F451052

General Info

Members Datasets Scaffolds Average Seq Length
473 300 946 349

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0111990|Ga0395905_0111990_755_1822
Length 340
Sequence MTDTHDNPMGLDGFEFAEFTSPDPEHMTGLIEQLGFVATHRHPTKDILRYKQGDISLLVNRDPSGQAAAFRAEHGAFDMAVERGAKPADAASGALGPDSYVLQGIGGSLLYLIDRYGAKGTIYDGWTAIPGAAEAEAKNAVGLQVLDHLTHNVRRGEMRTWSSFYNRVFGFEEQKYFDIKGKATGLFSQAMIAPDRQIRIPLNESQDENSQIEEFIRQYNGEGIQHLALTTDDIYGTIEKLKARGVVFQDTIETYYELVDKRLPGHGEDLERMKQNRILIDGSQEEGLLLQIFTENLFGPIFFEIIQRKGNEGFGNGNFQALFESIELDQIRRGVIKVDA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
83 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
151 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
212 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
213 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
214 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
225 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
226 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
230 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
231 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
232 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
233 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
241 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
242 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
248 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
253 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
254 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
255 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
256 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
257 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
258 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
259 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
260 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
261 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
262 2643221583 Caulobacter sp. Root655 Isolate Unclassified
263 2643221584 Caulobacter sp. Root656 Isolate Unclassified
264 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
265 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
266 2643221640 Caulobacter sp. Root342 Isolate Unclassified
267 2643221642 Caulobacter sp. Root343 Isolate Unclassified
268 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
269 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
270 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
271 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
272 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
273 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
274 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
275 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
276 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
277 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
278 2818991435 Caulobacter henricii 536 Isolate Unclassified
279 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
280 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
281 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
282 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
283 2849560528 Caulobacter zeae 410 Isolate Unclassified
284 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
285 2851153111 Caulobacter radicis 736 Isolate Unclassified
286 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
287 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
288 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
289 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
290 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
291 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
292 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
293 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
294 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
295 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
296 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
297 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
298 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
299 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
300 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 89.64
Metatranscriptomes 0
Isolates 10.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.63
Bulb 0
Endosphere 31.92
Nodule 0
Rhizoplane 1.48
Rhizosphere 55.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0111990 3300037471 Bacteria 2563
2 JGI24740J21852_10010391 3300001979 Bacteria 3591
3 JGI24739J22299_10014357 3300001989 Bacteria 2882
4 JGI24737J22298_10001020 3300001990 Bacteria 9922
5 JGI24737J22298_10001106 3300001990 Bacteria 9485
6 JGI24737J22298_10039714 3300001990 Bacteria 1446
7 JGI24735J21928_10000344 3300002067 Bacteria 16234
8 JGI24735J21928_10018710 3300002067 Bacteria 2135
9 JGI24735J21928_10035210 3300002067 Bacteria 1473
10 JGI24738J21930_10000317 3300002075 Bacteria 13341
11 JGI24738J21930_10002550 3300002075 Bacteria 4730
12 JGI25150J39212_1000946 3300002774 Bacteria 9298
13 JGI25151J46595_10008598 3300003187 Bacteria 4895
14 JGI25165J46597_1000145 3300003214 Bacteria 116948
15 JGI25153J46596_10000036 3300003215 Bacteria 182205
16 JGI25153J46596_10013839 3300003215 Bacteria 3388
17 Ga0055542_1003517 3300003762 Bacteria 4202
18 Ga0055526_1006904 3300003771 Bacteria 6043
19 Ga0055537_1001008 3300003773 Bacteria 12763
20 Ga0055537_1004951 3300003773 Bacteria 3677
21 Ga0055537_1006445 3300003773 Bacteria 2979
22 Ga0055524_1000351 3300003775 Bacteria 41918
23 Ga0055524_1009750 3300003775 Bacteria 3876
24 Ga0055524_1014523 3300003775 Bacteria 2915
25 Ga0055536_1000580 3300003781 Bacteria 24917
26 Ga0055536_1001430 3300003781 Bacteria 14396
27 Ga0055536_1019001 3300003781 Bacteria 2177
28 Ga0055528_1018686 3300003790 Bacteria 2338
29 Ga0055530_10000017 3300003791 Bacteria 144027
30 Ga0055530_10000144 3300003791 Bacteria 63595
31 Ga0055530_10002385 3300003791 Bacteria 12178
32 Ga0055530_10003953 3300003791 Bacteria 8016
33 Ga0055540_1000701 3300003792 Bacteria 23049
34 Ga0055531_10000129 3300003794 Bacteria 85460
35 Ga0055531_10000188 3300003794 Bacteria 68777
36 Ga0055531_10002101 3300003794 Bacteria 13686
37 Ga0055531_10006456 3300003794 Bacteria 6657
38 Ga0055531_10011261 3300003794 Bacteria 4339
39 Ga0055543_1015833 3300004625 Bacteria 1444
40 Ga0065165_1001046 3300005262 Bacteria 33350
41 Ga0065165_1002946 3300005262 Bacteria 12963
42 Ga0065707_10004435 3300005295 Bacteria 6895
43 Ga0070658_10000082 3300005327 Bacteria 89656
44 Ga0070658_10008508 3300005327 Bacteria 8250
45 Ga0070658_10022356 3300005327 Bacteria 5073
46 Ga0070658_10312622 3300005327 Bacteria 1341
47 Ga0070676_10008767 3300005328 Bacteria 5457
48 Ga0068869_100001291 3300005334 Bacteria 14827
49 Ga0070666_10027492 3300005335 Bacteria 3726
50 Ga0068868_100003545 3300005338 Bacteria 10880
51 Ga0070660_100000641 3300005339 Bacteria 23186
52 Ga0070660_100002098 3300005339 Bacteria 13750
53 Ga0070668_100000923 3300005347 Bacteria 20489
54 Ga0070668_100001054 3300005347 Bacteria 19371
55 Ga0070674_100060625 3300005356 Bacteria 2638
56 Ga0070673_100000003 3300005364 Bacteria 216759
57 Ga0070667_100000024 3300005367 Bacteria 191216
58 Ga0070667_100010837 3300005367 Bacteria 7538
59 Ga0070663_100002030 3300005455 Bacteria 11311
60 Ga0070662_100032500 3300005457 Bacteria 3667
61 Ga0070662_100037789 3300005457 Bacteria 3425
62 Ga0068867_100000001 3300005459 Bacteria 427563
63 Ga0068853_100009163 3300005539 Bacteria 7973
64 Ga0070693_100090451 3300005547 Bacteria 1844
65 Ga0070665_100000767 3300005548 Bacteria 42433
66 Ga0068855_100000273 3300005563 Bacteria 63616
67 Ga0068855_100208631 3300005563 Bacteria 2196
68 Ga0068854_100000559 3300005578 Bacteria 22307
69 Ga0068854_100052860 3300005578 Bacteria 2915
70 Ga0068856_100029115 3300005614 Bacteria 5395
71 Ga0068852_100013658 3300005616 Bacteria 6221
72 Ga0068859_100004856 3300005617 Bacteria 13679
73 Ga0068866_10054116 3300005718 Bacteria 2055
74 Ga0068861_100000036 3300005719 Bacteria 60355
75 Ga0068863_100000082 3300005841 Bacteria 105688
76 Ga0068858_100000260 3300005842 Bacteria 56470
77 Ga0068860_100220937 3300005843 Bacteria 1840
78 Ga0068862_100006887 3300005844 Bacteria 9427
79 Ga0081540_1042864 3300005983 Bacteria 2328
80 Ga0081539_10019079 3300005985 Bacteria 4715
81 Ga0075368_10000225 3300006042 Bacteria 15895
82 Ga0075368_10000346 3300006042 Bacteria 13571
83 Ga0075363_100025234 3300006048 Bacteria 3029
84 Ga0075364_10040294 3300006051 Bacteria 3029
85 Ga0075362_10007630 3300006177 Bacteria 4108
86 Ga0075367_10001261 3300006178 Bacteria 10679
87 Ga0075369_10039279 3300006186 Bacteria 2021
88 Ga0097621_100037492 3300006237 Bacteria 3884
89 Ga0075370_10002969 3300006353 Bacteria 7971
90 Ga0075370_10008165 3300006353 Bacteria 5373
91 Ga0075370_10029084 3300006353 Bacteria 3075
92 Ga0075370_10065936 3300006353 Bacteria 2065
93 Ga0068865_100000306 3300006881 Bacteria 27093
94 Ga0097620_100004857 3300006931 Bacteria 13679
95 Ga0105240_10009750 3300009093 Bacteria 13561
96 Ga0105245_10002236 3300009098 Bacteria 17525
97 Ga0105243_10000042 3300009148 Bacteria 159276
98 Ga0105241_10009470 3300009174 Bacteria 7156
99 Ga0105242_10004833 3300009176 Bacteria 10430
100 Ga0105248_10000315 3300009177 Bacteria 57362
101 Ga0105248_10002271 3300009177 Bacteria 21272
102 Ga0105248_10044023 3300009177 Bacteria 5006
103 Ga0105248_10066044 3300009177 Bacteria 4062
104 Ga0105237_10002575 3300009545 Bacteria 22351
105 Ga0105237_10270715 3300009545 Bacteria 1701
106 Ga0105249_10183191 3300009553 Bacteria 2039
107 Ga0105148_100052 3300009978 Bacteria 17846
108 Ga0105239_10000131 3300010375 Bacteria 105796
109 Ga0105239_10011679 3300010375 Bacteria 9802
110 Ga0105246_10008547 3300011119 Bacteria 6297
111 Ga0157373_10130270 3300013100 Bacteria 1769
112 Ga0157370_10000008 3300013104 Bacteria 240668
113 Ga0157369_10011793 3300013105 Bacteria 9925
114 Ga0157369_10103977 3300013105 Bacteria 3025
115 Ga0157369_10285306 3300013105 Bacteria 1719
116 Ga0157374_10014130 3300013296 Bacteria 6979
117 Ga0157374_10075852 3300013296 Bacteria 3177
118 Ga0157378_10011556 3300013297 Bacteria 7731
119 Ga0157372_10027326 3300013307 Bacteria 6213
120 Ga0157372_10094385 3300013307 Bacteria 3406
121 Ga0157375_10001871 3300013308 Bacteria 18131
122 Ga0157380_10027469 3300014326 Bacteria 4329
123 Ga0157376_10000072 3300014969 Bacteria 77631
124 Ga0183365_10001 3300015684 Bacteria 2090444
125 Ga0183363_1003 3300015690 Bacteria 421263
126 Ga0163161_10203205 3300017792 Bacteria 1528
127 Ga0213872_10004938 3300021361 Bacteria 6935
128 Ga0209674_106850 3300025226 Bacteria 1499
129 Ga0209147_101472 3300025229 Bacteria 8441
130 Ga0207427_100395 3300025231 Bacteria 25928
131 Ga0207425_1000037 3300025245 Bacteria 224645
132 Ga0209026_1001380 3300025250 Bacteria 10846
133 Ga0209148_1000441 3300025254 Bacteria 45707
134 Ga0209148_1004388 3300025254 Bacteria 3487
135 Ga0209129_1014866 3300025258 Bacteria 1634
136 Ga0209233_1000207 3300025261 Bacteria 117152
137 Ga0209565_1000012 3300025263 Bacteria 606500
138 Ga0209565_1000118 3300025263 Bacteria 113196
139 Ga0209565_1000314 3300025263 Bacteria 44878
140 Ga0209455_1000772 3300025272 Bacteria 17958
141 Ga0209673_1008474 3300025273 Bacteria 4571
142 Ga0209673_1012955 3300025273 Bacteria 3320
143 Ga0209675_1000089 3300025291 Bacteria 146897
144 Ga0209675_1002824 3300025291 Bacteria 8660
145 Ga0209675_1013585 3300025291 Bacteria 2534
146 Ga0209676_1000128 3300025292 Bacteria 188099
147 Ga0209676_1000151 3300025292 Bacteria 167307
148 Ga0209676_1000212 3300025292 Bacteria 128606
149 Ga0209676_1019332 3300025292 Bacteria 2345
150 Ga0209025_1000117 3300025294 Bacteria 215073
151 Ga0209564_1002594 3300025295 Bacteria 13866
152 Ga0209564_1004400 3300025295 Bacteria 8636
153 Ga0209564_1007705 3300025295 Bacteria 5488
154 Ga0209564_1010025 3300025295 Bacteria 4420
155 Ga0209758_1000103 3300025297 Bacteria 223968
156 Ga0209758_1002847 3300025297 Bacteria 16797
157 Ga0209758_1005117 3300025297 Bacteria 10364
158 Ga0209758_1014215 3300025297 Bacteria 4255
159 Ga0209050_1000001 3300025298 Bacteria 3563507
160 Ga0209050_1000010 3300025298 Bacteria 980454
161 Ga0209050_1000068 3300025298 Bacteria 298849
162 Ga0209050_1000817 3300025298 Bacteria 43485
163 Ga0209050_1001306 3300025298 Bacteria 28018
164 Ga0209050_1005775 3300025298 Bacteria 7617
165 Ga0209050_1006599 3300025298 Bacteria 6814
166 Ga0209050_1009072 3300025298 Bacteria 5167
167 Ga0209256_1000012 3300025299 Bacteria 790371
168 Ga0209256_1004048 3300025299 Bacteria 9537
169 Ga0209256_1006244 3300025299 Bacteria 6412
170 Ga0209256_1010053 3300025299 Bacteria 4033
171 Ga0209051_1000296 3300025303 Bacteria 79427
172 Ga0209051_1001480 3300025303 Bacteria 19758
173 Ga0209257_1000009 3300025304 Bacteria 1205047
174 Ga0209257_1000140 3300025304 Bacteria 201515
175 Ga0209257_1000193 3300025304 Bacteria 151777
176 Ga0209257_1002098 3300025304 Bacteria 20912
177 Ga0209257_1002149 3300025304 Bacteria 20520
178 Ga0209257_1002618 3300025304 Bacteria 17382
179 Ga0209257_1006971 3300025304 Bacteria 7038
180 Ga0209257_1007742 3300025304 Bacteria 6395
181 Ga0209257_1008265 3300025304 Bacteria 5979
182 Ga0209257_1008681 3300025304 Bacteria 5684
183 Ga0207680_10045798 3300025903 Bacteria 2582
184 Ga0207647_10000788 3300025904 Bacteria 24607
185 Ga0207647_10001451 3300025904 Bacteria 18199
186 Ga0207647_10022355 3300025904 Bacteria 4201
187 Ga0207647_10035726 3300025904 Bacteria 3164
188 Ga0207645_10000454 3300025907 Bacteria 34064
189 Ga0207705_10000027 3300025909 Bacteria 248863
190 Ga0207705_10000256 3300025909 Bacteria 51644
191 Ga0207705_10002705 3300025909 Bacteria 13560
192 Ga0207705_10191742 3300025909 Bacteria 1546
193 Ga0207695_10027218 3300025913 Bacteria 6370
194 Ga0207695_10073539 3300025913 Bacteria 3482
195 Ga0207671_10001065 3300025914 Bacteria 33324
196 Ga0207671_10161648 3300025914 Bacteria 1734
197 Ga0207671_10173240 3300025914 Bacteria 1676
198 Ga0207657_10000949 3300025919 Bacteria 30720
199 Ga0207657_10005009 3300025919 Bacteria 13911
200 Ga0207657_10078655 3300025919 Bacteria 2776
201 Ga0207657_10205931 3300025919 Bacteria 1580
202 Ga0207687_10007684 3300025927 Bacteria 7082
203 Ga0207690_10014878 3300025932 Bacteria 4709
204 Ga0207706_10014749 3300025933 Bacteria 7075
205 Ga0207706_10015554 3300025933 Bacteria 6875
206 Ga0207706_10134537 3300025933 Bacteria 2174
207 Ga0207706_10232695 3300025933 Bacteria 1612
208 Ga0207686_10004829 3300025934 Bacteria 7241
209 Ga0207709_10000547 3300025935 Bacteria 32231
210 Ga0207669_10016205 3300025937 Bacteria 3781
211 Ga0207704_10000001 3300025938 Bacteria 716296
212 Ga0207691_10021769 3300025940 Bacteria 6051
213 Ga0207711_10000838 3300025941 Bacteria 29705
214 Ga0207711_10001460 3300025941 Bacteria 22085
215 Ga0207711_10014888 3300025941 Bacteria 6461
216 Ga0207711_10044378 3300025941 Bacteria 3795
217 Ga0207689_10001948 3300025942 Bacteria 19544
218 Ga0207667_10000109 3300025949 Bacteria 132054
219 Ga0207651_10000002 3300025960 Bacteria 427663
220 Ga0207712_10108887 3300025961 Bacteria 2074
221 Ga0207668_10000033 3300025972 Bacteria 121080
222 Ga0207668_10000647 3300025972 Bacteria 21409
223 Ga0207640_10000202 3300025981 Bacteria 42596
224 Ga0207658_10000022 3300025986 Bacteria 191235
225 Ga0207658_10016149 3300025986 Bacteria 5130
226 Ga0207677_10001269 3300026023 Bacteria 13574
227 Ga0207703_10000113 3300026035 Bacteria 96214
228 Ga0207639_10006534 3300026041 Bacteria 7929
229 Ga0207639_10028364 3300026041 Bacteria 4086
230 Ga0207639_10031492 3300026041 Bacteria 3899
231 Ga0207678_10315774 3300026067 Bacteria 1344
232 Ga0207641_10000139 3300026088 Bacteria 105740
233 Ga0207648_10000001 3300026089 Bacteria 427499
234 Ga0207676_10340742 3300026095 Bacteria 1383
235 Ga0207675_100000154 3300026118 Bacteria 60483
236 Ga0207683_10258433 3300026121 Bacteria 1590
237 Ga0207698_10000077 3300026142 Bacteria 65551
238 Ga0209813_10000180 3300027866 Bacteria 20487
239 Ga0209813_10000872 3300027866 Bacteria 6798
240 Ga0268266_10001064 3300028379 Bacteria 34416
241 Ga0268265_10004230 3300028380 Bacteria 10025
242 Ga0307515_10001181 3300028794 Bacteria 59747
243 Ga0307515_10027226 3300028794 Bacteria 9785
244 Ga0307515_10036427 3300028794 Bacteria 7958
245 Ga0307515_10077216 3300028794 Bacteria 4402
246 Ga0265338_10078372 3300028800 Bacteria 2787
247 Ga0307413_10056680 3300031824 Bacteria 2391
248 Ga0395899_0000004 3300037312 Bacteria 874267
249 Ga0395899_0002774 3300037312 Bacteria 14132
250 Ga0395900_0057711 3300037418 Bacteria 3997
251 Ga0395905_0089031 3300037471 Bacteria 2893
252 Ga0436361_0211876 3300039447 Bacteria 15693
253 Ga0439436_0019842 3300041404 Bacteria 2004
254 Ga0439465_0008744 3300041413 Bacteria 3191
255 Ga0451806_171803 3300041462 Bacteria 1699
256 Ga0439431_0000643 3300041997 Bacteria 7429
257 Ga0439448_0007380 3300042005 Bacteria 3186
258 Ga0439448_0033139 3300042005 Bacteria 1647
259 Ga0439432_000868 3300042006 Bacteria 11320
260 Ga0439455_0004366 3300042012 Bacteria 2797
261 Ga0439455_0049004 3300042012 Bacteria 1099
262 Ga0439458_0000341 3300042157 Bacteria 11672
263 Ga0439458_0001444 3300042157 Bacteria 5980
264 Ga0439435_0013963 3300042436 Bacteria 1977
265 Ga0466969_0021314 3300044656 Bacteria 3351
266 Ga0466966_0011188 3300044684 Bacteria 5952
267 Ga0466961_0002957 3300044693 Bacteria 10556
268 Ga0466963_0174661 3300044694 Bacteria 1498
269 Ga0466971_0005983 3300044719 Bacteria 5293
270 Ga0466970_0053442 3300044765 Bacteria 2157
271 Ga0466959_0000280 3300045049 Bacteria 31145
272 Ga0466959_0098465 3300045049 Bacteria 2095
273 Ga0451576_0284798 3300045051 Bacteria 1728
274 Ga0466958_0008065 3300045836 Bacteria 5826
275 Ga0495627_000113 3300046453 Bacteria 100542
276 Ga0495627_001065 3300046453 Bacteria 18144
277 Ga0495590_0002574 3300046457 Bacteria 7496
278 Ga0495638_0000012 3300046460 Bacteria 435577
279 Ga0495638_0000892 3300046460 Bacteria 30611
280 Ga0495638_0001021 3300046460 Bacteria 27811
281 Ga0495638_0005532 3300046460 Bacteria 9374
282 Ga0495650_0000237 3300046471 Bacteria 110872
283 Ga0495650_0006604 3300046471 Bacteria 7201
284 Ga0495607_0057711 3300046501 Bacteria 2223
285 Ga0495583_0000001 3300046506 Bacteria 811973
286 Ga0495583_0001160 3300046506 Bacteria 28668
287 Ga0495606_0005233 3300046507 Bacteria 12524
288 Ga0495610_0000407 3300046512 Bacteria 44093
289 Ga0495610_0005272 3300046512 Bacteria 9247
290 Ga0495610_0028782 3300046512 Bacteria 2934
291 Ga0495616_0000109 3300046513 Bacteria 71495
292 Ga0495616_0000162 3300046513 Bacteria 58625
293 Ga0495620_0028407 3300046515 Bacteria 2601
294 Ga0495632_0000001 3300046519 Bacteria 873295
295 Ga0495632_0000773 3300046519 Bacteria 28703
296 Ga0495632_0008096 3300046519 Bacteria 6507
297 Ga0495637_0000809 3300046520 Bacteria 20718
298 Ga0495637_0018613 3300046520 Bacteria 3220
299 Ga0495643_0000006 3300046522 Bacteria 419524
300 Ga0495643_0052495 3300046522 Bacteria 2189
301 Ga0495648_0000295 3300046524 Bacteria 55574
302 Ga0495648_0001990 3300046524 Bacteria 19425
303 Ga0495648_0041808 3300046524 Bacteria 2891
304 Ga0495663_0000002 3300046525 Bacteria 495384
305 Ga0495654_0000249 3300046530 Bacteria 49711
306 Ga0495654_0005404 3300046530 Bacteria 7426
307 Ga0495609_0064419 3300046538 Bacteria 1617
308 Ga0495597_0047739 3300046542 Bacteria 1895
309 Ga0495633_0000053 3300046558 Bacteria 152374
310 Ga0495633_0000160 3300046558 Bacteria 88116
311 Ga0495633_0005525 3300046558 Bacteria 7696
312 Ga0495633_0019075 3300046558 Bacteria 3471
313 Ga0495668_0000037 3300046616 Bacteria 233981
314 Ga0495668_0026028 3300046616 Bacteria 3321
315 Ga0495625_0000143 3300046660 Bacteria 110121
316 Ga0495625_0007323 3300046660 Bacteria 9636
317 Ga0495625_0080372 3300046660 Bacteria 2270
318 Ga0495670_0000004 3300046691 Bacteria 310086
319 Ga0495671_0000008 3300046692 Bacteria 419524
320 Ga0495671_0000111 3300046692 Bacteria 72744
321 Ga0495589_0010961 3300046794 Bacteria 4706
322 Ga0495672_0001838 3300047320 Bacteria 20264
323 Ga0495679_022557 3300047446 Bacteria 2152
324 Ga0495673_0000013 3300047469 Bacteria 612902
325 Ga0495673_0000139 3300047469 Bacteria 130652
326 Ga0495673_0000156 3300047469 Bacteria 118831
327 Ga0495673_0003688 3300047469 Bacteria 9981
328 Ga0495681_0002650 3300047470 Bacteria 12688
329 Ga0495686_0000103 3300047472 Bacteria 176842
330 Ga0495686_0008083 3300047472 Bacteria 7783
331 Ga0495686_0012360 3300047472 Bacteria 5975
332 Ga0495686_0049988 3300047472 Bacteria 2628
333 Ga0495686_0213902 3300047472 Bacteria 1100
334 Ga0496102_0394321 3300048905 Bacteria 1302
335 Ga0496107_0004682 3300048910 Bacteria 9288
336 Ga0496111_0008505 3300048914 Bacteria 6798
337 Ga0496115_0003128 3300048918 Bacteria 11899
338 Ga0496117_0036372 3300048920 Bacteria 3685
339 Ga0496118_0007932 3300048921 Bacteria 11108
340 Ga0496118_0029840 3300048921 Bacteria 4564
341 Ga0496118_0038504 3300048921 Bacteria 3831
342 Ga0496119_0015637 3300048922 Bacteria 5825
343 Ga0496120_0071001 3300048923 Bacteria 1913
344 Ga0496121_0000272 3300048924 Bacteria 108051
345 Ga0496121_0003298 3300048924 Bacteria 23176
346 Ga0496121_0004371 3300048924 Bacteria 19103
347 Ga0496121_0005379 3300048924 Bacteria 16450
348 Ga0496121_0025027 3300048924 Bacteria 5684
349 Ga0496121_0063896 3300048924 Bacteria 3004
350 Ga0496123_0012290 3300048926 Bacteria 7316
351 Ga0496124_0007621 3300048927 Bacteria 11470
352 Ga0496124_0010185 3300048927 Bacteria 9561
