F451005

General Info

Members Datasets Scaffolds Average Seq Length
473 227 946 239

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10055716|Ga0157375_100557164
Length 289
Sequence VKALIARFIFINWKNKSSIISVAIDDRFLDISCRSELLTTIFVRIVIIKTAIMNDLSNKVAYITGGSKGIGYGIAKTLYGLGMKVAITSRTLEAAQKAAASISKDQTRVMALASEVSSLADETKAVKDVINHFGKLDVLIANAGVGILLPFEKLSEQQWKQTIDTNLTGVFNSVKASLDELKKTKGYIITIASLAGTNFFENGTAYNASKFGLVGFTQALMLDLRKYGIKVTTIMPGSVATNFNDHIVSDADAWKIQPEDIGQIVSDLLNMHPRTLPSKVEVRPSIPVK

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
217 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
218 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
221 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
226 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
227 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 0.63
Rhizosphere 94.08
Stem 0
Stem Tuber 0
Unclassified 21.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10055716 3300013308 Unclassified 3899
2 ARcpr5yngRDRAFT_c002403 3300000043 Unclassified 1948
3 JGI25406J46586_10033203 3300003203 Bacteria 1909
4 rootH2_10329710 3300003320 Bacteria 1488
5 rootL2_10297889 3300003322 Bacteria 3296
6 rootH1_10047967 3300003323 Bacteria 2582
7 rootH1_10075774 3300003323 Bacteria 8881
8 Ga0055536_1015298 3300003781 Bacteria 2636
9 Ga0065165_1000060 3300005262 Bacteria 180226
10 Ga0065714_10067686 3300005288 Bacteria 5284
11 Ga0065712_10024347 3300005290 Bacteria 1857
12 Ga0070658_10036250 3300005327 Bacteria 3975
13 Ga0070658_10132417 3300005327 Bacteria 2078
14 Ga0070658_10301405 3300005327 Bacteria 1366
15 Ga0070658_10473501 3300005327 Unclassified 1080
16 Ga0070676_10002798 3300005328 Bacteria 9015
17 Ga0070676_10006786 3300005328 Bacteria 6134
18 Ga0070676_10310330 3300005328 Unclassified 1072
19 Ga0070683_100000286 3300005329 Bacteria 34774
20 Ga0070683_100014039 3300005329 Bacteria 6995
21 Ga0070690_100063093 3300005330 Bacteria 2390
22 Ga0070690_100113482 3300005330 Bacteria 1811
23 Ga0070670_100030774 3300005331 Bacteria 4622
24 Ga0070670_100319968 3300005331 Unclassified 1359
25 Ga0068869_100006670 3300005334 Bacteria 7333
26 Ga0068869_100014722 3300005334 Bacteria 5231
27 Ga0068869_100036980 3300005334 Unclassified 3469
28 Ga0068869_100117579 3300005334 Unclassified 2029
29 Ga0070666_10274183 3300005335 Bacteria 1198
30 Ga0070666_10460052 3300005335 Unclassified 919
31 Ga0070680_100057633 3300005336 Bacteria 3176
32 Ga0070680_100257342 3300005336 Bacteria 1476
33 Ga0070682_100000644 3300005337 Bacteria 21214
34 Ga0070682_100113825 3300005337 Bacteria 1807
35 Ga0070682_100137277 3300005337 Bacteria 1663
36 Ga0070682_100225292 3300005337 Bacteria 1337
37 Ga0070682_100537826 3300005337 Bacteria 912
38 Ga0068868_100002313 3300005338 Bacteria 13182
39 Ga0068868_100038979 3300005338 Bacteria 3689
40 Ga0068868_100059256 3300005338 Unclassified 3028
41 Ga0070660_100058205 3300005339 Unclassified 2995
42 Ga0070660_100106917 3300005339 Bacteria 2223
43 Ga0070689_100013924 3300005340 Bacteria 5834
44 Ga0070687_100201526 3300005343 Unclassified 1206
45 Ga0070661_100000587 3300005344 Bacteria 27509
46 Ga0070661_100034893 3300005344 Bacteria 3650
47 Ga0070661_100043667 3300005344 Bacteria 3274
48 Ga0070668_100045693 3300005347 Unclassified 3360
49 Ga0070668_100555604 3300005347 Bacteria 1000
50 Ga0070669_100023004 3300005353 Bacteria 4460
51 Ga0070669_100039614 3300005353 Unclassified 3424
52 Ga0070669_100652139 3300005353 Bacteria 886
53 Ga0070675_100092867 3300005354 Unclassified 2530
54 Ga0070675_100111389 3300005354 Bacteria 2316
55 Ga0070675_100150964 3300005354 Bacteria 1992
56 Ga0070671_100040685 3300005355 Bacteria 3862
57 Ga0070671_100143687 3300005355 Unclassified 2014
58 Ga0070674_100021442 3300005356 Unclassified 4148
59 Ga0070674_100246512 3300005356 Unclassified 1401
60 Ga0070674_100574836 3300005356 Bacteria 949
61 Ga0070673_100042608 3300005364 Bacteria 3501
62 Ga0070688_100041146 3300005365 Bacteria 2835
63 Ga0070688_100067167 3300005365 Bacteria 2283
64 Ga0070688_100090378 3300005365 Unclassified 2000
65 Ga0070659_100022281 3300005366 Bacteria 4835
66 Ga0070659_100028784 3300005366 Bacteria 4292
67 Ga0070667_100039572 3300005367 Unclassified 3952
68 Ga0070667_100159046 3300005367 Bacteria 1988
69 Ga0070667_100721070 3300005367 Bacteria 923
70 Ga0070700_100464749 3300005441 Unclassified 966
71 Ga0070663_100267935 3300005455 Unclassified 1357
72 Ga0070678_100007382 3300005456 Bacteria 6516
73 Ga0070662_100014760 3300005457 Bacteria 5221
74 Ga0070662_100017389 3300005457 Bacteria 4848
