | 3300050507 | nmdc:mga05p37_626998_c1 | nmdc:mga05p37_626998_c1_10_957 | 314 |
| 449 | 3300050511 | nmdc:mga08y16_13575_c1 | nmdc:mga08y16_13575_c1_5418_6365 | 314 |
| 450 | 3300050511 | nmdc:mga08y16_20418_c1 | nmdc:mga08y16_20418_c1_831_1778 | 314 |
| 451 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_429932_430912 | 314 |
| 452 | 3300050512 | nmdc:mga0n895_18764_c1 | nmdc:mga0n895_18764_c1_3739_4686 | 314 |
| 453 | 3300050512 | nmdc:mga0n895_362399_c1 | nmdc:mga0n895_362399_c1_205_1152 | 314 |
| 454 | 3300050512 | nmdc:mga0n895_45488_c1 | nmdc:mga0n895_45488_c1_133_1080 | 314 |
| 455 | 3300050512 | nmdc:mga0n895_5949_c1 | nmdc:mga0n895_5949_c1_5254_6201 | 314 |
| 456 | 3300050513 | nmdc:mga0rr50_30525_c1 | nmdc:mga0rr50_30525_c1_1381_2331 | 314 |
| 457 | 3300050513 | nmdc:mga0rr50_3_c1 | nmdc:mga0rr50_3_c1_6820_7767 | 314 |
| 458 | 3300050513 | nmdc:mga0rr50_40183_c1 | nmdc:mga0rr50_40183_c1_511_1458 | 314 |
| 459 | 3300050513 | nmdc:mga0rr50_43000_c1 | nmdc:mga0rr50_43000_c1_1970_2917 | 314 |
| 460 | 3300050513 | nmdc:mga0rr50_5622_c1 | nmdc:mga0rr50_5622_c1_5775_6722 | 314 |
| 461 | 3300050513 | nmdc:mga0rr50_62931_c1 | nmdc:mga0rr50_62931_c1_1203_2150 | 314 |
| 462 | 3300050514 | nmdc:mga08x19_239783_c1 | nmdc:mga08x19_239783_c1_231_1178 | 314 |
| 463 | 3300050514 | nmdc:mga08x19_262152_c1 | nmdc:mga08x19_262152_c1_41_988 | 314 |
| 464 | 3300050514 | nmdc:mga08x19_627_c1 | nmdc:mga08x19_627_c1_3726_4673 | 314 |
| 465 | 3300050514 | nmdc:mga08x19_96312_c1 | nmdc:mga08x19_96312_c1_264_1214 | 314 |
| 466 | 3300050515 | nmdc:mga0a205_273574_c1 | nmdc:mga0a205_273574_c1_510_1457 | 314 |
| 467 | 3300050515 | nmdc:mga0a205_57111_c1 | nmdc:mga0a205_57111_c1_1787_2734 | 314 |
| 468 | 3300050515 | nmdc:mga0a205_58999_c1 | nmdc:mga0a205_58999_c1_1810_2757 | 314 |
| 469 | 3300050515 | nmdc:mga0a205_66025_c1 | nmdc:mga0a205_66025_c1_1049_1996 | 314 |
| 470 | 3300053077 | Ga0495601_0002222 | Ga0495601_0002222_2529_3494 | 314 |
| 471 | 3300053085 | Ga0495619_0022423 | Ga0495619_0022423_2681_3646 | 314 |
| 472 | 3300053085 | Ga0495619_0198688 | Ga0495619_0198688_320_1267 | 314 |
| 473 | 3300060353 | Ga0501082_0027944 | Ga0501082_0027944_2985_3956 | 314 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uwy-assembly1.cif.gz_A-2 | the crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005 | 0.9433 | 1 | 308 |
| 5uwy-assembly1.cif.gz_A-2 | the crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005 | 0.9404 | 1 | 308 |
| 4gcm-assembly1.cif.gz_A | crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. aureus mu50 at 1.80 a resolution | 0.9382 | 6 | 306 |
| 2q7v-assembly1.cif.gz_B | crystal structure of deinococcus radiodurans thioredoxin reductase | 0.9364 | 6 | 308 |
| 5uth-assembly1.cif.gz_A | crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad | 0.9342 | 3 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5uthA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9689 | 116 | 240 | 3.50.50.60 |
| 2q0kA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9638 | 116 | 240 | 3.50.50.60 |
| 5uthA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9613 | 116 | 240 | 3.50.50.60 |
| 3f8rD02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9583 | 116 | 240 | 3.50.50.60 |
| 2q0kA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9563 | 116 | 240 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0YJU2-F1-model_v4 | deleted | 0.996 | 134 | 203 |
|
| AF-A0A3C0YJU2-F1-model_v4 | deleted | 0.9821 | 134 | 203 |
|
| AF-A0A3D5UWY6-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9803 | 141 | 232 |
GO:0016491
|
| AF-K1UEN0-F1-model_v4 | Protein containing Pyridine nucleotide-disulfide oxidoreductase, NAD-binding region domain protein (EC 1.-.-.-) | 0.9741 | 139 | 206 |
GO:0016491
|
| AF-A0A7H4N4U0-F1-model_v4 | Alkyl hydroperoxide reductase protein F (EC 1.8.1.-) | 0.9664 | 118 | 200 |
GO:0016668
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar