F451004

General Info

Members Datasets Scaffolds Average Seq Length
473 249 946 227

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10115338|Ga0157372_101153382
Length 261
Sequence MIIFCSQQLFFTDRLLCHSLQRSEHCSTKQNPELCFLVMERILQLTSDGSYTIAVPSMHVTYHSIHGAIQESMHVFINAGLQPLLHQFETLHIFEMGFGTGLNALLSLQQATQHNQKIFYYAAELFPLKPYEYSSLNYSSKLQNDSLQSYFKLMHECEWGKDVSIHPLFTLHKTNESLLNLITDHAFNLIFFDAFAPAAQPELWTQQVFKKVFQLLANKGMLVTYCSKGDVRRAMLAADFKVEKLQGPPRKREMLRAIKAI

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
185 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
186 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
187 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
206 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
207 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
210 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
213 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
214 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
230 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
235 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
236 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 2738541278 Niastella sp. CF465 Isolate Unclassified
243 2818991444 Filimonas endophytica 3197 Isolate Unclassified
244 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
245 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
246 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
247 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
248 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
249 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.36
Nodule 0
Rhizoplane 0.21
Rhizosphere 80.97
Stem 0
Stem Tuber 0
Unclassified 11.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10115338 3300013307 Bacteria 3080
2 JGI24740J21852_10004905 3300001979 Bacteria 5692
3 JGI24740J21852_10033948 3300001979 Bacteria 1613
4 JGI24739J22299_10124070 3300001989 Bacteria 770
5 JGI24744J21845_10022158 3300002077 Bacteria 1248
6 JGI25154J39366_1000012 3300002738 Bacteria 287601
7 JGI25406J46586_10002742 3300003203 Bacteria 8291
8 JGI25153J46596_10027577 3300003215 Unclassified 1986
9 rootH1_10060194 3300003316 Bacteria 1919
10 rootH1_10179425 3300003316 Bacteria 1096
11 rootH1_10190589 3300003316 Bacteria 2395
12 rootH2_10115022 3300003320 Bacteria 1638
13 rootH2_10135145 3300003320 Bacteria 1832
14 rootH2_10168463 3300003320 Bacteria 2158
15 rootH2_10198254 3300003320 Bacteria 1197
16 rootH2_10314643 3300003320 Bacteria 1261
17 rootL2_10014974 3300003322 Bacteria 21232
18 rootL2_10020852 3300003322 Bacteria 3243
19 rootL2_10051034 3300003322 Bacteria 4261
20 rootL2_10086591 3300003322 Bacteria 3381
21 rootL2_10113318 3300003322 Bacteria 1928
22 rootL2_10168080 3300003322 Bacteria 1314
23 rootL2_10201946 3300003322 Unclassified 2519
24 rootL2_10253065 3300003322 Unclassified 1586
25 rootH1_10020501 3300003323 Bacteria 26877
26 rootH1_10044480 3300003323 Bacteria 1884
27 JGI25160J50197_1003604 3300003354 Bacteria 6874
28 JGI25160J50197_1021931 3300003354 Bacteria 1883
29 Ga0055526_1011118 3300003771 Bacteria 4100
30 Ga0055526_1023425 3300003771 Bacteria 2061
31 Ga0055528_1000153 3300003790 Bacteria 57255
32 Ga0055530_10000805 3300003791 Bacteria 26057
33 Ga0055531_10000284 3300003794 Bacteria 51146
34 Ga0055531_10020731 3300003794 Bacteria 2586
35 Ga0065165_1000159 3300005262 Bacteria 116983
36 Ga0065714_10094168 3300005288 Bacteria 1824
37 Ga0065704_10181233 3300005289 Bacteria 1236
38 Ga0065712_10075441 3300005290 Bacteria 3844
39 Ga0065712_10247499 3300005290 Bacteria 960
40 Ga0065707_10110999 3300005295 Bacteria 2409
41 Ga0070676_10126559 3300005328 Bacteria 1611
42 Ga0070683_100009092 3300005329 Bacteria 8480
43 Ga0070683_100045346 3300005329 Bacteria 4057
44 Ga0070683_100188632 3300005329 Bacteria 1957
45 Ga0070683_100565705 3300005329 Bacteria 1087
46 Ga0070690_100149390 3300005330 Bacteria 1593
47 Ga0070690_100185000 3300005330 Bacteria 1441
48 Ga0070670_100024005 3300005331 Bacteria 5245
49 Ga0070670_100047379 3300005331 Bacteria 3699
50 Ga0070670_100171677 3300005331 Bacteria 1881
51 Ga0070677_10055701 3300005333 Unclassified 1615
52 Ga0068869_100005758 3300005334 Bacteria 7820
53 Ga0068869_100013589 3300005334 Bacteria 5418
54 Ga0068869_100048044 3300005334 Bacteria 3084
55 Ga0068869_100108289 3300005334 Bacteria 2111
56 Ga0068869_100377233 3300005334 Unclassified 1161
57 Ga0070666_10000064 3300005335 Bacteria 79823
58 Ga0070666_10035817 3300005335 Unclassified 3291
59 Ga0070666_10422133 3300005335 Bacteria 961
60 Ga0070680_100052387 3300005336 Bacteria 3331
61 Ga0070682_100037602 3300005337 Bacteria 2965