75 Ga0070662_100245690 3300005457 Bacteria 1437
76 Ga0070681_10064208 3300005458 Bacteria 3643
77 Ga0070681_10108566 3300005458 Bacteria 2715
78 Ga0068867_100111311 3300005459 Bacteria 2104
79 Ga0070685_10013600 3300005466 Bacteria 4297
80 Ga0070685_10111004 3300005466 Bacteria 1689
81 Ga0070685_10169274 3300005466 Unclassified 1399
82 Ga0070685_10496758 3300005466 Unclassified 863
83 Ga0070698_100003810 3300005471 Bacteria 16568
84 Ga0070679_100000398 3300005530 Bacteria 37016
85 Ga0070679_100504754 3300005530 Bacteria 1153
86 Ga0070684_100000500 3300005535 Bacteria 26969
87 Ga0070684_100003115 3300005535 Bacteria 12384
88 Ga0070684_100181264 3300005535 Unclassified 1915
89 Ga0070684_100340387 3300005535 Bacteria 1379
90 Ga0068853_100031964 3300005539 Bacteria 4455
91 Ga0068853_100053665 3300005539 Unclassified 3471
92 Ga0068853_100179758 3300005539 Bacteria 1918
93 Ga0068853_100183386 3300005539 Unclassified 1899
94 Ga0068853_100214363 3300005539 Bacteria 1756
95 Ga0068853_100268715 3300005539 Bacteria 1570
96 Ga0070672_100045657 3300005543 Unclassified 3390
97 Ga0070672_100752277 3300005543 Bacteria 855
98 Ga0070686_100110139 3300005544 Unclassified 1875
99 Ga0070686_100795608 3300005544 Bacteria 762
100 Ga0070665_100017699 3300005548 Bacteria 7155
101 Ga0070665_100026771 3300005548 Bacteria 5809
102 Ga0070665_100428635 3300005548 Unclassified 1331
103 Ga0068855_100014666 3300005563 Bacteria 9440
104 Ga0068855_100083213 3300005563 Bacteria 3707
105 Ga0068855_100102885 3300005563 Unclassified 3287
106 Ga0068855_100176937 3300005563 Bacteria 2414
107 Ga0070664_100000321 3300005564 Bacteria 34876
108 Ga0070664_100010635 3300005564 Bacteria 7456
109 Ga0070664_100124207 3300005564 Bacteria 2262
110 Ga0070664_100127021 3300005564 Bacteria 2238
111 Ga0070664_100408063 3300005564 Bacteria 1243
112 Ga0068857_100015618 3300005577 Bacteria 6636
113 Ga0068857_100078615 3300005577 Unclassified 2944
114 Ga0068857_100090444 3300005577 Unclassified 2739
115 Ga0068857_100145739 3300005577 Bacteria 2142
116 Ga0068857_100222813 3300005577 Unclassified 1723
117 Ga0068857_100565452 3300005577 Bacteria 1072
118 Ga0068857_100736658 3300005577 Bacteria 938
119 Ga0068854_100018808 3300005578 Bacteria 4644
120 Ga0068856_100036724 3300005614 Bacteria 4804
121 Ga0068856_100070221 3300005614 Bacteria 3464
122 Ga0068856_100308530 3300005614 Bacteria 1600
123 Ga0068852_100236074 3300005616 Bacteria 1745
124 Ga0068852_100317746 3300005616 Bacteria 1511
125 Ga0068859_100076258 3300005617 Bacteria 3393
126 Ga0068859_100136431 3300005617 Bacteria 2526
127 Ga0068859_100208465 3300005617 Unclassified 2040
128 Ga0068859_100248041 3300005617 Bacteria 1870
129 Ga0068864_100020503 3300005618 Bacteria 5531
130 Ga0068864_100024337 3300005618 Bacteria 5093
131 Ga0068864_100070261 3300005618 Bacteria 3046
132 Ga0068864_100120771 3300005618 Unclassified 2343
133 Ga0068866_10183531 3300005718 Unclassified 1237
134 Ga0068866_10193190 3300005718 Unclassified 1211
135 Ga0068861_100200941 3300005719 Bacteria 1673
136 Ga0068851_10000088 3300005834 Bacteria 50968
137 Ga0068851_10154219 3300005834 Unclassified 1258
138 Ga0068870_10063684 3300005840 Unclassified 1989
139 Ga0068863_100039004 3300005841 Bacteria 4520
140 Ga0068858_100025905 3300005842 Bacteria 5454
141 Ga0068858_100074331 3300005842 Unclassified 3155
142 Ga0068860_100050035 3300005843 Unclassified 3979
143 Ga0068860_100059558 3300005843 Bacteria 3629
144 Ga0068860_100060978 3300005843 Bacteria 3584
145 Ga0068860_100116106 3300005843 Unclassified 2560
146 Ga0081539_10000622 3300005985 Bacteria 71778
147 Ga0070715_10130049 3300006163 Unclassified 1211
148 Ga0097621_100006601 3300006237 Bacteria 8240
149 Ga0097621_100028195 3300006237 Bacteria 4425
150 Ga0097621_100048927 3300006237 Bacteria 3432
151 Ga0097621_100209259 3300006237 Unclassified 1696
152 Ga0068871_100024090 3300006358 Unclassified 4717
153 Ga0068871_100104526 3300006358 Bacteria 2376
154 Ga0075428_100289149 3300006844 Bacteria 1763
155 Ga0068865_100419813 3300006881 Unclassified 1099
156 Ga0097620_100076257 3300006931 Bacteria 3393
157 Ga0097620_100136431 3300006931 Bacteria 2526
158 Ga0097620_100208483 3300006931 Unclassified 2040
159 Ga0097620_100248041 3300006931 Bacteria 1870
160 Ga0105251_10030563 3300009011 Bacteria 2703
161 Ga0105244_10000049 3300009036 Bacteria 140190
162 Ga0105240_10455815 3300009093 Bacteria 1430
163 Ga0111539_10005020 3300009094 Bacteria 17207
164 Ga0111539_10049682 3300009094 Bacteria 5000
165 Ga0111539_10188926 3300009094 Unclassified 2404
166 Ga0111539_10445126 3300009094 Bacteria 1508
167 Ga0105247_10150548 3300009101 Bacteria 1533
168 Ga0105243_10002732 3300009148 Bacteria 14670
169 Ga0105241_10076052 3300009174 Bacteria 2617
170 Ga0105242_10008966 3300009176 Bacteria 7680
171 Ga0105242_10009503 3300009176 Bacteria 7452
172 Ga0105242_10420880 3300009176 Unclassified 1252
173 Ga0105237_10063140 3300009545 Bacteria 3702
174 Ga0105249_10260063 3300009553 Bacteria 1724
175 Ga0105249_10644888 3300009553 Unclassified 1116
176 Ga0105239_10457989 3300010375 Bacteria 1448
177 Ga0105246_10033558 3300011119 Unclassified 3413
178 Ga0105246_10045396 3300011119 Unclassified 2992
179 Ga0157373_10000107 3300013100 Bacteria 65161
180 Ga0157373_10022656 3300013100 Bacteria 4556
181 Ga0157373_10028380 3300013100 Bacteria 4036
182 Ga0157373_10032015 3300013100 Bacteria 3786
183 Ga0157371_10000201 3300013102 Bacteria 87780
184 Ga0157371_10002256 3300013102 Bacteria 18605
185 Ga0157371_10014672 3300013102 Bacteria 5899
186 Ga0157371_10015852 3300013102 Bacteria 5638
187 Ga0157371_10056614 3300013102 Bacteria 2781
188 Ga0157371_10086636 3300013102 Bacteria 2218
189 Ga0157371_10100497 3300013102 Bacteria 2051
190 Ga0157371_10141923 3300013102 Bacteria 1711
191 Ga0157371_10164072 3300013102 Bacteria 1587
192 Ga0157371_10310926 3300013102 Bacteria 1142
193 Ga0157371_10345934 3300013102 Bacteria 1082
194 Ga0157370_10005377 3300013104 Bacteria 14378
195 Ga0157370_10039262 3300013104 Bacteria 4575
196 Ga0157370_10054744 3300013104 Bacteria 3803
197 Ga0157370_10091443 3300013104 Bacteria 2857
198 Ga0157370_10098320 3300013104 Bacteria 2745
199 Ga0157370_10102355 3300013104 Bacteria 2682
200 Ga0157370_10417300 3300013104 Unclassified 1235
201 Ga0157370_10783025 3300013104 Bacteria 868
202 Ga0157370_10783383 3300013104 Bacteria 868
203 Ga0157369_10000759 3300013105 Bacteria 41636
204 Ga0157369_10170442 3300013105 Bacteria 2294
205 Ga0157369_10559401 3300013105 Bacteria 1182
206 Ga0157374_10013695 3300013296 Bacteria 7085
207 Ga0157374_10082034 3300013296 Bacteria 3061
208 Ga0157374_10108122 3300013296 Bacteria 2673
209 Ga0157374_10129786 3300013296 Bacteria 2439
210 Ga0157374_10197911 3300013296 Unclassified 1967
211 Ga0157374_10418739 3300013296 Unclassified 1338
212 Ga0157378_10018615 3300013297 Bacteria 6105
213 Ga0157378_10023594 3300013297 Bacteria 5411
214 Ga0157378_10162319 3300013297 Unclassified 2090
215 Ga0157378_10411181 3300013297 Bacteria 1335
216 Ga0163162_10008971 3300013306 Bacteria 9724
217 Ga0163162_10026684 3300013306 Bacteria 5710
218 Ga0163162_10028810 3300013306 Bacteria 5496
219 Ga0163162_10064981 3300013306 Bacteria 3694
220 Ga0163162_10105256 3300013306 Bacteria 2916
221 Ga0163162_10143662 3300013306 Bacteria 2501
222 Ga0163162_10260554 3300013306 Bacteria 1866
223 Ga0157372_10015208 3300013307 Bacteria 8242
224 Ga0157372_10018030 3300013307 Bacteria 7588
225 Ga0157372_10033289 3300013307 Bacteria 5659
226 Ga0157372_10097841 3300013307 Bacteria 3347
227 Ga0157372_10198994 3300013307 Bacteria 2321
228 Ga0157372_10212366 3300013307 Unclassified 2242
229 Ga0157372_10484269 3300013307 Bacteria 1442
230 Ga0157372_10762996 3300013307 Bacteria 1124
231 Ga0157372_10965976 3300013307 Bacteria 987
232 Ga0157375_10006054 3300013308 Bacteria 10548
233 Ga0157375_10062909 3300013308 Bacteria 3689
234 Ga0157375_10116172 3300013308 Unclassified 2780
235 Ga0157375_10233311 3300013308 Unclassified 1999
236 Ga0163163_10004447 3300014325 Bacteria 11954
237 Ga0163163_10037722 3300014325 Bacteria 4703
238 Ga0163163_10041887 3300014325 Bacteria 4481
239 Ga0163163_10537646 3300014325 Unclassified 1231
240 Ga0157380_10000259 3300014326 Bacteria 31654
241 Ga0157380_10082828 3300014326 Bacteria 2627
242 Ga0182008_10000011 3300014497 Bacteria 297770
243 Ga0157377_10046140 3300014745 Bacteria 2435
244 Ga0157379_10078905 3300014968 Bacteria 2949
245 Ga0157379_10303737 3300014968 Unclassified 1455
246 Ga0157376_10002842 3300014969 Bacteria 11849
247 Ga0157376_10046815 3300014969 Bacteria 3569
248 Ga0157376_10110251 3300014969 Bacteria 2421
249 Ga0157376_10193350 3300014969 Bacteria 1867
250 Ga0157376_10305192 3300014969 Bacteria 1508
251 Ga0157376_10423397 3300014969 Bacteria 1293
252 Ga0182006_1000012 3300015261 Bacteria 394239
253 Ga0163161_10006037 3300017792 Bacteria 8395
254 Ga0163161_10007386 3300017792 Bacteria 7589
255 Ga0163161_10174194 3300017792 Bacteria 1646
256 Ga0163161_10318457 3300017792 Unclassified 1229
257 Ga0163161_10462905 3300017792 Bacteria 1027
258 Ga0163161_10487821 3300017792 Bacteria 1001
259 Ga0209675_1000035 3300025291 Bacteria 255411
260 Ga0209676_1000342 3300025292 Bacteria 88613
261 Ga0207656_10000038 3300025321 Bacteria 59027
262 Ga0207655_1000254 3300025728 Bacteria 85278
263 Ga0207642_10200318 3300025899 Unclassified 1102
264 Ga0207710_10148611 3300025900 Bacteria 1135
265 Ga0207688_10035805 3300025901 Unclassified 2750
266 Ga0207680_10043638 3300025903 Unclassified 2631
267 Ga0207647_10204086 3300025904 Bacteria 1143
268 Ga0207645_10000193 3300025907 Bacteria 49552
269 Ga0207645_10003952 3300025907 Bacteria 11063
270 Ga0207645_10289849 3300025907 Bacteria 1088
271 Ga0207643_10002695 3300025908 Bacteria 9596
272 Ga0207705_10072926 3300025909 Bacteria 2490
273 Ga0207705_10162673 3300025909 Bacteria 1677
274 Ga0207705_10289923 3300025909 Bacteria 1254
275 Ga0207705_10297048 3300025909 Unclassified 1238
276 Ga0207705_10388159 3300025909 Bacteria 1079
277 Ga0207707_10085890 3300025912 Bacteria 2749
278 Ga0207707_10418457 3300025912 Unclassified 1149
279 Ga0207695_10322716 3300025913 Bacteria 1434
280 Ga0207671_10158991 3300025914 Unclassified 1749
281 Ga0207660_10224330 3300025917 Bacteria 1476
282 Ga0207662_10128767 3300025918 Unclassified 1594
283 Ga0207657_10025764 3300025919 Bacteria 5417
284 Ga0207657_10092907 3300025919 Bacteria 2514
285 Ga0207657_10224191 3300025919 Bacteria 1505
286 Ga0207649_10001129 3300025920 Bacteria 16163
287 Ga0207649_10014263 3300025920 Unclassified 4447
288 Ga0207649_10157984 3300025920 Unclassified 1568
289 Ga0207652_10107196 3300025921 Bacteria 2474
290 Ga0207652_10251878 3300025921 Unclassified 1592
291 Ga0207681_10542384 3300025923 Bacteria 956
292 Ga0207650_10040009 3300025925 Unclassified 3428
293 Ga0207650_10263584 3300025925 Unclassified 1398
294 Ga0207650_10384290 3300025925 Bacteria 1160
295 Ga0207659_10008019 3300025926 Bacteria 6533
296 Ga0207659_10348285 3300025926 Bacteria 1228
297 Ga0207644_10251282 3300025931 Unclassified 1411
298 Ga0207690_10273405 3300025932 Bacteria 1313
299 Ga0207706_10001127 3300025933 Bacteria 27189
300 Ga0207706_10026213 3300025933 Bacteria 5217
301 Ga0207706_10048082 3300025933 Bacteria 3773
302 Ga0207706_10159849 3300025933 Bacteria 1981
303 Ga0207686_10000175 3300025934 Bacteria 49208
304 Ga0207670_10065213 3300025936 Bacteria 2499
305 Ga0207670_10141076 3300025936 Bacteria 1777
306 Ga0207669_10280844 3300025937 Unclassified 1256
307 Ga0207704_10024641 3300025938 Unclassified 3267
308 Ga0207691_10016995 3300025940 Bacteria 6904
309 Ga0207691_10189934 3300025940 Unclassified 1792
310 Ga0207691_10680756 3300025940 Bacteria 868
311 Ga0207689_10000359 3300025942 Bacteria 42877
312 Ga0207689_10006249 3300025942 Bacteria 10556
313 Ga0207689_10014019 3300025942 Bacteria 6823
314 Ga0207661_10002246 3300025944 Bacteria 13325
315 Ga0207661_10091744 3300025944 Unclassified 2531
316 Ga0207661_10276072 3300025944 Unclassified 1501
317 Ga0207679_10000363 3300025945 Bacteria 32874
318 Ga0207679_10018180 3300025945 Bacteria 4704
319 Ga0207679_10043963 3300025945 Bacteria 3220
320 Ga0207679_10168203 3300025945 Bacteria 1802
321 Ga0207667_10027896 3300025949 Bacteria 6137
322 Ga0207667_10053988 3300025949 Bacteria 4227
323 Ga0207651_10122160 3300025960 Unclassified 1977
324 Ga0207651_10156883 3300025960 Bacteria 1779
325 Ga0207651_10205125 3300025960 Bacteria 1583
326 Ga0207651_10348696 3300025960 Bacteria 1246
327 Ga0207712_10027307 3300025961 Bacteria 3810
328 Ga0207712_10077425 3300025961 Bacteria 2410
329 Ga0207668_10647959 3300025972 Bacteria 924
330 Ga0207640_10291399 3300025981 Bacteria 1287
331 Ga0207658_10178163 3300025986 Bacteria 1757
332 Ga0207658_10254944 3300025986 Unclassified 1492
333 Ga0207677_10095706 3300026023 Bacteria 2171
334 Ga0207677_10147053 3300026023 Bacteria 1812
335 Ga0207677_10255015 3300026023 Unclassified 1427
336 Ga0207703_10121070 3300026035 Bacteria 2246
337 Ga0207639_10050778 3300026041 Bacteria 3151
338 Ga0207639_10066652 3300026041 Unclassified 2799
339 Ga0207639_10197400 3300026041 Bacteria 1723
340 Ga0207639_10219048 3300026041 Bacteria 1643
341 Ga0207639_10566815 3300026041 Bacteria 1044
342 Ga0207708_10409921 3300026075 Bacteria 1122
343 Ga0207702_10138774 3300026078 Bacteria 2197
344 Ga0207641_10001250 3300026088 Bacteria 25365
345 Ga0207641_10206471 3300026088 Bacteria 1814
346 Ga0207641_10319874 3300026088 Bacteria 1471
347 Ga0207641_10410449 3300026088 Bacteria 1302
348 Ga0207648_10004327 3300026089 Bacteria 14627
349 Ga0207648_10030947 3300026089 Bacteria 4734
350 Ga0207648_10087834 3300026089 Unclassified 2714
351 Ga0207648_10217789 3300026089 Bacteria 1696
352 Ga0207648_10352517 3300026089 Bacteria 1327
353 Ga0207676_10003993 3300026095 Bacteria 10413
354 Ga0207676_10005280 3300026095 Bacteria 9147
355 Ga0207674_10009287 3300026116 Bacteria 11267
356 Ga0207674_10013672 3300026116 Bacteria 8991
357 Ga0207674_10045838 3300026116 Bacteria 4494
358 Ga0207674_10128785 3300026116 Bacteria 2496
359 Ga0207674_10197419 3300026116 Unclassified 1962
360 Ga0207674_10284941 3300026116 Bacteria 1600
361 Ga0207675_100112797 3300026118 Bacteria 2566
362 Ga0207683_10001560 3300026121 Bacteria 20614
363 Ga0207698_10455889 3300026142 Bacteria 1235
364 Ga0207698_10456757 3300026142 Bacteria 1234
365 Ga0268266_10182214 3300028379 Bacteria 1913
366 Ga0268266_10262533 3300028379 Bacteria 1601
367 Ga0268266_10579682 3300028379 Unclassified 1076
368 Ga0268264_10045469 3300028381 Unclassified 3645
369 Ga0268264_10088763 3300028381 Unclassified 2661
370 Ga0268264_10096743 3300028381 Bacteria 2558
371 Ga0268264_10350647 3300028381 Unclassified 1405
372 Ga0265340_10203837 3300031247 Bacteria 889
373 Ga0265313_10126819 3300031595 Bacteria 1109
374 Ga0307405_10171924 3300031731 Bacteria 1546
375 Ga0307413_10065429 3300031824 Bacteria 2264
376 Ga0307406_10056378 3300031901 Bacteria 2516
377 Ga0307407_10343230 3300031903 Bacteria 1055
378 Ga0307412_10004787 3300031911 Bacteria 7555
379 Ga0307412_10015174 3300031911 Bacteria 4559
380 Ga0307412_10027599 3300031911 Bacteria 3542
381 Ga0307409_100065196 3300031995 Bacteria 2865
382 Ga0307416_100000039 3300032002 Bacteria 133298
383 Ga0307416_100045039 3300032002 Bacteria 3470
384 Ga0307414_10002464 3300032004 Bacteria 9701
385 Ga0307414_10012066 3300032004 Bacteria 5096
386 Ga0307414_10046223 3300032004 Bacteria 2987
387 Ga0307414_10264667 3300032004 Bacteria 1437
388 Ga0307414_10446952 3300032004 Bacteria 1133
389 Ga0307415_100066222 3300032126 Bacteria 2520
390 Ga0373956_0038777 3300035119 Unclassified 2109
391 Ga0373955_0134540 3300035172 Unclassified 1445
392 Ga0373924_0039749 3300035410 Unclassified 1923
393 Ga0373935_0514302 3300035692 Unclassified 870
394 Ga0373933_0022546 3300035724 Bacteria 3587
395 Ga0373937_0285680 3300036401 Unclassified 1558
396 Ga0373925_0544527 3300037068 Unclassified 954
397 Ga0395900_0669724 3300037418 Unclassified 973
398 Ga0439433_0052040 3300041999 Bacteria 967
399 Ga0439445_0001630 3300042004 Bacteria 4907
400 Ga0451577_0016580 3300042876 Bacteria 6818
401 Ga0451577_0021782 3300042876 Bacteria 5861
402 Ga0451577_0033108 3300042876 Bacteria 4659
403 Ga0453684_0001775 3300044712 Bacteria 57622
404 Ga0453684_0248050 3300044712 Bacteria 2046
405 Ga0453684_1222398 3300044712 Bacteria 788
406 Ga0451576_0004801 3300045051 Bacteria 17314
407 Ga0466967_0262154 3300045976 Bacteria 1654
408 Ga0495627_000003 3300046453 Bacteria 704557
409 Ga0495627_008622 3300046453 Bacteria 3804
410 Ga0495638_0015692 3300046460 Bacteria 5081
411 Ga0495606_0029436 3300046507 Bacteria 3855
412 Ga0495610_0000032 3300046512 Bacteria 216443
413 Ga0495628_0053569 3300046516 Bacteria 3183
414 Ga0495630_0011154 3300046517 Bacteria 6504
415 Ga0495663_0000124 3300046525 Bacteria 32076
416 Ga0495663_0112917 3300046525 Bacteria 904
417 Ga0495640_0174354 3300046533 Unclassified 1373
418 Ga0495586_0071421 3300046535 Bacteria 1897
419 Ga0495598_0051748 3300046537 Unclassified 1239
420 Ga0495621_0149648 3300046539 Bacteria 918
421 Ga0495633_0000109 3300046558 Bacteria 110841
422 Ga0495633_0013488 3300046558 Bacteria 4305
423 Ga0495634_0056538 3300046642 Bacteria 2621
424 Ga0495625_0000542 3300046660 Bacteria 55319
425 Ga0495635_0058544 3300046663 Bacteria 2651
426 Ga0495599_0135017 3300046678 Unclassified 1532
427 Ga0495674_0197947 3300047319 Unclassified 1668
428 Ga0495672_0005785 3300047320 Bacteria 9715
429 Ga0495684_0115379 3300047471 Unclassified 2025
430 Ga0495686_0000253 3300047472 Bacteria 96076
431 Ga0495686_0003954 3300047472 Bacteria 12443
432 Ga0496102_0024576 3300048905 Bacteria 5356
433 Ga0496103_0082066 3300048906 Bacteria 2028
434 Ga0496108_0706688 3300048911 Bacteria 874
435 Ga0496116_0000022 3300048919 Bacteria 482506
436 Ga0496117_0000064 3300048920 Bacteria 254248
437 Ga0496118_0000147 3300048921 Bacteria 123467
438 Ga0496119_0000025 3300048922 Bacteria 257069
439 Ga0496122_0000433 3300048925 Bacteria 87562
440 Ga0496122_0002432 3300048925 Bacteria 26482
441 Ga0496122_0003237 3300048925 Bacteria 21629
442 Ga0496123_0003730 3300048926 Bacteria 16731
443 Ga0496123_0018826 3300048926 Bacteria 5472
444 Ga0496123_0078389 3300048926 Bacteria 2024
445 Ga0496124_0001842 3300048927 Bacteria 29277
446 Ga0496125_0001531 3300048928 Bacteria 33182
447 Ga0496125_0007660 3300048928 Bacteria 11444
448 Ga0496125_0250939 3300048928 Bacteria 1116
449 Ga0496126_0000922 3300048929 Bacteria 50884
450 Ga0496126_0095735 3300048929 Bacteria 2604
451 Ga0501032_0100079 3300049569 Bacteria 1921
452 Ga0501033_0101879 3300049570 Bacteria 2094
453 Ga0501034_0000002 3300049571 Bacteria 565510
454 Ga0501034_0052256 3300049571 Bacteria 4117
455 Ga0501034_0229730 3300049571 Bacteria 1805
456 Ga0501034_0454489 3300049571 Bacteria 1198
457 Ga0501037_0381306 3300049573 Bacteria 969
458 Ga0501038_0091162 3300049574 Bacteria 2554
459 Ga0501043_0464032 3300049579 Bacteria 950
460 Ga0501073_0262417 3300049589 Bacteria 1192
461 Ga0501207_034174 3300049654 Bacteria 865
462 Ga0501217_068340 3300049661 Bacteria 962
463 Ga0501233_022332 3300049668 Bacteria 1366
464 Ga0501249_040472 3300049679 Bacteria 1056
465 Ga0501241_000114 3300049758 Bacteria 17450
466 Ga0501269_000702 3300049766 Bacteria 5545
467 Ga0501035_0040851 3300049822 Bacteria 4190
468 Ga0501044_0551717 3300049823 Unclassified 1049
469 Ga0501044_0644954 3300049823 Bacteria 948
470 nmdc:mga08y16_40357_c1 3300050511 Unclassified 4893
471 2588233270 2585428187 Bacteria 4629388
472 2740058009 2739367874 Bacteria 4872888
473 2911143048 2911138879 Bacteria 5811561
474 Ga0157375_10055716
475 ARcpr5yngRDRAFT_c002403
476 JGI25406J46586_10033203
477 rootH2_10329710
478 rootL2_10297889
479 rootH1_10047967
480 rootH1_10075774
481 Ga0055536_1015298
482 Ga0065165_1000060
483 Ga0065714_10067686
484 Ga0065712_10024347
485 Ga0070658_10036250
486 Ga0070658_10132417
487 Ga0070658_10301405
488 Ga0070658_10473501
489 Ga0070676_10002798
490 Ga0070676_10006786
491 Ga0070676_10310330
492 Ga0070683_100000286
493 Ga0070683_100014039
494 Ga0070690_100063093
495 Ga0070690_100113482
496 Ga0070670_100030774
497 Ga0070670_100319968
498 Ga0068869_100006670
499 Ga0068869_100014722
500 Ga0068869_100036980
501 Ga0068869_100117579
502 Ga0070666_10274183
503 Ga0070666_10460052
504 Ga0070680_100057633
505 Ga0070680_100257342
506 Ga0070682_100000644
507 Ga0070682_100113825
508 Ga0070682_100137277
509 Ga0070682_100225292
510 Ga0070682_100537826
511 Ga0068868_100002313
512 Ga0068868_100038979
513 Ga0068868_100059256
514 Ga0070660_100058205
515 Ga0070660_100106917
516 Ga0070689_100013924
517 Ga0070687_100201526
518 Ga0070661_100000587
519 Ga0070661_100034893
520 Ga0070661_100043667
521 Ga0070668_100045693
522 Ga0070668_100555604
523 Ga0070669_100023004
524 Ga0070669_100039614
525 Ga0070669_100652139
526 Ga0070675_100092867
527 Ga0070675_100111389
528 Ga0070675_100150964
529 Ga0070671_100040685
530 Ga0070671_100143687
531 Ga0070674_100021442
532 Ga0070674_100246512
533 Ga0070674_100574836
534 Ga0070673_100042608
535 Ga0070688_100041146
536 Ga0070688_100067167
537 Ga0070688_100090378
538 Ga0070659_100022281
539 Ga0070659_100028784
540 Ga0070667_100039572
541 Ga0070667_100159046
542 Ga0070667_100721070
543 Ga0070700_100464749
544 Ga0070663_100267935
545 Ga0070678_100007382
546 Ga0070662_100014760
547 Ga0070662_100017389
548 Ga0070662_100245690
549 Ga0070681_10064208
550 Ga0070681_10108566
551 Ga0068867_100111311
552 Ga0070685_10013600
553 Ga0070685_10111004
554 Ga0070685_10169274
555 Ga0070685_10496758
556 Ga0070698_100003810
557 Ga0070679_100000398
558 Ga0070679_100504754
559 Ga0070684_100000500
560 Ga0070684_100003115
561 Ga0070684_100181264
562 Ga0070684_100340387
563 Ga0068853_100031964
564 Ga0068853_100053665
565 Ga0068853_100179758
566 Ga0068853_100183386
567 Ga0068853_100214363
568 Ga0068853_100268715
569 Ga0070672_100045657
570 Ga0070672_100752277
571 Ga0070686_100110139
572 Ga0070686_100795608
573 Ga0070665_100017699
574 Ga0070665_100026771
575 Ga0070665_100428635
576 Ga0068855_100014666
577 Ga0068855_100083213
578 Ga0068855_100102885
579 Ga0068855_100176937
580 Ga0070664_100000321
581 Ga0070664_100010635
582 Ga0070664_100124207
583 Ga0070664_100127021
584 Ga0070664_100408063
585 Ga0068857_100015618
586 Ga0068857_100078615
587 Ga0068857_100090444
588 Ga0068857_100145739
589 Ga0068857_100222813
590 Ga0068857_100565452
591 Ga0068857_100736658
592 Ga0068854_100018808
593 Ga0068856_100036724
594 Ga0068856_100070221
595 Ga0068856_100308530
596 Ga0068852_100236074
597 Ga0068852_100317746
598 Ga0068859_100076258
599 Ga0068859_100136431
600 Ga0068859_100208465
601 Ga0068859_100248041
602 Ga0068864_100020503
603 Ga0068864_100024337
604 Ga0068864_100070261
605 Ga0068864_100120771
606 Ga0068866_10183531