353 Ga0496124_0126722 3300048927 Bacteria 2033
354 Ga0496125_0000953 3300048928 Bacteria 45480
355 Ga0496125_0004150 3300048928 Bacteria 16894
356 Ga0496125_0038735 3300048928 Bacteria 4118
357 Ga0496125_0216078 3300048928 Bacteria 1240
358 Ga0496126_0000733 3300048929 Bacteria 59621
359 Ga0495678_003643 3300049459 Bacteria 9359
360 Ga0501034_0003784 3300049571 Bacteria 17076
361 Ga0501034_0305381 3300049571 Bacteria 1527
362 Ga0501043_0257737 3300049579 Bacteria 1342
363 Ga0501211_003579 3300049658 Bacteria 1598
364 Ga0501223_000006 3300049663 Bacteria 133378
365 Ga0501235_000453 3300049669 Bacteria 8013
366 Ga0501246_000655 3300049676 Bacteria 2532
367 Ga0501225_0000032 3300049705 Bacteria 47166
368 nmdc:mga03683_1401_c1 3300050489 Bacteria 7178
369 nmdc:mga03n38_87624_c1 3300050490 Bacteria 1476
370 nmdc:mga00v17_2932_c1 3300050491 Bacteria 3259
371 nmdc:mga00v17_9340_c1 3300050491 Bacteria 5302
372 nmdc:mga0k408_110641_c1 3300050493 Bacteria 1624
373 nmdc:mga0k408_79126_c1 3300050493 Bacteria 1924
374 nmdc:mga06z11_100_c1 3300050494 Bacteria 36184
375 nmdc:mga04h51_11_c1 3300050495 Bacteria 101578
376 nmdc:mga04h51_181_c1 3300050495 Bacteria 17738
377 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
378 nmdc:mga07m45_163116_c1 3300050496 Bacteria 1294
379 nmdc:mga07m45_18591_c1 3300050496 Bacteria 2064
380 nmdc:mga07m45_29388_c1 3300050496 Bacteria 3039
381 nmdc:mga07m45_4041_c1 3300050496 Bacteria 7146
382 nmdc:mga0sz30_109_c1 3300050516 Bacteria 31084
383 Ga0500635_0000408 3300053080 Bacteria 12879
384 Ga0500578_0000023 3300053086 Bacteria 153470
385 Ga0500643_000098 3300053087 Bacteria 91878
386 Ga0500643_000110 3300053087 Bacteria 85114
387 Ga0500643_001047 3300053087 Bacteria 16790
388 Ga0500643_007636 3300053087 Bacteria 4333
389 Ga0500644_0000174 3300053088 Bacteria 41140
390 Ga0500646_0007632 3300053090 Bacteria 2764
391 Ga0500554_001270 3300053102 Bacteria 4890
392 Ga0500555_001428 3300053103 Bacteria 7329
393 Ga0500556_0001361 3300053104 Bacteria 10781
394 Ga0500592_000143 3300053116 Bacteria 14793
395 Ga0500594_0001447 3300053118 Bacteria 5154
396 Ga0500595_003892 3300053119 Bacteria 6851
397 Ga0500607_000065 3300053121 Bacteria 74437
398 Ga0500608_000276 3300053122 Bacteria 19915
399 Ga0500608_005116 3300053122 Bacteria 5167
400 Ga0500618_000305 3300053125 Bacteria 36613
401 Ga0500642_0148779 3300053130 Bacteria 1099
402 Ga0500559_0000007 3300053136 Bacteria 226236
403 Ga0500559_0000031 3300053136 Bacteria 114782
404 Ga0500559_0000668 3300053136 Bacteria 22938
405 Ga0500559_0002474 3300053136 Bacteria 9532
406 Ga0500559_0004363 3300053136 Bacteria 6740
407 Ga0500564_005036 3300053138 Bacteria 5363
408 Ga0500573_0000016 3300053140 Bacteria 182675
409 Ga0500604_0052938 3300053151 Bacteria 1257
410 Ga0500616_0034837 3300053153 Bacteria 2741
411 Ga0500616_0047096 3300053153 Bacteria 2290
412 Ga0500622_0003664 3300053156 Bacteria 10092
413 Ga0500622_0038553 3300053156 Bacteria 2492
414 Ga0500624_000018 3300053157 Bacteria 131677
415 Ga0500627_0000442 3300053158 Bacteria 11255
416 Ga0500627_0022815 3300053158 Bacteria 2543
417 Ga0500634_0158092 3300053161 Bacteria 1050
418 Ga0500637_0008072 3300053178 Bacteria 5289
419 Ga0500645_001900 3300053730 Bacteria 9932
420 Ga0500645_015614 3300053730 Bacteria 2404
421 Ga0500609_002319 3300053731 Bacteria 2717
422 Ga0466962_0006711 3300061719 Bacteria 5518
423 Ga0466962_0087607 3300061719 Bacteria 1491
424 Ga0466962_0130885 3300061719 Bacteria 1212
425 2511121174 2510917020 Bacteria 5657507
426 2512644268 2512564014 Bacteria 4639632
427 2585147395 2582581279 Bacteria 4980720
428 2585155316 2582581280 Bacteria 5994497
429 2585198879 2582581293 Bacteria 5907401
430 2587919278 2585428106 Bacteria 5179711
431 2600201677 2599185354 Bacteria 4398675
432 2600224887 2599185359 Bacteria 4772316
433 2643748011 2643221545 Bacteria 5083237
434 2643779119 2643221552 Bacteria 5708754
435 2643923667 2643221583 Bacteria 5218014
436 2643927684 2643221584 Bacteria 5511711
437 2644001179 2643221598 Bacteria 4578346
438 2644086125 2643221614 Bacteria 4260023
439 2644225106 2643221640 Bacteria 5258820
440 2644232414 2643221642 Bacteria 5357871
441 2644345208 2643221661 Bacteria 4267604
442 2644369482 2643221666 Bacteria 4265935
443 2644508054 2643221691 Bacteria 5093099
444 2739791768 2739367756 Bacteria 4553612
445 2753767903 2751185897 Bacteria 5322941
446 2778126990 2775507255 Bacteria 3945731
447 2792458809 2791355048 Bacteria 5832535
448 2809062646 2808606401 Bacteria 4586670
449 2809078670 2808606404 Bacteria 4652788
450 2809083035 2808606405 Bacteria 4586632
451 2819540406 2818991435 Bacteria 5433759
452 2819649534 2818991454 Bacteria 5563326
453 2830076061 2830075706 Bacteria 3855215
454 2843747039 2843744320 Bacteria 5659202
455 2848298393 2848297114 Bacteria 3608511
456 2849565447 2849560528 Bacteria 5393480
457 2849575399 2849573788 Bacteria 5421256
458 2851154838 2851153111 Bacteria 5542585
459 2857507500 2857504554 Bacteria 5369913
460 2879165674 2879163058 Bacteria 4223965
461 2880521548 2880518877 Bacteria 5012590
462 2884960812 2884960567 Bacteria 5437054
463 2885432415 2885429604 Bacteria 3642894
464 2896429586 2896429255 Bacteria 2557483
465 2898333089 2898329390 Bacteria 5168154
466 2928027491 2928027323 Bacteria 4382488
467 2928527620 2928526807 Bacteria 4760224