62 Ga0068868_100038803 3300005338 Bacteria 3697
63 Ga0068868_100249040 3300005338 Unclassified 1495
64 Ga0068868_100666110 3300005338 Unclassified 928
65 Ga0070689_100084778 3300005340 Bacteria 2490
66 Ga0070687_100084964 3300005343 Bacteria 1736
67 Ga0070687_100275836 3300005343 Bacteria 1056
68 Ga0070661_100010672 3300005344 Bacteria 6390
69 Ga0070661_100191444 3300005344 Unclassified 1560
70 Ga0070668_100037275 3300005347 Bacteria 3712
71 Ga0070668_100100088 3300005347 Bacteria 2296
72 Ga0070669_100011558 3300005353 Bacteria 6264
73 Ga0070669_100291224 3300005353 Bacteria 1311
74 Ga0070675_100002115 3300005354 Bacteria 14665
75 Ga0070675_100037225 3300005354 Bacteria 3962
76 Ga0070675_100046216 3300005354 Bacteria 3565
77 Ga0070675_100252942 3300005354 Bacteria 1543
78 Ga0070675_100602361 3300005354 Unclassified 996
79 Ga0070671_100014145 3300005355 Bacteria 6444
80 Ga0070671_100094207 3300005355 Bacteria 2510
81 Ga0070674_100016973 3300005356 Bacteria 4569
82 Ga0070674_100031799 3300005356 Bacteria 3500
83 Ga0070674_100073072 3300005356 Bacteria 2430
84 Ga0070673_100001051 3300005364 Bacteria 15685
85 Ga0070673_100001247 3300005364 Bacteria 14780
86 Ga0070673_100082188 3300005364 Bacteria 2614
87 Ga0070673_100860164 3300005364 Bacteria 839
88 Ga0070659_100032283 3300005366 Bacteria 4060
89 Ga0070659_100188757 3300005366 Bacteria 1693
90 Ga0070667_100010938 3300005367 Bacteria 7505
91 Ga0070667_100060084 3300005367 Bacteria 3217
92 Ga0070667_100273153 3300005367 Bacteria 1516
93 Ga0070667_100441170 3300005367 Bacteria 1189
94 Ga0070713_100372052 3300005436 Bacteria 1330
95 Ga0070701_10004865 3300005438 Bacteria 5494
96 Ga0070700_100043955 3300005441 Bacteria 2749
97 Ga0070700_100076697 3300005441 Bacteria 2147
98 Ga0070700_100253065 3300005441 Bacteria 1264
99 Ga0070678_100075808 3300005456 Unclassified 2532
100 Ga0070678_100382264 3300005456 Bacteria 1218
101 Ga0070662_100083564 3300005457 Bacteria 2383
102 Ga0070681_10308842 3300005458 Bacteria 1491
103 Ga0068867_100039399 3300005459 Bacteria 3445
104 Ga0068867_100193392 3300005459 Bacteria 1625
105 Ga0068867_100315401 3300005459 Unclassified 1293
106 Ga0070685_10032591 3300005466 Bacteria 2919
107 Ga0070685_10559713 3300005466 Unclassified 817
108 Ga0070679_100166221 3300005530 Bacteria 2180
109 Ga0070684_100004375 3300005535 Bacteria 10739
110 Ga0070684_100041221 3300005535 Unclassified 3980
111 Ga0068853_100115586 3300005539 Bacteria 2388
112 Ga0068853_100671786 3300005539 Bacteria 987
113 Ga0070686_100083930 3300005544 Bacteria 2116
114 Ga0070665_100182033 3300005548 Unclassified 2102
115 Ga0068855_100081596 3300005563 Bacteria 3748
116 Ga0070664_100002301 3300005564 Bacteria 15347
117 Ga0070664_100449055 3300005564 Bacteria 1183
118 Ga0068854_100092580 3300005578 Unclassified 2252
119 Ga0068854_100214856 3300005578 Bacteria 1519
120 Ga0068856_100089448 3300005614 Bacteria 3062
121 Ga0068852_100004036 3300005616 Bacteria 10318
122 Ga0068852_100075299 3300005616 Bacteria 2977
123 Ga0068852_100109367 3300005616 Bacteria 2510
124 Ga0068852_100195423 3300005616 Bacteria 1911
125 Ga0068852_100673015 3300005616 Bacteria 1044
126 Ga0068859_100000003 3300005617 Bacteria 479218
127 Ga0068859_100004846 3300005617 Bacteria 13695
128 Ga0068859_100090517 3300005617 Bacteria 3110
129 Ga0068864_100006628 3300005618 Bacteria 9477
130 Ga0068864_100065234 3300005618 Bacteria 3159
131 Ga0068864_100295274 3300005618 Unclassified 1516
132 Ga0068864_100438104 3300005618 Bacteria 1248
133 Ga0068864_100936538 3300005618 Bacteria 857
134 Ga0068866_10022853 3300005718 Bacteria 2900
135 Ga0068866_10211648 3300005718 Bacteria 1164
136 Ga0068861_100005751 3300005719 Bacteria 8412
137 Ga0068861_100111406 3300005719 Bacteria 2193
138 Ga0068861_100239746 3300005719 Unclassified 1542
139 Ga0068861_100750230 3300005719 Bacteria 912
140 Ga0068851_10069805 3300005834 Bacteria 1816
141 Ga0068870_10009295 3300005840 Bacteria 4465
142 Ga0068863_100003550 3300005841 Bacteria 15382
143 Ga0068858_100002928 3300005842 Bacteria 17176
144 Ga0068858_100710683 3300005842 Bacteria 978
145 Ga0068860_100004200 3300005843 Bacteria 14762
146 Ga0068860_100415839 3300005843 Bacteria 1332
147 Ga0068860_100699801 3300005843 Bacteria 1023
148 Ga0068862_100016622 3300005844 Bacteria 6126
149 Ga0068862_100137800 3300005844 Bacteria 2164
150 Ga0081539_10000534 3300005985 Bacteria 78990
151 Ga0070716_100365301 3300006173 Bacteria 1026
152 Ga0075366_10004372 3300006195 Bacteria 7580
153 Ga0075366_10205199 3300006195 Bacteria 1199
154 Ga0075366_10319450 3300006195 Bacteria 951
155 Ga0097621_100050152 3300006237 Unclassified 3393
156 Ga0097621_100053270 3300006237 Bacteria 3298
157 Ga0097621_100768281 3300006237 Bacteria 891
158 Ga0068871_100034178 3300006358 Bacteria 4032
159 Ga0068871_100235221 3300006358 Bacteria 1591
160 Ga0068871_100291446 3300006358 Bacteria 1430
161 Ga0075429_100181744 3300006880 Bacteria 1843
162 Ga0068865_100007946 3300006881 Bacteria 6550
163 Ga0068865_100026788 3300006881 Bacteria 3803
164 Ga0097620_100000003 3300006931 Bacteria 479218
165 Ga0097620_100004846 3300006931 Bacteria 13695
166 Ga0097620_100090518 3300006931 Bacteria 3110
167 Ga0111539_10002241 3300009094 Bacteria 25812
168 Ga0105245_10052557 3300009098 Unclassified 3654
169 Ga0105245_11136244 3300009098 Unclassified 828
170 Ga0114129_10001630 3300009147 Bacteria 30480
171 Ga0105241_10002666 3300009174 Bacteria 13368
172 Ga0105241_10165420 3300009174 Unclassified 1822
173 Ga0105241_10528225 3300009174 Bacteria 1056
174 Ga0105241_10570020 3300009174 Unclassified 1019
175 Ga0105242_10059536 3300009176 Bacteria 3134
176 Ga0105242_10223040 3300009176 Bacteria 1686
177 Ga0105237_10001055 3300009545 Bacteria 37018
178 Ga0105249_10022049 3300009553 Bacteria 5704
179 Ga0105249_10028477 3300009553 Bacteria 5042
180 Ga0105239_10010713 3300010375 Bacteria 10241
181 Ga0105239_10021156 3300010375 Bacteria 7174
182 Ga0105239_10437487 3300010375 Bacteria 1483
183 Ga0105246_10008490 3300011119 Bacteria 6316
184 Ga0105246_10014719 3300011119 Bacteria 4925
185 Ga0105246_10031070 3300011119 Bacteria 3532
186 Ga0157373_10003011 3300013100 Bacteria 12739
187 Ga0157371_10020010 3300013102 Bacteria 4928
188 Ga0157371_10233830 3300013102 Bacteria 1321
189 Ga0157370_10027313 3300013104 Bacteria 5628
190 Ga0157370_10177001 3300013104 Bacteria 1982
191 Ga0157369_10027453 3300013105 Bacteria 6311
192 Ga0157369_10191464 3300013105 Bacteria 2149
193 Ga0157374_10047672 3300013296 Bacteria 3974
194 Ga0157374_10125111 3300013296 Bacteria 2485
195 Ga0157374_10136688 3300013296 Unclassified 2377
196 Ga0157374_10423591 3300013296 Bacteria 1330
197 Ga0157374_10482674 3300013296 Bacteria 1243
198 Ga0157378_10009905 3300013297 Bacteria 8308
199 Ga0157378_10024818 3300013297 Bacteria 5279
200 Ga0157378_10037259 3300013297 Bacteria 4306
201 Ga0163162_10004389 3300013306 Bacteria 13572
202 Ga0163162_10075592 3300013306 Bacteria 3429
203 Ga0163162_10140403 3300013306 Bacteria 2529
204 Ga0163162_10160749 3300013306 Bacteria 2368
205 Ga0163162_10608583 3300013306 Bacteria 1218
206 Ga0157372_10025595 3300013307 Bacteria 6419
207 Ga0157372_10198244 3300013307 Bacteria 2325
208 Ga0157375_10011400 3300013308 Bacteria 7847
209 Ga0157375_10070183 3300013308 Bacteria 3513
210 Ga0157375_10515628 3300013308 Bacteria 1359
211 Ga0157375_10821630 3300013308 Bacteria 1077
212 Ga0163163_10288116 3300014325 Bacteria 1694
213 Ga0163163_10412084 3300014325 Unclassified 1410
214 Ga0157380_10003158 3300014326 Bacteria 11251
215 Ga0157380_10004013 3300014326 Bacteria 10163
216 Ga0157377_10002055 3300014745 Bacteria 8826
217 Ga0157377_10014770 3300014745 Bacteria 3980
218 Ga0157377_10086706 3300014745 Bacteria 1841
219 Ga0157379_10114811 3300014968 Unclassified 2420
220 Ga0157379_10855506 3300014968 Bacteria 861
221 Ga0157376_10423532 3300014969 Bacteria 1293
222 Ga0157376_10737255 3300014969 Bacteria 993
223 Ga0163161_10078593 3300017792 Bacteria 2425
224 Ga0163161_10579385 3300017792 Unclassified 923
225 Ga0163161_10619256 3300017792 Bacteria 894
226 Ga0213876_10005890 3300021384 Bacteria 6702
227 Ga0213876_10022204 3300021384 Bacteria 3356
228 Ga0209646_1000009 3300025246 Bacteria 652154
229 Ga0209026_1000209 3300025250 Bacteria 81291
230 Ga0209673_1000016 3300025273 Bacteria 506202
231 Ga0209673_1049566 3300025273 Unclassified 1122
232 Ga0209564_1005601 3300025295 Bacteria 7076
233 Ga0209564_1022792 3300025295 Bacteria 2198
234 Ga0209564_1036395 3300025295 Bacteria 1405
235 Ga0209758_1006726 3300025297 Bacteria 8099
236 Ga0209758_1007907 3300025297 Bacteria 7061
237 Ga0209758_1030840 3300025297 Bacteria 2211
238 Ga0209050_1000608 3300025298 Bacteria 56778
239 Ga0207426_1000658 3300025302 Bacteria 42320
240 Ga0207426_1000834 3300025302 Bacteria 32701
241 Ga0207426_1039666 3300025302 Bacteria 1473
242 Ga0209051_1025501 3300025303 Bacteria 2404
243 Ga0209257_1000071 3300025304 Bacteria 335832
244 Ga0209257_1000831 3300025304 Bacteria 44552
245 Ga0207697_10064175 3300025315 Unclassified 1531
246 Ga0207697_10226096 3300025315 Bacteria 826
247 Ga0207682_10226370 3300025893 Unclassified 866
248 Ga0207642_10042205 3300025899 Bacteria 2003
249 Ga0207688_10065865 3300025901 Unclassified 2048
250 Ga0207680_10000388 3300025903 Bacteria 21000
251 Ga0207680_10066259 3300025903 Bacteria 2220
252 Ga0207680_10229614 3300025903 Unclassified 1275
253 Ga0207647_10041306 3300025904 Bacteria 2901
254 Ga0207647_10048630 3300025904 Bacteria 2633
255 Ga0207647_10154446 3300025904 Bacteria 1340
256 Ga0207645_10001118 3300025907 Bacteria 22193
257 Ga0207645_10050151 3300025907 Bacteria 2665
258 Ga0207645_10140222 3300025907 Unclassified 1575
259 Ga0207645_10236836 3300025907 Bacteria 1206
260 Ga0207643_10017131 3300025908 Bacteria 3957
261 Ga0207654_10001481 3300025911 Bacteria 12399
262 Ga0207654_10144828 3300025911 Unclassified 1519
263 Ga0207707_10397642 3300025912 Bacteria 1183
264 Ga0207671_10001848 3300025914 Bacteria 23634
265 Ga0207671_10031686 3300025914 Bacteria 3939
266 Ga0207662_10005415 3300025918 Bacteria 6804
267 Ga0207662_10091806 3300025918 Bacteria 1868
268 Ga0207652_10092172 3300025921 Bacteria 2665
269 Ga0207681_10002654 3300025923 Bacteria 11336
270 Ga0207681_10257745 3300025923 Unclassified 1364
271 Ga0207650_10044610 3300025925 Bacteria 3259
272 Ga0207650_10161326 3300025925 Bacteria 1776
273 Ga0207659_10099600 3300025926 Bacteria 2189
274 Ga0207659_10148949 3300025926 Bacteria 1825
275 Ga0207644_10207232 3300025931 Bacteria 1549
276 Ga0207644_10298433 3300025931 Bacteria 1298
277 Ga0207690_10164236 3300025932 Bacteria 1658
278 Ga0207690_10619704 3300025932 Bacteria 884
279 Ga0207706_10003276 3300025933 Bacteria 15486
280 Ga0207706_10026010 3300025933 Bacteria 5241
281 Ga0207686_10028592 3300025934 Unclassified 3279
282 Ga0207670_10009853 3300025936 Bacteria 5471
283 Ga0207669_10098196 3300025937 Bacteria 1928
284 Ga0207669_10098820 3300025937 Bacteria 1923
285 Ga0207704_10048200 3300025938 Bacteria 2553
286 Ga0207665_10170487 3300025939 Unclassified 1571
287 Ga0207691_10029880 3300025940 Bacteria 5097
288 Ga0207689_10001731 3300025942 Bacteria 20624
289 Ga0207689_10002903 3300025942 Bacteria 15819
290 Ga0207689_10132645 3300025942 Bacteria 2050
291 Ga0207661_10061020 3300025944 Bacteria 3045
292 Ga0207661_10167183 3300025944 Bacteria 1912
293 Ga0207679_10220338 3300025945 Unclassified 1596
294 Ga0207651_10036799 3300025960 Bacteria 3200
295 Ga0207651_10110418 3300025960 Unclassified 2063
296 Ga0207651_10128377 3300025960 Unclassified 1936
297 Ga0207651_10346594 3300025960 Bacteria 1249
298 Ga0207712_10014560 3300025961 Bacteria 5064
299 Ga0207668_10105362 3300025972 Bacteria 2104
300 Ga0207658_10036299 3300025986 Bacteria 3533
301 Ga0207658_10255034 3300025986 Bacteria 1492
302 Ga0207677_10029575 3300026023 Bacteria 3484
303 Ga0207677_10042459 3300026023 Bacteria 3015
304 Ga0207677_10110919 3300026023 Bacteria 2043
305 Ga0207677_10770882 3300026023 Bacteria 859
306 Ga0207703_10006525 3300026035 Bacteria 9307
307 Ga0207639_10130848 3300026041 Bacteria 2077
308 Ga0207639_10158314 3300026041 Bacteria 1905
309 Ga0207678_11082635 3300026067 Bacteria 710
310 Ga0207708_10048621 3300026075 Bacteria 3229
311 Ga0207708_10114288 3300026075 Bacteria 2098
312 Ga0207708_10275637 3300026075 Bacteria 1362
313 Ga0207641_10000026 3300026088 Bacteria 245091
314 Ga0207648_10003325 3300026089 Bacteria 16891
315 Ga0207648_10015205 3300026089 Bacteria 7082
316 Ga0207648_10160407 3300026089 Bacteria 1986
317 Ga0207648_10160732 3300026089 Bacteria 1984
318 Ga0207676_10003977 3300026095 Bacteria 10429
319 Ga0207676_10237502 3300026095 Bacteria 1633
320 Ga0207674_10022101 3300026116 Bacteria 6837
321 Ga0207674_10169057 3300026116 Bacteria 2140
322 Ga0207675_100000144 3300026118 Bacteria 61517
323 Ga0207675_100020719 3300026118 Bacteria 6130
324 Ga0207675_100022457 3300026118 Bacteria 5876
325 Ga0207675_100050055 3300026118 Bacteria 3899
326 Ga0207675_100116280 3300026118 Bacteria 2528
327 Ga0207683_10004506 3300026121 Bacteria 12018
328 Ga0207683_10450839 3300026121 Bacteria 1186
329 Ga0207698_10001999 3300026142 Bacteria 12012
330 Ga0207698_10096879 3300026142 Bacteria 2432
331 Ga0207698_10164294 3300026142 Unclassified 1946
332 Ga0207698_10198156 3300026142 Bacteria 1796
333 Ga0207428_10193369 3300027907 Bacteria 1533
334 Ga0268265_10006981 3300028380 Bacteria 7639
335 Ga0268265_10244669 3300028380 Bacteria 1585
336 Ga0268264_10001142 3300028381 Bacteria 25957
337 Ga0268264_10177634 3300028381 Bacteria 1931
338 Ga0307515_10000031 3300028794 Bacteria 358648
339 Ga0265327_10000288 3300031251 Bacteria 99230
340 Ga0265327_10013816 3300031251 Bacteria 5333
341 Ga0307509_10117107 3300031507 Bacteria 2652
342 Ga0307509_10128572 3300031507 Bacteria 2494
343 Ga0307509_10145898 3300031507 Bacteria 2293
344 Ga0307508_10000990 3300031616 Bacteria 33005
345 Ga0307410_10251265 3300031852 Unclassified 1375
346 Ga0307410_10485911 3300031852 Bacteria 1014
347 Ga0307414_10375797 3300032004 Bacteria 1227
348 Ga0395905_0011690 3300037471 Bacteria 8475
349 Ga0395905_0128061 3300037471 Unclassified 2388
350 Ga0400483_075486 3300039062 Bacteria 32456
351 Ga0400483_218182 3300039062 Bacteria 28649
352 Ga0436365_0021822 3300039437 Bacteria 10004
353 Ga0436365_1684945 3300039437 Bacteria 47686
354 Ga0439439_0005085 3300041406 Bacteria 2991
355 Ga0451795_1010182 3300041456 Unclassified 769
356 Ga0451849_0930889 3300041505 Bacteria 1269
357 Ga0451853_3891532 3300041512 Bacteria 3816
358 Ga0439433_0023797 3300041999 Bacteria 1379
359 Ga0439449_0019777 3300042007 Bacteria 2524
360 Ga0439449_0062122 3300042007 Bacteria 1378
361 Ga0439457_000442 3300042014 Bacteria 11954
362 Ga0466972_0000009 3300044658 Bacteria 256374
363 Ga0453683_0373403 3300044673 Unclassified 917
364 Ga0453684_0103768 3300044712 Bacteria 3473
365 Ga0453684_0732375 3300044712 Bacteria 1072
366 Ga0466957_0043024 3300044842 Bacteria 2733
367 Ga0466957_0103958 3300044842 Bacteria 1794
368 Ga0495650_0033874 3300046471 Bacteria 2267
369 Ga0495668_0004630 3300046616 Bacteria 9663
370 Ga0495625_0110805 3300046660 Bacteria 1876
371 Ga0495670_0305542 3300046691 Unclassified 853
372 Ga0496126_0063750 3300048929 Bacteria 3303
373 Ga0501290_010117 3300049513 Bacteria 1203
374 Ga0501293_003295 3300049516 Bacteria 1245
375 Ga0501296_020192 3300049519 Bacteria 848
376 Ga0501298_001309 3300049521 Bacteria 3645
377 Ga0501031_0005967 3300049568 Bacteria 7947
378 Ga0501031_0455809 3300049568 Bacteria 826
379 Ga0501032_0002685 3300049569 Bacteria 13871
380 Ga0501032_0023207 3300049569 Bacteria 4293
381 Ga0501033_0192463 3300049570 Bacteria 1459
382 Ga0501034_0017359 3300049571 Bacteria 7381
383 Ga0501034_0023796 3300049571 Bacteria 6237
384 Ga0501034_0191790 3300049571 Bacteria 2005
385 Ga0501034_0672501 3300049571 Bacteria 935
386 Ga0501034_0796438 3300049571 Bacteria 838
387 Ga0501034_0914870 3300049571 Unclassified 764
388 Ga0501036_0001672 3300049572 Bacteria 17196
389 Ga0501036_0163644 3300049572 Bacteria 1875
390 Ga0501037_0003447 3300049573 Bacteria 11491
391 Ga0501037_0006925 3300049573 Bacteria 8279
392 Ga0501037_0111920 3300049573 Bacteria 1966
393 Ga0501038_0024880 3300049574 Bacteria 5336
394 Ga0501038_0087090 3300049574 Bacteria 2623
395 Ga0501039_0032809 3300049575 Bacteria 4005
396 Ga0501039_0170243 3300049575 Bacteria 1712
397 Ga0501043_0029665 3300049579 Bacteria 4298
398 Ga0501043_0031114 3300049579 Bacteria 4196
399 Ga0501043_0428298 3300049579 Bacteria 997
400 Ga0501046_0068687 3300049580 Bacteria 2757
401 Ga0501046_0121678 3300049580 Bacteria 1985
402 Ga0501047_0081917 3300049581 Bacteria 3102
403 Ga0501047_0083548 3300049581 Bacteria 3069
404 Ga0501047_0116074 3300049581 Bacteria 2559
405 Ga0501047_0125453 3300049581 Bacteria 2447
406 Ga0501047_0136438 3300049581 Bacteria 2334
407 Ga0501047_0352782 3300049581 Unclassified 1307
408 Ga0501048_0275425 3300049582 Bacteria 1196
409 Ga0501067_0064715 3300049583 Bacteria 2024
410 Ga0501070_0080335 3300049586 Bacteria 2698
411 Ga0501073_0008525 3300049589 Bacteria 7599
412 Ga0501074_0004127 3300049590 Bacteria 10369
413 Ga0501077_0038341 3300049593 Bacteria 3051
414 Ga0501198_002369 3300049649 Bacteria 2535
415 Ga0501202_035887 3300049652 Bacteria 1053
416 Ga0501207_002992 3300049654 Bacteria 2214
417 Ga0501217_000418 3300049661 Bacteria 6898
418 Ga0501224_005074 3300049664 Bacteria 1878
419 Ga0501228_023088 3300049666 Unclassified 717
420 Ga0501235_010541 3300049669 Bacteria 2019
421 Ga0501242_005501 3300049674 Bacteria 1428
422 Ga0501261_002689 3300049690 Bacteria 2184
423 Ga0501219_000135 3300049703 Bacteria 13063
424 Ga0501225_0012133 3300049705 Bacteria 2420
425 Ga0501225_0046986 3300049705 Bacteria 1197
426 Ga0501234_012202 3300049707 Bacteria 1345
427 Ga0501079_0268374 3300049741 Bacteria 1334
428 Ga0501080_0077577 3300049742 Bacteria 3090
429 Ga0501080_0181919 3300049742 Bacteria 1934
430 Ga0501080_0242268 3300049742 Bacteria 1646
431 Ga0501083_0004011 3300049744 Bacteria 10346
432 Ga0501083_0163227 3300049744 Bacteria 1457
433 Ga0501035_0006854 3300049822 Bacteria 10640
434 Ga0501044_0001914 3300049823 Bacteria 24093
435 Ga0501044_0051244 3300049823 Bacteria 4256
436 Ga0501044_0063531 3300049823 Bacteria 3771
437 Ga0501044_0067787 3300049823 Bacteria 3635
438 Ga0501044_0127817 3300049823 Bacteria 2538
439 Ga0501044_0598156 3300049823 Bacteria 996
440 Ga0501044_0639589 3300049823 Bacteria 953
441 Ga0501284_00001 3300050005 Bacteria 261916
442 nmdc:mga0k408_11749_c1 3300050493 Bacteria 4776
443 nmdc:mga0k408_22621_c1 3300050493 Bacteria 3540
444 nmdc:mga0k408_3446_c2 3300050493 Bacteria 6350
445 nmdc:mga05p37_1394_c1 3300050507 Bacteria 28114
446 nmdc:mga09592_281809_c1 3300050508 Bacteria 1441
447 nmdc:mga08y16_18928_c1 3300050511 Bacteria 7251
448 Ga0500578_0000920 3300053086 Bacteria 33032
449 Ga0500578_0210032 3300053086 Bacteria 1188
450 Ga0500583_0000019 3300053092 Bacteria 130534
451 Ga0500562_000012 3300053108 Bacteria 168210
452 Ga0500594_0029824 3300053118 Unclassified 1429
453 Ga0500642_0235116 3300053130 Bacteria 845
454 Ga0500652_029680 3300053131 Unclassified 2134
455 Ga0500568_0047655 3300053139 Unclassified 1697
456 Ga0500588_0006763 3300053146 Unclassified 2616
457 Ga0500603_060827 3300053150 Bacteria 1056
458 Ga0500604_0000475 3300053151 Bacteria 11057
459 Ga0500616_0002857 3300053153 Bacteria 13857
460 Ga0500616_0033389 3300053153 Bacteria 2809
461 Ga0500622_0000404 3300053156 Bacteria 41279
462 Ga0500636_0131328 3300053177 Bacteria 1395
463 Ga0500584_174203 3300053726 Unclassified 764
464 Ga0500645_006175 3300053730 Bacteria 4304
465 Ga0500645_019546 3300053730 Bacteria 2106
466 2738725080 2738541278 Bacteria 9755573
467 2819586166 2818991444 Bacteria 6968812
468 2910250226 2910245624 Bacteria 6935613
469 2911139859 2911138879 Bacteria 5811561
470 2929158917 2929154850 Bacteria 6753285
471 2929924308 2929921140 Bacteria 8649150
472 8003155588 8003151029 Bacteria 8187759
473 8036738018 8036736890 Bacteria 2944828
474 Ga0157372_10115338
475 JGI24740J21852_10004905
476 JGI24740J21852_10033948
477 JGI24739J22299_10124070
478 JGI24744J21845_10022158
479 JGI25154J39366_1000012
480 JGI25406J46586_10002742
481 JGI25153J46596_10027577
482 rootH1_10060194
483 rootH1_10179425
484 rootH1_10190589
485 rootH2_10115022
486 rootH2_10135145
487 rootH2_10168463
488 rootH2_10198254
489 rootH2_10314643
490 rootL2_10014974
491 rootL2_10020852
492 rootL2_10051034
493 rootL2_10086591
494 rootL2_10113318
495 rootL2_10168080
496 rootL2_10201946
497 rootL2_10253065
498 rootH1_10020501
499 rootH1_10044480
500 JGI25160J50197_1003604
501 JGI25160J50197_1021931
502 Ga0055526_1011118
503 Ga0055526_1023425
504 Ga0055528_1000153
505 Ga0055530_10000805
506 Ga0055531_10000284
507 Ga0055531_10020731
508 Ga0065165_1000159
509 Ga0065714_10094168
510 Ga0065704_10181233
511 Ga0065712_10075441
512 Ga0065712_10247499
513 Ga0065707_10110999
514 Ga0070676_10126559
515 Ga0070683_100009092
516 Ga0070683_100045346
517 Ga0070683_100188632
518 Ga0070683_100565705
519 Ga0070690_100149390
520 Ga0070690_100185000
521 Ga0070670_100024005
522 Ga0070670_100047379
523 Ga0070670_100171677
524 Ga0070677_10055701
525 Ga0068869_100005758
526 Ga0068869_100013589
527 Ga0068869_100048044
528 Ga0068869_100108289
529 Ga0068869_100377233
530 Ga0070666_10000064
531 Ga0070666_10035817
532 Ga0070666_10422133
533 Ga0070680_100052387
534 Ga0070682_100037602
535 Ga0068868_100038803
536 Ga0068868_100249040
537 Ga0068868_100666110
538 Ga0070689_100084778
539 Ga0070687_100084964
540 Ga0070687_100275836
541 Ga0070661_100010672
542 Ga0070661_100191444
543 Ga0070668_100037275
544 Ga0070668_100100088
545 Ga0070669_100011558
546 Ga0070669_100291224
547 Ga0070675_100002115
548 Ga0070675_100037225
549 Ga0070675_100046216
550 Ga0070675_100252942
551 Ga0070675_100602361
552 Ga0070671_100014145
553 Ga0070671_100094207
554 Ga0070674_100016973
555 Ga0070674_100031799
556 Ga0070674_100073072
557 Ga0070673_100001051
558 Ga0070673_100001247
559 Ga0070673_100082188
560 Ga0070673_100860164
561 Ga0070659_100032283
562 Ga0070659_100188757
563 Ga0070667_100010938
564 Ga0070667_100060084
565 Ga0070667_100273153
566 Ga0070667_100441170
567 Ga0070713_100372052
568 Ga0070701_10004865
569 Ga0070700_100043955
570 Ga0070700_100076697
571 Ga0070700_100253065
572 Ga0070678_100075808
573 Ga0070678_100382264
574 Ga0070662_100083564
575 Ga0070681_10308842
576 Ga0068867_100039399
577 Ga0068867_100193392
578 Ga0068867_100315401
579 Ga0070685_10032591
580 Ga0070685_10559713
581 Ga0070679_100166221
582 Ga0070684_100004375
583 Ga0070684_100041221
584 Ga0068853_100115586
585 Ga0068853_100671786
586 Ga0070686_100083930
587 Ga0070665_100182033
588 Ga0068855_100081596
589 Ga0070664_100002301
590 Ga0070664_100449055
591 Ga0068854_100092580
592 Ga0068854_100214856
593 Ga0068856_100089448
594 Ga0068852_100004036
595 Ga0068852_100075299
596 Ga0068852_100109367
597 Ga0068852_100195423
598 Ga0068852_100673015
599 Ga0068859_100000003
600 Ga0068859_100004846
601 Ga0068859_100090517
602 Ga0068864_100006628
603 Ga0068864_100065234
604 Ga0068864_100295274
605 Ga0068864_100438104
606 Ga0068864_100936538
607 Ga0068866_10022853
608 Ga0068866_10211648
609 Ga0068861_100005751
610 Ga0068861_100111406
611 Ga0068861_100239746
612 Ga0068861_100750230
613 Ga0068851_10069805
614 Ga0068870_10009295
615 Ga0068863_100003550
616 Ga0068858_100002928
617 Ga0068858_100710683
618 Ga0068860_100004200
619 Ga0068860_100415839
620 Ga0068860_100699801
621 Ga0068862_100016622
622 Ga0068862_100137800
623 Ga0081539_10000534
624 Ga0070716_100365301
625 Ga0075366_10004372
626 Ga0075366_10205199
627 Ga0075366_10319450
628 Ga0097621_100050152
629 Ga0097621_100053270
630 Ga0097621_100768281
631 Ga0068871_100034178
632 Ga0068871_100235221
633 Ga0068871_100291446
634 Ga0075429_100181744
635 Ga0068865_100007946
636 Ga0068865_100026788
637 Ga0097620_100000003
638 Ga0097620_100004846
639 Ga0097620_100090518
640 Ga0111539_10002241
641 Ga0105245_10052557
642 Ga0105245_11136244
643 Ga0114129_10001630
644 Ga0105241_10002666
645 Ga0105241_10165420
646 Ga0105241_10528225
647 Ga0105241_10570020
648 Ga0105242_10059536
649 Ga0105242_10223040
650 Ga0105237_10001055
651 Ga0105249_10022049
652 Ga0105249_10028477
653 Ga0105239_10010713
654 Ga0105239_10021156
655 Ga0105239_10437487
656 Ga0105246_10008490
657 Ga0105246_10014719
658 Ga0105246_10031070
659 Ga0157373_10003011
660 Ga0157371_10020010
661 Ga0157371_10233830
662 Ga0157370_10027313
663 Ga0157370_10177001
664 Ga0157369_10027453
665 Ga0157369_10191464
666 Ga0157374_10047672
667 Ga0157374_10125111
668 Ga0157374_10136688
669 Ga0157374_10423591
670 Ga0157374_10482674
671 Ga0157378_10009905
672 Ga0157378_10024818
673 Ga0157378_10037259
674 Ga0163162_10004389
675 Ga0163162_10075592
676 Ga0163162_10140403
677 Ga0163162_10160749
678 Ga0163162_10608583
679 Ga0157372_10025595
680 Ga0157372_10198244
681 Ga0157375_10011400
682 Ga0157375_10070183
683 Ga0157375_10515628
684 Ga0157375_10821630
685 Ga0163163_10288116
686 Ga0163163_10412084
687 Ga0157380_10003158
688 Ga0157380_10004013
689 Ga0157377_10002055
690 Ga0157377_10014770
691 Ga0157377_10086706
692 Ga0157379_10114811
693 Ga0157379_10855506
694 Ga0157376_10423532
695 Ga0157376_10737255
696 Ga0163161_10078593
697 Ga0163161_10579385
698 Ga0163161_10619256
699 Ga0213876_10005890
700 Ga0213876_10022204
701 Ga0209646_1000009
702 Ga0209026_1000209
703 Ga0209673_1000016
704 Ga0209673_1049566
705 Ga0209564_1005601
706 Ga0209564_1022792
707 Ga0209564_1036395
708 Ga0209758_1006726
709 Ga0209758_1007907
710 Ga0209758_1030840
711 Ga0209050_1000608
712 Ga0207426_1000658
713 Ga0207426_1000834
714 Ga0207426_1039666
715 Ga0209051_1025501
716 Ga0209257_1000071
717 Ga0209257_1000831
718 Ga0207697_10064175
719 Ga0207697_10226096
720 Ga0207682_10226370
721 Ga0207642_10042205
722 Ga0207688_10065865
723 Ga0207680_10000388
724 Ga0207680_10066259
725 Ga0207680_10229614
726 Ga0207647_10041306
727 Ga0207647_10048630
728 Ga0207647_10154446
729 Ga0207645_10001118
730 Ga0207645_10050151
731 Ga0207645_10140222
732 Ga0207645_10236836
733 Ga0207643_10017131
734 Ga0207654_10001481
735 Ga0207654_10144828
736 Ga0207707_10397642
737 Ga0207671_10001848
738 Ga0207671_10031686
739 Ga0207662_10005415
740 Ga0207662_10091806
741 Ga0207652_10092172
742 Ga0207681_10002654
743 Ga0207681_10257745
744 Ga0207650_10044610
745 Ga0207650_10161326
746 Ga0207659_10099600
747 Ga0207659_10148949
748 Ga0207644_10207232
749 Ga0207644_10298433
750 Ga0207690_10164236
751 Ga0207690_10619704
752 Ga0207706_10003276
753 Ga0207706_10026010
754 Ga0207686_10028592
755 Ga0207670_10009853
756 Ga0207669_10098196
757 Ga0207669_10098820
758 Ga0207704_10048200
759 Ga0207665_10170487
760 Ga0207691_10029880
761 Ga0207689_10001731
762 Ga0207689_10002903
763 Ga0207689_10132645
764 Ga0207661_10061020
765 Ga0207661_10167183
766 Ga0207679_10220338
767 Ga0207651_10036799
768 Ga0207651_10110418
769 Ga0207651_10128377
770 Ga0207651_10346594
771 Ga0207712_10014560
772 Ga0207668_10105362
773 Ga0207658_10036299
774 Ga0207658_10255034
775 Ga0207677_10029575
776 Ga0207677_10042459
777 Ga0207677_10110919
778 Ga0207677_10770882
779 Ga0207703_10006525
780 Ga0207639_10130848
781 Ga0207639_10158314
782 Ga0207678_11082635
783 Ga0207708_10048621
784 Ga0207708_10114288
785 Ga0207708_10275637
786 Ga0207641_10000026
787 Ga0207648_10003325
788 Ga0207648_10015205
789 Ga0207648_10160407
790 Ga0207648_10160732
791 Ga0207676_10003977
792 Ga0207676_10237502
793 Ga0207674_10022101
794 Ga0207674_10169057
795 Ga0207675_100000144
796 Ga0207675_100020719
797 Ga0207675_100022457
798 Ga0207675_100050055
799 Ga0207675_100116280
800 Ga0207683_10004506
801 Ga0207683_10450839
802 Ga0207698_10001999
803 Ga0207698_10096879
804 Ga0207698_10164294
805 Ga0207698_10198156
806 Ga0207428_10193369
807 Ga0268265_10006981
808 Ga0268265_10244669
809 Ga0268264_10001142
810 Ga0268264_10177634
