F451063
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 473 | 359 | 947 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300042015|Ga0439462_0006852|Ga0439462_0006852_867_1649 |
| Length | 260 |
| Sequence | MIGFARFTAGGAFINPLSHPKRAGQLQQARRKQRSNNMSLSSLGLLGRKVGMMRLFTDDGDAVPVTVVDVSNNRVTQVKSQDNDGYVALQVTYGSRKASRVAKPLAGHLAKAGVEAGEIIREFRVDAETAAKYQAGGQVPVQALFAAGQKVDVQGTSIGKGFTGTIKRHNFGSQRASHGNSRSHNVPGSISMAQDPGRVFPGKRMSGHLGDVTVTTQNLDIIRVDESRQLLLIKGAVPGAKNGFVTVRPAVKAPAAKGAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 21 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 167 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 172 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 193 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 194 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 196 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 199 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 200 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 201 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 204 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 205 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 206 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 207 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 208 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 209 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 210 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 211 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 212 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 215 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 216 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 253 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 254 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 273 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 274 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 275 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 276 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 277 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 280 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 281 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 289 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 290 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 291 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 292 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 294 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 295 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 296 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 297 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 298 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 299 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 307 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 308 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 309 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 310 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 311 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 312 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 313 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 314 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 315 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 316 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 317 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 318 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 319 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 320 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 321 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 322 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 323 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 324 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 325 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 326 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 327 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 328 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 329 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 330 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 331 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 332 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 333 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 334 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 335 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 336 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 337 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 338 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 339 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 340 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 341 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 342 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 343 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 344 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 345 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 346 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 347 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 348 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 349 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 350 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 351 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 352 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 353 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 354 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 355 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 356 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 357 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 358 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 359 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.11 |
| Metatranscriptomes | 12.47 |
| Isolates | 11.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.3 |
| Nodule | 0.63 |
| Rhizoplane | 2.33 |
| Rhizosphere | 65.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439462_0006852 | 3300042015 | Bacteria | 2842 |
| 2 | JGI24740J21852_10001224 | 3300001979 | Bacteria | 11607 |
| 3 | JGI24743J22301_10043949 | 3300001991 | Bacteria | 901 |
| 4 | JGI25158J39367_1013243 | 3300002739 | Bacteria | 1081 |
| 5 | JGI25152J39213_1001552 | 3300002773 | Bacteria | 9748 |
| 6 | JGI25152J39213_1006408 | 3300002773 | Bacteria | 3221 |
| 7 | JGI25150J39212_1006119 | 3300002774 | Bacteria | 2511 |
| 8 | Ga0006759J45824_1031718 | 3300003163 | Bacteria | 1084 |
| 9 | Ga0006759J45824_1038675 | 3300003163 | Bacteria | 4286 |
| 10 | JGI25153J46596_10026750 | 3300003215 | Bacteria | 2036 |
| 11 | JGI25153J46596_10028761 | 3300003215 | Bacteria | 1921 |
| 12 | Ga0006770J48903_1024177 | 3300003305 | Bacteria | 1110 |
| 13 | Ga0006777J48905_1013720 | 3300003308 | Bacteria | 1797 |
| 14 | rootH1_10034260 | 3300003316 | Bacteria | 1167 |
| 15 | rootL2_10120248 | 3300003322 | Bacteria | 3323 |
| 16 | rootL2_10156860 | 3300003322 | Bacteria | 1136 |
| 17 | rootH1_10036988 | 3300003316 | Bacteria | 3609 |
| 18 | rootH1_10036988 | 3300003323 | Bacteria | 4221 |
| 19 | JGI26128J50194_1000006 | 3300003347 | Bacteria | 6334 |
| 20 | JGI25160J50197_1020736 | 3300003354 | Bacteria | 1973 |
| 21 | Ga0007417J51691_1021404 | 3300003544 | Bacteria | 4422 |
| 22 | Ga0007410J51695_1009317 | 3300003574 | Bacteria | 4537 |
| 23 | Ga0007410J51695_1022915 | 3300003574 | Bacteria | 2695 |
| 24 | Ga0007409J51694_1022401 | 3300003575 | Bacteria | 4310 |
| 25 | Ga0007416J51690_1031853 | 3300003577 | Bacteria | 4447 |
| 26 | Ga0006562J51391_1013065 | 3300003578 | Bacteria | 1775 |
| 27 | Ga0007429J51699_1031263 | 3300003579 | Bacteria | 2173 |
| 28 | Ga0007411J51799_110034 | 3300003611 | Bacteria | 1429 |
| 29 | Ga0007415J51800_107200 | 3300003613 | Bacteria | 4345 |
| 30 | Ga0032354_1039438 | 3300003693 | Bacteria | 4274 |
| 31 | Ga0055527_1007469 | 3300003760 | Bacteria | 1333 |
| 32 | Ga0055535_1000833 | 3300003761 | Bacteria | 22124 |
| 33 | Ga0055535_1006474 | 3300003761 | Bacteria | 2362 |
| 34 | Ga0055542_1000811 | 3300003762 | Bacteria | 22966 |
| 35 | Ga0055529_1000322 | 3300003763 | Bacteria | 54232 |
| 36 | Ga0055524_1000140 | 3300003775 | Bacteria | 85990 |
| 37 | Ga0055536_1058943 | 3300003781 | Bacteria | 803 |
| 38 | Ga0055530_10009756 | 3300003791 | Bacteria | 3638 |
| 39 | Ga0055530_10014360 | 3300003791 | Bacteria | 2643 |
| 40 | Ga0055530_10024350 | 3300003791 | Bacteria | 1718 |
| 41 | Ga0055540_1003990 | 3300003792 | Bacteria | 6874 |
| 42 | Ga0055531_10004806 | 3300003794 | Bacteria | 8068 |
| 43 | Ga0055531_10014967 | 3300003794 | Bacteria | 3455 |
| 44 | Ga0055543_1003188 | 3300004625 | Bacteria | 4998 |
| 45 | Ga0058858_1018080 | 3300004785 | Bacteria | 2450 |
| 46 | Ga0065165_1026365 | 3300005262 | Bacteria | 1913 |
| 47 | Ga0065165_1088025 | 3300005262 | Bacteria | 795 |
| 48 | Ga0070676_10002282 | 3300005328 | Bacteria | 9791 |
| 49 | Ga0070676_10030854 | 3300005328 | Bacteria | 3059 |
| 50 | Ga0070676_10052429 | 3300005328 | Bacteria | 2398 |
| 51 | Ga0070683_100283216 | 3300005329 | Bacteria | 1577 |
| 52 | Ga0070690_100249172 | 3300005330 | Bacteria | 1256 |
| 53 | Ga0070677_10035203 | 3300005333 | Bacteria | 1940 |
| 54 | Ga0070682_100110807 | 3300005337 | Bacteria | 1829 |
| 55 | Ga0070687_100181887 | 3300005343 | Bacteria | 1260 |
| 56 | Ga0070661_100049810 | 3300005344 | Bacteria | 3066 |
| 57 | Ga0070668_100250397 | 3300005347 | Bacteria | 1470 |
| 58 | Ga0070669_100020298 | 3300005353 | Bacteria | 4745 |
| 59 | Ga0070669_100026052 | 3300005353 | Bacteria | 4206 |
| 60 | Ga0070675_100103048 | 3300005354 | Bacteria | 2405 |
| 61 | Ga0070675_100150753 | 3300005354 | Bacteria | 1993 |
| 62 | Ga0070675_100413519 | 3300005354 | Bacteria | 1205 |
| 63 | Ga0070674_100075338 | 3300005356 | Bacteria | 2396 |
| 64 | Ga0070674_100152064 | 3300005356 | Bacteria | 1747 |
| 65 | Ga0070673_100218197 | 3300005364 | Bacteria | 1650 |
| 66 | Ga0070673_100225614 | 3300005364 | Bacteria | 1623 |
| 67 | Ga0070705_100025070 | 3300005440 | Bacteria | 3228 |