468 2928532970 2928531327 Bacteria 5101314
469 2941488167 2941485952 Bacteria 3591484
470 2946788639 2946787523 Bacteria 4366789
471 2984558208 2984555340 Bacteria 4247089
472 2984567413 2984564862 Bacteria 4339992
473 2993358478 2993356040 Bacteria 4247105
474 Ga0395905_0111990
475 JGI24740J21852_10010391
476 JGI24739J22299_10014357
477 JGI24737J22298_10001020
478 JGI24737J22298_10001106
479 JGI24737J22298_10039714
480 JGI24735J21928_10000344
481 JGI24735J21928_10018710
482 JGI24735J21928_10035210
483 JGI24738J21930_10000317
484 JGI24738J21930_10002550
485 JGI25150J39212_1000946
486 JGI25151J46595_10008598
487 JGI25165J46597_1000145
488 JGI25153J46596_10000036
489 JGI25153J46596_10013839
490 Ga0055542_1003517
491 Ga0055526_1006904
492 Ga0055537_1001008
493 Ga0055537_1004951
494 Ga0055537_1006445
495 Ga0055524_1000351
496 Ga0055524_1009750
497 Ga0055524_1014523
498 Ga0055536_1000580
499 Ga0055536_1001430
500 Ga0055536_1019001
501 Ga0055528_1018686
502 Ga0055530_10000017
503 Ga0055530_10000144
504 Ga0055530_10002385
505 Ga0055530_10003953
506 Ga0055540_1000701
507 Ga0055531_10000129
508 Ga0055531_10000188
509 Ga0055531_10002101
510 Ga0055531_10006456
511 Ga0055531_10011261
512 Ga0055543_1015833
513 Ga0065165_1001046
514 Ga0065165_1002946
515 Ga0065707_10004435
516 Ga0070658_10000082
517 Ga0070658_10008508
518 Ga0070658_10022356
519 Ga0070658_10312622
520 Ga0070676_10008767
521 Ga0068869_100001291
522 Ga0070666_10027492
523 Ga0068868_100003545
524 Ga0070660_100000641
525 Ga0070660_100002098
526 Ga0070668_100000923
527 Ga0070668_100001054
528 Ga0070674_100060625
529 Ga0070673_100000003
530 Ga0070667_100000024
531 Ga0070667_100010837
532 Ga0070663_100002030
533 Ga0070662_100032500
534 Ga0070662_100037789
535 Ga0068867_100000001
536 Ga0068853_100009163
537 Ga0070693_100090451
538 Ga0070665_100000767
539 Ga0068855_100000273
540 Ga0068855_100208631
541 Ga0068854_100000559
542 Ga0068854_100052860
543 Ga0068856_100029115
544 Ga0068852_100013658
545 Ga0068859_100004856
546 Ga0068866_10054116
547 Ga0068861_100000036
548 Ga0068863_100000082
549 Ga0068858_100000260
550 Ga0068860_100220937
551 Ga0068862_100006887
552 Ga0081540_1042864
553 Ga0081539_10019079
554 Ga0075368_10000225
555 Ga0075368_10000346
556 Ga0075363_100025234
557 Ga0075364_10040294
558 Ga0075362_10007630
559 Ga0075367_10001261
560 Ga0075369_10039279
561 Ga0097621_100037492
562 Ga0075370_10002969
563 Ga0075370_10008165
564 Ga0075370_10029084
565 Ga0075370_10065936
566 Ga0068865_100000306
567 Ga0097620_100004857
568 Ga0105240_10009750
569 Ga0105245_10002236
570 Ga0105243_10000042
571 Ga0105241_10009470
572 Ga0105242_10004833
573 Ga0105248_10000315
574 Ga0105248_10002271
575 Ga0105248_10044023
576 Ga0105248_10066044
577 Ga0105237_10002575
578 Ga0105237_10270715
579 Ga0105249_10183191
580 Ga0105148_100052
581 Ga0105239_10000131
582 Ga0105239_10011679
583 Ga0105246_10008547
584 Ga0157373_10130270
585 Ga0157370_10000008
586 Ga0157369_10011793
587 Ga0157369_10103977
588 Ga0157369_10285306
589 Ga0157374_10014130
590 Ga0157374_10075852
591 Ga0157378_10011556
592 Ga0157372_10027326
593 Ga0157372_10094385
594 Ga0157375_10001871
595 Ga0157380_10027469
596 Ga0157376_10000072
597 Ga0183365_10001
598 Ga0183363_1003
599 Ga0163161_10203205
600 Ga0213872_10004938
601 Ga0209674_106850
602 Ga0209147_101472
603 Ga0207427_100395
604 Ga0207425_1000037
605 Ga0209026_1001380
606 Ga0209148_1000441
607 Ga0209148_1004388
608 Ga0209129_1014866
609 Ga0209233_1000207
610 Ga0209565_1000012
611 Ga0209565_1000118
612 Ga0209565_1000314
613 Ga0209455_1000772
614 Ga0209673_1008474
615 Ga0209673_1012955
616 Ga0209675_1000089
617 Ga0209675_1002824
618 Ga0209675_1013585
619 Ga0209676_1000128
620 Ga0209676_1000151
621 Ga0209676_1000212
622 Ga0209676_1019332
623 Ga0209025_1000117
624 Ga0209564_1002594
625 Ga0209564_1004400
626 Ga0209564_1007705
627 Ga0209564_1010025
628 Ga0209758_1000103
629 Ga0209758_1002847
630 Ga0209758_1005117
631 Ga0209758_1014215
632 Ga0209050_1000001
633 Ga0209050_1000010
634 Ga0209050_1000068
635 Ga0209050_1000817
636 Ga0209050_1001306
637 Ga0209050_1005775
638 Ga0209050_1006599
639 Ga0209050_1009072
640 Ga0209256_1000012
641 Ga0209256_1004048
642 Ga0209256_1006244
643 Ga0209256_1010053
644 Ga0209051_1000296
645 Ga0209051_1001480
646 Ga0209257_1000009
647 Ga0209257_1000140
648 Ga0209257_1000193
649 Ga0209257_1002098
650 Ga0209257_1002149
651 Ga0209257_1002618
652 Ga0209257_1006971
653 Ga0209257_1007742
654 Ga0209257_1008265
655 Ga0209257_1008681
656 Ga0207680_10045798
657 Ga0207647_10000788
658 Ga0207647_10001451
659 Ga0207647_10022355
660 Ga0207647_10035726
661 Ga0207645_10000454
662 Ga0207705_10000027
663 Ga0207705_10000256
664 Ga0207705_10002705
665 Ga0207705_10191742
666 Ga0207695_10027218
667 Ga0207695_10073539
668 Ga0207671_10001065
669 Ga0207671_10161648
670 Ga0207671_10173240
671 Ga0207657_10000949
672 Ga0207657_10005009
673 Ga0207657_10078655
674 Ga0207657_10205931
675 Ga0207687_10007684
676 Ga0207690_10014878
677 Ga0207706_10014749
678 Ga0207706_10015554
679 Ga0207706_10134537
680 Ga0207706_10232695
681 Ga0207686_10004829
682 Ga0207709_10000547
683 Ga0207669_10016205
684 Ga0207704_10000001
685 Ga0207691_10021769
686 Ga0207711_10000838
687 Ga0207711_10001460
688 Ga0207711_10014888
689 Ga0207711_10044378
690 Ga0207689_10001948
691 Ga0207667_10000109
692 Ga0207651_10000002
693 Ga0207712_10108887
694 Ga0207668_10000033