607 Ga0068866_10193190
608 Ga0068861_100200941
609 Ga0068851_10000088
610 Ga0068851_10154219
611 Ga0068870_10063684
612 Ga0068863_100039004
613 Ga0068858_100025905
614 Ga0068858_100074331
615 Ga0068860_100050035
616 Ga0068860_100059558
617 Ga0068860_100060978
618 Ga0068860_100116106
619 Ga0081539_10000622
620 Ga0070715_10130049
621 Ga0097621_100006601
622 Ga0097621_100028195
623 Ga0097621_100048927
624 Ga0097621_100209259
625 Ga0068871_100024090
626 Ga0068871_100104526
627 Ga0075428_100289149
628 Ga0068865_100419813
629 Ga0097620_100076257
630 Ga0097620_100136431
631 Ga0097620_100208483
632 Ga0097620_100248041
633 Ga0105251_10030563
634 Ga0105244_10000049
635 Ga0105240_10455815
636 Ga0111539_10005020
637 Ga0111539_10049682
638 Ga0111539_10188926
639 Ga0111539_10445126
640 Ga0105247_10150548
641 Ga0105243_10002732
642 Ga0105241_10076052
643 Ga0105242_10008966
644 Ga0105242_10009503
645 Ga0105242_10420880
646 Ga0105237_10063140
647 Ga0105249_10260063
648 Ga0105249_10644888
649 Ga0105239_10457989
650 Ga0105246_10033558
651 Ga0105246_10045396
652 Ga0157373_10000107
653 Ga0157373_10022656
654 Ga0157373_10028380
655 Ga0157373_10032015
656 Ga0157371_10000201
657 Ga0157371_10002256
658 Ga0157371_10014672
659 Ga0157371_10015852
660 Ga0157371_10056614
661 Ga0157371_10086636
662 Ga0157371_10100497
663 Ga0157371_10141923
664 Ga0157371_10164072
665 Ga0157371_10310926
666 Ga0157371_10345934
667 Ga0157370_10005377
668 Ga0157370_10039262
669 Ga0157370_10054744
670 Ga0157370_10091443
671 Ga0157370_10098320
672 Ga0157370_10102355
673 Ga0157370_10417300
674 Ga0157370_10783025
675 Ga0157370_10783383
676 Ga0157369_10000759
677 Ga0157369_10170442
678 Ga0157369_10559401
679 Ga0157374_10013695
680 Ga0157374_10082034
681 Ga0157374_10108122
682 Ga0157374_10129786
683 Ga0157374_10197911
684 Ga0157374_10418739
685 Ga0157378_10018615
686 Ga0157378_10023594
687 Ga0157378_10162319
688 Ga0157378_10411181
689 Ga0163162_10008971
690 Ga0163162_10026684
691 Ga0163162_10028810
692 Ga0163162_10064981
693 Ga0163162_10105256
694 Ga0163162_10143662
695 Ga0163162_10260554
696 Ga0157372_10015208
697 Ga0157372_10018030
698 Ga0157372_10033289
699 Ga0157372_10097841
700 Ga0157372_10198994
701 Ga0157372_10212366
702 Ga0157372_10484269
703 Ga0157372_10762996
704 Ga0157372_10965976
705 Ga0157375_10006054
706 Ga0157375_10062909
707 Ga0157375_10116172
708 Ga0157375_10233311
709 Ga0163163_10004447
710 Ga0163163_10037722
711 Ga0163163_10041887
712 Ga0163163_10537646
713 Ga0157380_10000259
714 Ga0157380_10082828
715 Ga0182008_10000011
716 Ga0157377_10046140
717 Ga0157379_10078905
718 Ga0157379_10303737
719 Ga0157376_10002842
720 Ga0157376_10046815
721 Ga0157376_10110251
722 Ga0157376_10193350
723 Ga0157376_10305192
724 Ga0157376_10423397
725 Ga0182006_1000012
726 Ga0163161_10006037
727 Ga0163161_10007386
728 Ga0163161_10174194
729 Ga0163161_10318457
730 Ga0163161_10462905
731 Ga0163161_10487821
732 Ga0209675_1000035
733 Ga0209676_1000342
734 Ga0207656_10000038
735 Ga0207655_1000254
736 Ga0207642_10200318
737 Ga0207710_10148611
738 Ga0207688_10035805
739 Ga0207680_10043638
740 Ga0207647_10204086
741 Ga0207645_10000193
742 Ga0207645_10003952
743 Ga0207645_10289849
744 Ga0207643_10002695
745 Ga0207705_10072926
746 Ga0207705_10162673
747 Ga0207705_10289923
748 Ga0207705_10297048
749 Ga0207705_10388159
750 Ga0207707_10085890
751 Ga0207707_10418457
752 Ga0207695_10322716
753 Ga0207671_10158991
754 Ga0207660_10224330
755 Ga0207662_10128767
756 Ga0207657_10025764
757 Ga0207657_10092907
758 Ga0207657_10224191
759 Ga0207649_10001129
760 Ga0207649_10014263
761 Ga0207649_10157984
762 Ga0207652_10107196
763 Ga0207652_10251878
764 Ga0207681_10542384
765 Ga0207650_10040009
766 Ga0207650_10263584
767 Ga0207650_10384290
768 Ga0207659_10008019
769 Ga0207659_10348285
770 Ga0207644_10251282
771 Ga0207690_10273405
772 Ga0207706_10001127
773 Ga0207706_10026213
774 Ga0207706_10048082
775 Ga0207706_10159849
776 Ga0207686_10000175
777 Ga0207670_10065213
778 Ga0207670_10141076
779 Ga0207669_10280844
780 Ga0207704_10024641
781 Ga0207691_10016995
782 Ga0207691_10189934
783 Ga0207691_10680756
784 Ga0207689_10000359
785 Ga0207689_10006249
786 Ga0207689_10014019
787 Ga0207661_10002246
788 Ga0207661_10091744
789 Ga0207661_10276072
790 Ga0207679_10000363
791 Ga0207679_10018180
792 Ga0207679_10043963
793 Ga0207679_10168203
794 Ga0207667_10027896
795 Ga0207667_10053988
796 Ga0207651_10122160
797 Ga0207651_10156883
798 Ga0207651_10205125
799 Ga0207651_10348696
800 Ga0207712_10027307
801 Ga0207712_10077425
802 Ga0207668_10647959