| 68 | Ga0070700_100545394 | 3300005441 | Bacteria | 900 |
| 69 | Ga0070694_100007904 | 3300005444 | Bacteria | 6493 |
| 70 | Ga0070663_100003492 | 3300005455 | Bacteria | 9070 |
| 71 | Ga0070663_100399833 | 3300005455 | Bacteria | 1123 |
| 72 | Ga0070678_100147019 | 3300005456 | Bacteria | 1893 |
| 73 | Ga0070678_100253493 | 3300005456 | Bacteria | 1476 |
| 74 | Ga0070662_100328007 | 3300005457 | Bacteria | 1250 |
| 75 | Ga0070681_10001245 | 3300005458 | Bacteria | 22156 |
| 76 | Ga0068867_100000552 | 3300005459 | Bacteria | 24723 |
| 77 | Ga0068867_100318561 | 3300005459 | Bacteria | 1288 |
| 78 | Ga0068867_100532752 | 3300005459 | Bacteria | 1014 |
| 79 | Ga0070706_100274369 | 3300005467 | Bacteria | 1573 |
| 80 | Ga0070699_100242433 | 3300005518 | Bacteria | 1609 |
| 81 | Ga0070679_100105941 | 3300005530 | Bacteria | 2797 |
| 82 | Ga0070684_100035127 | 3300005535 | Bacteria | 4289 |
| 83 | Ga0070672_100105406 | 3300005543 | Bacteria | 2292 |
| 84 | Ga0070672_100265443 | 3300005543 | Bacteria | 1448 |
| 85 | Ga0070686_100105179 | 3300005544 | Bacteria | 1913 |
| 86 | Ga0070695_100001266 | 3300005545 | Bacteria | 13913 |
| 87 | Ga0070696_100183473 | 3300005546 | Bacteria | 1553 |
| 88 | Ga0070704_100046248 | 3300005549 | Bacteria | 3034 |
| 89 | Ga0068855_100079296 | 3300005563 | Bacteria | 3808 |
| 90 | Ga0070664_100062281 | 3300005564 | Bacteria | 3180 |
| 91 | Ga0068857_100563020 | 3300005577 | Bacteria | 1075 |
| 92 | Ga0068852_100290433 | 3300005616 | Bacteria | 1579 |
| 93 | Ga0068851_10015881 | 3300005834 | Bacteria | 3593 |
| 94 | Ga0081539_10046061 | 3300005985 | Bacteria | 2502 |
| 95 | Ga0075362_10107530 | 3300006177 | Bacteria | 1310 |
| 96 | Ga0075366_10029148 | 3300006195 | Bacteria | 3242 |
| 97 | Ga0075366_10042881 | 3300006195 | Bacteria | 2679 |
| 98 | Ga0075366_10060215 | 3300006195 | Bacteria | 2255 |
| 99 | Ga0075366_10350844 | 3300006195 | Bacteria | 905 |
| 100 | Ga0097621_100001348 | 3300006237 | Bacteria | 16895 |
| 101 | Ga0097621_100131954 | 3300006237 | Bacteria | 2127 |
| 102 | Ga0075370_10025794 | 3300006353 | Bacteria | 3252 |
| 103 | Ga0068871_100280954 | 3300006358 | Bacteria | 1456 |
| 104 | Ga0075430_100159725 | 3300006846 | Bacteria | 1876 |
| 105 | Ga0075433_10035840 | 3300006852 | Bacteria | 4270 |
| 106 | Ga0075434_100000895 | 3300006871 | Bacteria | 23884 |
| 107 | Ga0075434_100132977 | 3300006871 | Bacteria | 2507 |
| 108 | Ga0075436_100002331 | 3300006914 | Bacteria | 13096 |
| 109 | Ga0075436_100056181 | 3300006914 | Bacteria | 2719 |
| 110 | Ga0075436_100057078 | 3300006914 | Bacteria | 2696 |
| 111 | Ga0079104_1000053 | 3300006946 | Bacteria | 168604 |
| 112 | Ga0075435_100020698 | 3300007076 | Bacteria | 5048 |
| 113 | Ga0075435_100171874 | 3300007076 | Bacteria | 1828 |
| 114 | Ga0105240_10806284 | 3300009093 | Bacteria | 1017 |
| 115 | Ga0105247_10445598 | 3300009101 | Bacteria | 932 |
| 116 | Ga0105243_10001789 | 3300009148 | Bacteria | 18454 |
| 117 | Ga0105243_10378834 | 3300009148 | Bacteria | 1308 |
| 118 | Ga0105248_11445766 | 3300009177 | Bacteria | 778 |
| 119 | Ga0157339_1001211 | 3300012505 | Bacteria | 1529 |
| 120 | Ga0163162_10790770 | 3300013306 | Bacteria | 1066 |
| 121 | Ga0157375_10200738 | 3300013308 | Bacteria | 2150 |
| 122 | Ga0157375_10238393 | 3300013308 | Bacteria | 1978 |
| 123 | Ga0157380_10224761 | 3300014326 | Bacteria | 1682 |
| 124 | Ga0157380_10686365 | 3300014326 | Bacteria | 1027 |