695 Ga0207668_10000647
696 Ga0207640_10000202
697 Ga0207658_10000022
698 Ga0207658_10016149
699 Ga0207677_10001269
700 Ga0207703_10000113
701 Ga0207639_10006534
702 Ga0207639_10028364
703 Ga0207639_10031492
704 Ga0207678_10315774
705 Ga0207641_10000139
706 Ga0207648_10000001
707 Ga0207676_10340742
708 Ga0207675_100000154
709 Ga0207683_10258433
710 Ga0207698_10000077
711 Ga0209813_10000180
712 Ga0209813_10000872
713 Ga0268266_10001064
714 Ga0268265_10004230
715 Ga0307515_10001181
716 Ga0307515_10027226
717 Ga0307515_10036427
718 Ga0307515_10077216
719 Ga0265338_10078372
720 Ga0307413_10056680
721 Ga0395899_0000004
722 Ga0395899_0002774
723 Ga0395900_0057711
724 Ga0395905_0089031
725 Ga0436361_0211876
726 Ga0439436_0019842
727 Ga0439465_0008744
728 Ga0451806_171803
729 Ga0439431_0000643
730 Ga0439448_0007380
731 Ga0439448_0033139
732 Ga0439432_000868
733 Ga0439455_0004366
734 Ga0439455_0049004
735 Ga0439458_0000341
736 Ga0439458_0001444
737 Ga0439435_0013963
738 Ga0466969_0021314
739 Ga0466966_0011188
740 Ga0466961_0002957
741 Ga0466963_0174661
742 Ga0466971_0005983
743 Ga0466970_0053442
744 Ga0466959_0000280
745 Ga0466959_0098465
746 Ga0451576_0284798
747 Ga0466958_0008065
748 Ga0495627_000113
749 Ga0495627_001065
750 Ga0495590_0002574
751 Ga0495638_0000012
752 Ga0495638_0000892
753 Ga0495638_0001021
754 Ga0495638_0005532
755 Ga0495650_0000237
756 Ga0495650_0006604
757 Ga0495607_0057711
758 Ga0495583_0000001
759 Ga0495583_0001160
760 Ga0495606_0005233
761 Ga0495610_0000407
762 Ga0495610_0005272
763 Ga0495610_0028782
764 Ga0495616_0000109
765 Ga0495616_0000162
766 Ga0495620_0028407
767 Ga0495632_0000001
768 Ga0495632_0000773
769 Ga0495632_0008096
770 Ga0495637_0000809
771 Ga0495637_0018613
772 Ga0495643_0000006
773 Ga0495643_0052495
774 Ga0495648_0000295
775 Ga0495648_0001990
776 Ga0495648_0041808
777 Ga0495663_0000002
778 Ga0495654_0000249
779 Ga0495654_0005404
780 Ga0495609_0064419
781 Ga0495597_0047739
782 Ga0495633_0000053
783 Ga0495633_0000160
784 Ga0495633_0005525
785 Ga0495633_0019075
786 Ga0495668_0000037
787 Ga0495668_0026028
788 Ga0495625_0000143
789 Ga0495625_0007323
790 Ga0495625_0080372
791 Ga0495670_0000004
792 Ga0495671_0000008
793 Ga0495671_0000111
794 Ga0495589_0010961
795 Ga0495672_0001838
796 Ga0495679_022557
797 Ga0495673_0000013
798 Ga0495673_0000139
799 Ga0495673_0000156
800 Ga0495673_0003688
801 Ga0495681_0002650
802 Ga0495686_0000103
803 Ga0495686_0008083
804 Ga0495686_0012360
805 Ga0495686_0049988
806 Ga0495686_0213902
807 Ga0496102_0394321
808 Ga0496107_0004682
809 Ga0496111_0008505
810 Ga0496115_0003128
811 Ga0496117_0036372
812 Ga0496118_0007932
813 Ga0496118_0029840
814 Ga0496118_0038504
815 Ga0496119_0015637
816 Ga0496120_0071001
817 Ga0496121_0000272
818 Ga0496121_0003298
819 Ga0496121_0004371
820 Ga0496121_0005379
821 Ga0496121_0025027
822 Ga0496121_0063896
823 Ga0496123_0012290
824 Ga0496124_0007621
825 Ga0496124_0010185
826 Ga0496124_0126722
827 Ga0496125_0000953
828 Ga0496125_0004150
829 Ga0496125_0038735
830 Ga0496125_0216078
831 Ga0496126_0000733
832 Ga0495678_003643
833 Ga0501034_0003784
834 Ga0501034_0305381
835 Ga0501043_0257737
836 Ga0501211_003579
837 Ga0501223_000006
838 Ga0501235_000453
839 Ga0501246_000655
840 Ga0501225_0000032
841 nmdc:mga03683_1401_c1
842 nmdc:mga03n38_87624_c1
843 nmdc:mga00v17_2932_c1
844 nmdc:mga00v17_9340_c1
845 nmdc:mga0k408_110641_c1
846 nmdc:mga0k408_79126_c1
847 nmdc:mga06z11_100_c1
848 nmdc:mga04h51_11_c1
849 nmdc:mga04h51_181_c1
850 nmdc:mga07m45_15_c1
851 nmdc:mga07m45_163116_c1
852 nmdc:mga07m45_18591_c1
853 nmdc:mga07m45_29388_c1
854 nmdc:mga07m45_4041_c1
855 nmdc:mga0sz30_109_c1
856 Ga0500635_0000408
857 Ga0500578_0000023
858 Ga0500643_000098
859 Ga0500643_000110
860 Ga0500643_001047
861 Ga0500643_007636
862 Ga0500644_0000174
863 Ga0500646_0007632
864 Ga0500554_001270
865 Ga0500555_001428
866 Ga0500556_0001361
867 Ga0500592_000143
868 Ga0500594_0001447
869 Ga0500595_003892
870 Ga0500607_000065
871 Ga0500608_000276
872 Ga0500608_005116
873 Ga0500618_000305
874 Ga0500642_0148779
875 Ga0500559_0000007
876 Ga0500559_0000031
877 Ga0500559_0000668
878 Ga0500559_0002474
879 Ga0500559_0004363
880 Ga0500564_005036
881 Ga0500573_0000016
882 Ga0500604_0052938
883 Ga0500616_0034837
884 Ga0500616_0047096
885 Ga0500622_0003664
886 Ga0500622_0038553
887 Ga0500624_000018
888 Ga0500627_0000442
889 Ga0500627_0022815
890 Ga0500634_0158092
891 Ga0500637_0008072
892 Ga0500645_001900
893 Ga0500645_015614
894 Ga0500609_002319
895 Ga0466962_0006711
896 Ga0466962_0087607
897 Ga0466962_0130885
898 2511121174
899 2512644268
900 2585147395
901 2585155316
902 2585198879
903 2587919278
904 2600201677
905 2600224887
906 2643748011
907 2643779119
908 2643923667
909 2643927684
910 2644001179
911 2644086125
912 2644225106
913 2644232414
914 2644345208
915 2644369482
916 2644508054
917 2739791768
918 2753767903
919 2778126990
920 2792458809
921 2809062646
922 2809078670
923 2809083035
924 2819540406
925 2819649534
926 2830076061
927 2843747039
928 2848298393
929 2849565447
930 2849575399
931 2851154838
932 2857507500
933 2879165674
934 2880521548
935 2884960812
936 2885432415
937 2896429586
938 2898333089
939 2928027491
940 2928527620
941 2928532970
942 2941488167
943 2946788639
944 2984558208
945 2984567413
946 2993358478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14696