803 Ga0207640_10291399
804 Ga0207658_10178163
805 Ga0207658_10254944
806 Ga0207677_10095706
807 Ga0207677_10147053
808 Ga0207677_10255015
809 Ga0207703_10121070
810 Ga0207639_10050778
811 Ga0207639_10066652
812 Ga0207639_10197400
813 Ga0207639_10219048
814 Ga0207639_10566815
815 Ga0207708_10409921
816 Ga0207702_10138774
817 Ga0207641_10001250
818 Ga0207641_10206471
819 Ga0207641_10319874
820 Ga0207641_10410449
821 Ga0207648_10004327
822 Ga0207648_10030947
823 Ga0207648_10087834
824 Ga0207648_10217789
825 Ga0207648_10352517
826 Ga0207676_10003993
827 Ga0207676_10005280
828 Ga0207674_10009287
829 Ga0207674_10013672
830 Ga0207674_10045838
831 Ga0207674_10128785
832 Ga0207674_10197419
833 Ga0207674_10284941
834 Ga0207675_100112797
835 Ga0207683_10001560
836 Ga0207698_10455889
837 Ga0207698_10456757
838 Ga0268266_10182214
839 Ga0268266_10262533
840 Ga0268266_10579682
841 Ga0268264_10045469
842 Ga0268264_10088763
843 Ga0268264_10096743
844 Ga0268264_10350647
845 Ga0265340_10203837
846 Ga0265313_10126819
847 Ga0307405_10171924
848 Ga0307413_10065429
849 Ga0307406_10056378
850 Ga0307407_10343230
851 Ga0307412_10004787
852 Ga0307412_10015174
853 Ga0307412_10027599
854 Ga0307409_100065196
855 Ga0307416_100000039
856 Ga0307416_100045039
857 Ga0307414_10002464
858 Ga0307414_10012066
859 Ga0307414_10046223
860 Ga0307414_10264667
861 Ga0307414_10446952
862 Ga0307415_100066222
863 Ga0373956_0038777
864 Ga0373955_0134540
865 Ga0373924_0039749
866 Ga0373935_0514302
867 Ga0373933_0022546
868 Ga0373937_0285680
869 Ga0373925_0544527
870 Ga0395900_0669724
871 Ga0439433_0052040
872 Ga0439445_0001630
873 Ga0451577_0016580
874 Ga0451577_0021782
875 Ga0451577_0033108
876 Ga0453684_0001775
877 Ga0453684_0248050
878 Ga0453684_1222398
879 Ga0451576_0004801
880 Ga0466967_0262154
881 Ga0495627_000003
882 Ga0495627_008622
883 Ga0495638_0015692
884 Ga0495606_0029436
885 Ga0495610_0000032
886 Ga0495628_0053569
887 Ga0495630_0011154
888 Ga0495663_0000124
889 Ga0495663_0112917
890 Ga0495640_0174354
891 Ga0495586_0071421
892 Ga0495598_0051748
893 Ga0495621_0149648
894 Ga0495633_0000109
895 Ga0495633_0013488
896 Ga0495634_0056538
897 Ga0495625_0000542
898 Ga0495635_0058544
899 Ga0495599_0135017
900 Ga0495674_0197947
901 Ga0495672_0005785
902 Ga0495684_0115379
903 Ga0495686_0000253
904 Ga0495686_0003954
905 Ga0496102_0024576
906 Ga0496103_0082066
907 Ga0496108_0706688
908 Ga0496116_0000022
909 Ga0496117_0000064
910 Ga0496118_0000147
911 Ga0496119_0000025
912 Ga0496122_0000433
913 Ga0496122_0002432
914 Ga0496122_0003237
915 Ga0496123_0003730
916 Ga0496123_0018826
917 Ga0496123_0078389
918 Ga0496124_0001842
919 Ga0496125_0001531
920 Ga0496125_0007660
921 Ga0496125_0250939
922 Ga0496126_0000922
923 Ga0496126_0095735
924 Ga0501032_0100079
925 Ga0501033_0101879
926 Ga0501034_0000002
927 Ga0501034_0052256
928 Ga0501034_0229730
929 Ga0501034_0454489
930 Ga0501037_0381306
931 Ga0501038_0091162
932 Ga0501043_0464032
933 Ga0501073_0262417
934 Ga0501207_034174
935 Ga0501217_068340
936 Ga0501233_022332
937 Ga0501249_040472
938 Ga0501241_000114
939 Ga0501269_000702
940 Ga0501035_0040851
941 Ga0501044_0551717
942 Ga0501044_0644954
943 nmdc:mga08y16_40357_c1
944 2588233270
945 2740058009
946 2911143048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

59

252

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

65

265

0.91

PF08659

KR

KR domain

60

241

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.911 1 230
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9087 6 233
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9075 7 232
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9059 7 233
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9055 6 234
ID Description Score Start End Superfamily
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9389 2 94 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9303 2 82 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9246 2 185 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9123 2 189 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.911 1 230 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y3F574-F1-model_v4 SDR family oxidoreductase 0.9382 35 233 GO:0016491
AF-A0A7Z1XZP9-F1-model_v4 deleted 0.9347 7 237
AF-A0A534PQG2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9338 2 184 GO:0016020
GO:0016491
AF-A0A238YM33-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9274 1 237 GO:0016491
AF-K1LAD4-F1-model_v4 3-alpha-(Or 20-beta)-hydroxysteroid dehydrogenase (EC 1.1.1.53) 0.9271 58 235 GO:0047044

Map