| 125 | Ga0182008_10157982 | 3300014497 | Bacteria | 1140 |
| 126 | Ga0157376_10414606 | 3300014969 | Bacteria | 1305 |
| 127 | Ga0157376_10620812 | 3300014969 | Bacteria | 1078 |
| 128 | Ga0182007_10107409 | 3300015262 | Bacteria | 927 |
| 129 | Ga0163161_10150402 | 3300017792 | Bacteria | 1769 |
| 130 | Ga0206356_10269682 | 3300020070 | Bacteria | 1010 |
| 131 | Ga0206354_10007622 | 3300020081 | Bacteria | 932 |
| 132 | Ga0209672_101179 | 3300025228 | Bacteria | 10647 |
| 133 | Ga0209672_103368 | 3300025228 | Bacteria | 3335 |
| 134 | Ga0209147_101231 | 3300025229 | Bacteria | 10201 |
| 135 | Ga0209258_100696 | 3300025242 | Bacteria | 23018 |
| 136 | Ga0209258_101359 | 3300025242 | Bacteria | 8893 |
| 137 | Ga0207425_1000501 | 3300025245 | Bacteria | 24428 |
| 138 | Ga0207425_1000562 | 3300025245 | Bacteria | 21887 |
| 139 | Ga0209148_1000122 | 3300025254 | Bacteria | 186071 |
| 140 | Ga0209129_1000269 | 3300025258 | Bacteria | 51170 |
| 141 | Ga0209129_1003034 | 3300025258 | Bacteria | 7616 |
| 142 | Ga0209129_1030067 | 3300025258 | Bacteria | 911 |
| 143 | Ga0209565_1004855 | 3300025263 | Bacteria | 4015 |
| 144 | Ga0209565_1024068 | 3300025263 | Bacteria | 1243 |
| 145 | Ga0209455_1000083 | 3300025272 | Bacteria | 255660 |
| 146 | Ga0209673_1000690 | 3300025273 | Bacteria | 48324 |
| 147 | Ga0209673_1008953 | 3300025273 | Bacteria | 4398 |
| 148 | Ga0209673_1013951 | 3300025273 | Bacteria | 3138 |
| 149 | Ga0209130_1008830 | 3300025284 | Bacteria | 2933 |
| 150 | Ga0209675_1007426 | 3300025291 | Bacteria | 4204 |
| 151 | Ga0209675_1017483 | 3300025291 | Bacteria | 2046 |
| 152 | Ga0209676_1004912 | 3300025292 | Bacteria | 7197 |
| 153 | Ga0209676_1007067 | 3300025292 | Bacteria | 5379 |
| 154 | Ga0209025_1019023 | 3300025294 | Bacteria | 3844 |
| 155 | Ga0209025_1022034 | 3300025294 | Bacteria | 3400 |
| 156 | Ga0209025_1044999 | 3300025294 | Bacteria | 1836 |
| 157 | Ga0209564_1000300 | 3300025295 | Bacteria | 98386 |
| 158 | Ga0209564_1011819 | 3300025295 | Bacteria | 3873 |
| 159 | Ga0209564_1012459 | 3300025295 | Bacteria | 3707 |
| 160 | Ga0209758_1006854 | 3300025297 | Bacteria | 7968 |
| 161 | Ga0209758_1029420 | 3300025297 | Bacteria | 2298 |
| 162 | Ga0209758_1029560 | 3300025297 | Bacteria | 2288 |
| 163 | Ga0209050_1000224 | 3300025298 | Bacteria | 125433 |
| 164 | Ga0209050_1001097 | 3300025298 | Bacteria | 32856 |
| 165 | Ga0209256_1000045 | 3300025299 | Bacteria | 325506 |
| 166 | Ga0209256_1010481 | 3300025299 | Bacteria | 3873 |
| 167 | Ga0209256_1010684 | 3300025299 | Bacteria | 3801 |
| 168 | Ga0207426_1009492 | 3300025302 | Bacteria | 3846 |
| 169 | Ga0207426_1009647 | 3300025302 | Bacteria | 3801 |
| 170 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 171 | Ga0209051_1000313 | 3300025303 | Bacteria | 75138 |
| 172 | Ga0209051_1008297 | 3300025303 | Bacteria | 5516 |
| 173 | Ga0209051_1011804 | 3300025303 | Bacteria | 4278 |
| 174 | Ga0209257_1000315 | 3300025304 | Bacteria | 102293 |
| 175 | Ga0209257_1010185 | 3300025304 | Bacteria | 4827 |
| 176 | Ga0209257_1028216 | 3300025304 | Bacteria | 1851 |
| 177 | Ga0207656_10087178 | 3300025321 | Bacteria | 1412 |
| 178 | Ga0207645_10125857 | 3300025907 | Bacteria | 1666 |
| 179 | Ga0207684_10009766 | 3300025910 | Bacteria | 8465 |
| 180 | Ga0207707_10041835 | 3300025912 | Bacteria | 4001 |
| 181 | Ga0207671_10205096 | 3300025914 | Bacteria | 1541 |