Glyoxalase_5

Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal

5

126

0.98

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

145

258

0.93

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

131

255

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cjx-assembly1.cif.gz_D crystal structure of pseudomonas fluorescens hppd 0.9063 7 343
7xnt-assembly1.cif.gz_G crystal structure of pfhppd-y13161 complex 0.8873 7 331
1cjx-assembly1.cif.gz_D crystal structure of pseudomonas fluorescens hppd 0.8813 7 343
2r5v-assembly1.cif.gz_A hydroxymandelate synthase crystal structure 0.8797 10 337
7xnt-assembly1.cif.gz_C crystal structure of pfhppd-y13161 complex 0.8752 7 331
ID Description Score Start End Superfamily
1cjxC02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9117 147 343 3.10.180.10
1cjxD01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9048 7 136 3.10.180.10
1cjxC02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8862 147 343 3.10.180.10
3zgjA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8746 150 336 3.10.180.10
3zgjA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8568 150 336 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A519NUF8-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9866 1 99 GO:0051213
AF-A0A528B2G0-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9702 2 78
AF-A0A4Q3APR0-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) 0.9697 2 317 GO:0003868
GO:0006572
GO:0046872
AF-A0A227J1H3-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9687 237 324 GO:0003868
GO:0006572
AF-A0A519NUF8-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9673 1 99 GO:0051213

Map