811 Ga0307515_10000031
812 Ga0265327_10000288
813 Ga0265327_10013816
814 Ga0307509_10117107
815 Ga0307509_10128572
816 Ga0307509_10145898
817 Ga0307508_10000990
818 Ga0307410_10251265
819 Ga0307410_10485911
820 Ga0307414_10375797
821 Ga0395905_0011690
822 Ga0395905_0128061
823 Ga0400483_075486
824 Ga0400483_218182
825 Ga0436365_0021822
826 Ga0436365_1684945
827 Ga0439439_0005085
828 Ga0451795_1010182
829 Ga0451849_0930889
830 Ga0451853_3891532
831 Ga0439433_0023797
832 Ga0439449_0019777
833 Ga0439449_0062122
834 Ga0439457_000442
835 Ga0466972_0000009
836 Ga0453683_0373403
837 Ga0453684_0103768
838 Ga0453684_0732375
839 Ga0466957_0043024
840 Ga0466957_0103958
841 Ga0495650_0033874
842 Ga0495668_0004630
843 Ga0495625_0110805
844 Ga0495670_0305542
845 Ga0496126_0063750
846 Ga0501290_010117
847 Ga0501293_003295
848 Ga0501296_020192
849 Ga0501298_001309
850 Ga0501031_0005967
851 Ga0501031_0455809
852 Ga0501032_0002685
853 Ga0501032_0023207
854 Ga0501033_0192463
855 Ga0501034_0017359
856 Ga0501034_0023796
857 Ga0501034_0191790
858 Ga0501034_0672501
859 Ga0501034_0796438
860 Ga0501034_0914870
861 Ga0501036_0001672
862 Ga0501036_0163644
863 Ga0501037_0003447
864 Ga0501037_0006925
865 Ga0501037_0111920
866 Ga0501038_0024880
867 Ga0501038_0087090
868 Ga0501039_0032809
869 Ga0501039_0170243
870 Ga0501043_0029665
871 Ga0501043_0031114
872 Ga0501043_0428298
873 Ga0501046_0068687
874 Ga0501046_0121678
875 Ga0501047_0081917
876 Ga0501047_0083548
877 Ga0501047_0116074
878 Ga0501047_0125453
879 Ga0501047_0136438
880 Ga0501047_0352782
881 Ga0501048_0275425
882 Ga0501067_0064715
883 Ga0501070_0080335
884 Ga0501073_0008525
885 Ga0501074_0004127
886 Ga0501077_0038341
887 Ga0501198_002369
888 Ga0501202_035887
889 Ga0501207_002992
890 Ga0501217_000418
891 Ga0501224_005074
892 Ga0501228_023088
893 Ga0501235_010541
894 Ga0501242_005501
895 Ga0501261_002689
896 Ga0501219_000135
897 Ga0501225_0012133
898 Ga0501225_0046986
899 Ga0501234_012202
900 Ga0501079_0268374
901 Ga0501080_0077577
902 Ga0501080_0181919
903 Ga0501080_0242268
904 Ga0501083_0004011
905 Ga0501083_0163227
906 Ga0501035_0006854
907 Ga0501044_0001914
908 Ga0501044_0051244
909 Ga0501044_0063531
910 Ga0501044_0067787
911 Ga0501044_0127817
912 Ga0501044_0598156
913 Ga0501044_0639589
914 Ga0501284_00001
915 nmdc:mga0k408_11749_c1
916 nmdc:mga0k408_22621_c1
917 nmdc:mga0k408_3446_c2
918 nmdc:mga05p37_1394_c1
919 nmdc:mga09592_281809_c1
920 nmdc:mga08y16_18928_c1
921 Ga0500578_0000920
922 Ga0500578_0210032
923 Ga0500583_0000019
924 Ga0500562_000012
925 Ga0500594_0029824
926 Ga0500642_0235116
927 Ga0500652_029680
928 Ga0500568_0047655
929 Ga0500588_0006763
930 Ga0500603_060827
931 Ga0500604_0000475
932 Ga0500616_0002857
933 Ga0500616_0033389
934 Ga0500622_0000404
935 Ga0500636_0131328
936 Ga0500584_174203
937 Ga0500645_006175
938 Ga0500645_019546
939 2738725080
940 2819586166
941 2910250226
942 2911139859
943 2929158917
944 2929924308
945 8003155588
946 8036738018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05430

Methyltransf_30

S-adenosyl-L-methionine-dependent methyltransferase

144

260

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sgl-assembly1.cif.gz_A the crystal structure of mnmc from yersinia pestis bound with fad and sam 0.8503 31 221
2qy6-assembly1.cif.gz_A crystal structure of the n-terminal domain of upf0209 protein yfck from escherichia coli o157:h7 0.8308 3 223
2qy6-assembly1.cif.gz_A crystal structure of the n-terminal domain of upf0209 protein yfck from escherichia coli o157:h7 0.8208 3 223
3awi-assembly2.cif.gz_B bifunctional trna modification enzyme mnmc from escherichia coli 0.8196 32 221
3ps9-assembly1.cif.gz_A crystal structure of mnmc from e. coli 0.8116 14 221
ID Description Score Start End Superfamily
3sglA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8289 31 223 3.40.50.150
2qy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8288 4 223 3.40.50.150
2qy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8154 4 223 3.40.50.150
af_A0A1D6K4H3_75_167_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7566 145 222 3.40.50.150
3sglA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7479 31 223 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2E4VEP4-F1-model_v4 MnmC-like methyltransferase domain-containing protein 0.9747 146 222 GO:0016645
AF-A0A4Q3RK67-F1-model_v4 SAM-dependent methyltransferase 0.9709 52 222 GO:0004808
GO:0016645
GO:0032259
AF-A0A444WG57-F1-model_v4 deleted 0.9698 20 222
AF-A0A3C2C7P6-F1-model_v4 deleted 0.9632 113 223
AF-A0A3M1UPC8-F1-model_v4 SAM-dependent methyltransferase 0.9623 146 223 GO:0008168
GO:0016645
GO:0032259

Map