| 182 | Ga0207660_10298298 | 3300025917 | Bacteria | 1283 |
| 183 | Ga0207662_10216238 | 3300025918 | Bacteria | 1246 |
| 184 | Ga0207657_10389350 | 3300025919 | Bacteria | 1097 |
| 185 | Ga0207649_10009290 | 3300025920 | Bacteria | 5379 |
| 186 | Ga0207652_10314673 | 3300025921 | Bacteria | 1413 |
| 187 | Ga0207652_10351125 | 3300025921 | Bacteria | 1331 |
| 188 | Ga0207681_10212303 | 3300025923 | Bacteria | 1492 |
| 189 | Ga0207694_10368402 | 3300025924 | Bacteria | 1191 |
| 190 | Ga0207659_10182486 | 3300025926 | Bacteria | 1664 |
| 191 | Ga0207687_10427533 | 3300025927 | Bacteria | 1094 |
| 192 | Ga0207690_10090774 | 3300025932 | Bacteria | 2157 |
| 193 | Ga0207706_10134853 | 3300025933 | Bacteria | 2172 |
| 194 | Ga0207686_10669791 | 3300025934 | Bacteria | 822 |
| 195 | Ga0207709_10001005 | 3300025935 | Bacteria | 20902 |
| 196 | Ga0207709_10435065 | 3300025935 | Bacteria | 1010 |
| 197 | Ga0207691_10041144 | 3300025940 | Bacteria | 4268 |
| 198 | Ga0207691_10133738 | 3300025940 | Bacteria | 2189 |
| 199 | Ga0207691_10286094 | 3300025940 | Bacteria | 1418 |
| 200 | Ga0207689_10429496 | 3300025942 | Bacteria | 1103 |
| 201 | Ga0207679_10029503 | 3300025945 | Bacteria | 3820 |
| 202 | Ga0207679_10145633 | 3300025945 | Bacteria | 1921 |
| 203 | Ga0207667_10062375 | 3300025949 | Bacteria | 3897 |
| 204 | Ga0207651_10689140 | 3300025960 | Bacteria | 899 |
| 205 | Ga0207712_10711273 | 3300025961 | Bacteria | 877 |
| 206 | Ga0207668_10074143 | 3300025972 | Bacteria | 2442 |
| 207 | Ga0207668_10092589 | 3300025972 | Bacteria | 2225 |
| 208 | Ga0207658_10019075 | 3300025986 | Bacteria | 4744 |
| 209 | Ga0207658_10559180 | 3300025986 | Bacteria | 1024 |
| 210 | Ga0207703_10448855 | 3300026035 | Bacteria | 1204 |
| 211 | Ga0207639_10026764 | 3300026041 | Bacteria | 4193 |
| 212 | Ga0207678_10475078 | 3300026067 | Bacteria | 1088 |
| 213 | Ga0207648_10002176 | 3300026089 | Bacteria | 21281 |
| 214 | Ga0207648_10149138 | 3300026089 | Bacteria | 2063 |
| 215 | Ga0207648_10285285 | 3300026089 | Bacteria | 1477 |
| 216 | Ga0207674_10597833 | 3300026116 | Bacteria | 1066 |
| 217 | Ga0207675_100021254 | 3300026118 | Bacteria | 6044 |
| 218 | Ga0207683_10161174 | 3300026121 | Bacteria | 2028 |
| 219 | Ga0207698_10086124 | 3300026142 | Bacteria | 2554 |
| 220 | Ga0209281_1000147 | 3300027111 | Bacteria | 168586 |
| 221 | Ga0209973_1008804 | 3300027252 | Bacteria | 1161 |
| 222 | Ga0209969_1011948 | 3300027360 | Bacteria | 1250 |
| 223 | Ga0209981_1016649 | 3300027378 | Bacteria | 1034 |
| 224 | Ga0209996_1000331 | 3300027395 | Bacteria | 5870 |
| 225 | Ga0209984_1001403 | 3300027424 | Bacteria | 2608 |
| 226 | Ga0209995_1001236 | 3300027471 | Bacteria | 3933 |
| 227 | Ga0209995_1031390 | 3300027471 | Bacteria | 890 |
| 228 | Ga0209968_1019826 | 3300027526 | Bacteria | 1084 |
| 229 | Ga0209999_1003422 | 3300027543 | Bacteria | 2834 |
| 230 | Ga0209971_1008102 | 3300027682 | Bacteria | 2494 |
| 231 | Ga0209971_1071942 | 3300027682 | Bacteria | 840 |
| 232 | Ga0209966_1000117 | 3300027695 | Bacteria | 35145 |
| 233 | Ga0209998_10010535 | 3300027717 | Bacteria | 1914 |
| 234 | Ga0209974_10008712 | 3300027876 | Bacteria | 3457 |
| 235 | Ga0268266_10508976 | 3300028379 | Bacteria | 1150 |
| 236 | Ga0265336_10000618 | 3300028666 | Bacteria | 19547 |
| 237 | Ga0307515_10127712 | 3300028794 | Bacteria | 2826 |
| 238 | Ga0307515_10217902 | 3300028794 | Bacteria | 1735 |
| 239 | Ga0265324_10057894 | 3300029957 | Bacteria | 1326 |
| 240 | Ga0265330_10000464 | 3300031235 | Bacteria | 27117 |
| 241 | Ga0265330_10004608 | 3300031235 | Bacteria | 6970 |
| 242 | Ga0265332_10000018 | 3300031238 | Bacteria | 224913 |
| 243 | Ga0265332_10001783 | 3300031238 | Bacteria | 11615 |
| 244 | Ga0265328_10047331 | 3300031239 | Bacteria | 1581 |
| 245 | Ga0265325_10002138 | 3300031241 | Bacteria | 13479 |
| 246 | Ga0265329_10002128 | 3300031242 | Bacteria | 9177 |
| 247 | Ga0265340_10075932 | 3300031247 | Bacteria | 1587 |
| 248 | Ga0265331_10000635 | 3300031250 | Bacteria | 30467 |
| 249 | Ga0265327_10009087 | 3300031251 | Bacteria | 7252 |
| 250 | Ga0265327_10010616 | 3300031251 | Bacteria | 6447 |
| 251 | Ga0265327_10021833 | 3300031251 | Bacteria | 3850 |
| 252 | Ga0265327_10023957 | 3300031251 | Bacteria | 3598 |
| 253 | Ga0265316_10224059 | 3300031344 | Bacteria | 1386 |
| 254 | Ga0307513_10120005 | 3300031456 | Bacteria | 2599 |
| 255 | Ga0307408_100691981 | 3300031548 | Bacteria | 915 |
| 256 | Ga0307514_10017304 | 3300031649 | Bacteria | 5933 |
| 257 | Ga0265314_10001491 | 3300031711 | Bacteria | 25976 |
| 258 | Ga0265314_10121847 | 3300031711 | Bacteria | 1640 |
| 259 | Ga0265342_10013924 | 3300031712 | Bacteria | 5364 |
| 260 | Ga0307516_10020587 | 3300031730 | Bacteria | 6812 |
| 261 | Ga0307516_10065214 | 3300031730 | Bacteria | 3518 |
| 262 | Ga0307405_10385157 | 3300031731 | Bacteria | 1093 |
| 263 | Ga0307412_10092220 | 3300031911 | Bacteria | 2122 |
| 264 | Ga0373958_0006443 | 3300034819 | Bacteria | 1830 |
| 265 | Ga0373936_0102927 | 3300035113 | Bacteria | 1206 |
| 266 | Ga0373961_0003749 | 3300035241 | Bacteria | 3717 |
| 267 | Ga0373961_0121031 | 3300035241 | Bacteria | 867 |
| 268 | Ga0373931_0001921 | 3300035691 | Bacteria | 9104 |
| 269 | Ga0373931_0061298 | 3300035691 | Bacteria | 2028 |
| 270 | Ga0395899_0410943 | 3300037312 | Bacteria | 894 |
| 271 | Ga0395905_0366037 | 3300037471 | Bacteria | 1335 |
| 272 | Ga0395905_0394995 | 3300037471 | Bacteria | 1277 |
| 273 | Ga0395901_0144460 | 3300038443 | Bacteria | 2501 |
| 274 | Ga0436361_0771676 | 3300039447 | Bacteria | 1677 |
| 275 | Ga0436361_0791336 | 3300039447 | Bacteria | 1134 |
| 276 | Ga0439466_0040946 | 3300041411 | Bacteria | 1548 |
| 277 | Ga0451797_0414767 | 3300041453 | Bacteria | 734 |
| 278 | Ga0451833_1140249 | 3300041491 | Bacteria | 955 |
| 279 | Ga0451841_0465717 | 3300041498 | Bacteria | 1948 |
| 280 | Ga0451853_2157359 | 3300041512 | Bacteria | 1112 |
| 281 | Ga0452268_33226 | 3300041907 | Bacteria | 707 |
| 282 | Ga0439431_0001654 | 3300041997 | Bacteria | 4929 |
| 283 | Ga0439445_0016088 | 3300042004 | Bacteria | 1837 |
| 284 | Ga0439432_118635 | 3300042006 | Bacteria | 784 |
| 285 | Ga0439449_0016996 | 3300042007 | Bacteria | 2731 |
| 286 | Ga0450919_002341 | 3300042121 | Bacteria | 2455 |
| 287 | Ga0450888_021693 | 3300042126 | Bacteria | 821 |
| 288 | Ga0450890_011788 | 3300042127 | Bacteria | 1131 |
| 289 | Ga0450896_033533 | 3300042133 | Bacteria | 783 |
| 290 | Ga0450898_018202 | 3300042134 | Bacteria | 1215 |
| 291 | Ga0450889_020227 | 3300042144 | Bacteria | 736 |
| 292 | Ga0439446_0111632 | 3300042156 | Bacteria | 873 |
| 293 | Ga0439458_0044629 | 3300042157 | Bacteria | 1083 |
| 294 | Ga0439434_0014600 | 3300042435 | Bacteria | 2337 |
| 295 | Ga0439434_0054453 | 3300042435 | Bacteria | 1244 |
| 296 | Ga0450918_000123 | 3300042531 | Bacteria | 16624 |
| 297 | Ga0451577_0004088 | 3300042876 | Bacteria | 15682 |
| 298 | Ga0453683_0003443 | 3300044673 | Bacteria | 11656 |
| 299 | Ga0453683_0094065 | 3300044673 | Bacteria | 1880 |
| 300 | Ga0453684_0074718 | 3300044712 | Bacteria | 4265 |
| 301 | Ga0466968_0016214 | 3300044735 | Bacteria | 2964 |
| 302 | Ga0451576_0000909 | 3300045051 | Bacteria | 56035 |
| 303 | Ga0451576_0049923 | 3300045051 | Bacteria | 4390 |
| 304 | Ga0451576_0052030 | 3300045051 | Bacteria | 4292 |
| 305 | Ga0495627_008591 | 3300046453 | Bacteria | 3813 |
| 306 | Ga0495638_0218040 | 3300046460 | Bacteria | 1068 |
| 307 | Ga0495651_0331710 | 3300046462 | Bacteria | 1011 |
| 308 | Ga0495650_0016911 | 3300046471 | Bacteria | 3672 |
| 309 | Ga0495639_0012489 | 3300046475 | Bacteria | 3663 |
| 310 | Ga0495610_0070310 | 3300046512 | Bacteria | 1635 |
| 311 | Ga0495616_0006407 | 3300046513 | Bacteria | 7120 |
| 312 | Ga0495631_0009961 | 3300046518 | Bacteria | 4725 |
| 313 | Ga0495632_0216148 | 3300046519 | Bacteria | 868 |
| 314 | Ga0495587_0371677 | 3300046536 | Bacteria | 796 |
| 315 | Ga0495609_0182216 | 3300046538 | Bacteria | 884 |
| 316 | Ga0495621_0017782 | 3300046539 | Bacteria | 2302 |
| 317 | Ga0495621_0188722 | 3300046539 | Bacteria | 825 |
| 318 | Ga0495625_0151499 | 3300046660 | Bacteria | 1558 |
| 319 | Ga0495588_0026324 | 3300046674 | Bacteria | 2903 |
| 320 | Ga0495658_0068289 | 3300046683 | Bacteria | 2058 |
| 321 | Ga0495660_0055681 | 3300046810 | Bacteria | 2140 |
| 322 | Ga0495676_0035104 | 3300047321 | Bacteria | 4197 |
| 323 | Ga0496101_0074792 | 3300048904 | Bacteria | 2492 |
| 324 | Ga0496102_0004235 | 3300048905 | Bacteria | 12129 |
| 325 | Ga0496103_0022709 | 3300048906 | Bacteria | 3778 |
| 326 | Ga0496104_0003354 | 3300048907 | Bacteria | 13832 |
| 327 | Ga0496108_0107610 | 3300048911 | Bacteria | 2381 |
| 328 | Ga0496111_0102270 | 3300048914 | Bacteria | 2106 |
| 329 | Ga0496114_0047986 | 3300048917 | Bacteria | 3551 |
| 330 | Ga0496116_0076380 | 3300048919 | Bacteria | 2098 |
| 331 | Ga0496124_0027342 | 3300048927 | Bacteria | 5121 |
| 332 | Ga0496124_0420871 | 3300048927 | Bacteria | 920 |
| 333 | Ga0496124_0504887 | 3300048927 | Bacteria | 810 |
| 334 | Ga0496125_0042934 | 3300048928 | Bacteria | 3844 |
| 335 | Ga0501306_004860 | 3300049127 | Bacteria | 1519 |
| 336 | Ga0501306_008244 | 3300049127 | Bacteria | 1267 |
| 337 | Ga0501308_003803 | 3300049128 | Bacteria | 1421 |
| 338 | Ga0501308_006728 | 3300049128 | Bacteria | 1186 |
| 339 | Ga0501309_023468 | 3300049129 | Bacteria | 877 |
| 340 | Ga0501310_026846 | 3300049130 | Bacteria | 748 |
| 341 | Ga0501304_001350 | 3300049160 | Bacteria | 1557 |
| 342 | Ga0501305_004654 | 3300049161 | Bacteria | 1624 |
| 343 | Ga0501305_005663 | 3300049161 | Bacteria | 1524 |
| 344 | Ga0501307_021344 | 3300049162 | Bacteria | 844 |
| 345 | Ga0501292_003303 | 3300049515 | Bacteria | 2148 |
| 346 | Ga0501298_035454 | 3300049521 | Bacteria | 996 |
| 347 | Ga0501311_010004 | 3300049527 | Bacteria | 1144 |
| 348 | Ga0501312_002796 | 3300049528 | Bacteria | 1918 |
| 349 | Ga0501312_014826 | 3300049528 | Bacteria | 1100 |
| 350 | Ga0501312_037297 | 3300049528 | Bacteria | 783 |
| 351 | Ga0501313_003567 | 3300049529 | Bacteria | 1555 |
| 352 | Ga0501316_021927 | 3300049532 | Bacteria | 810 |
| 353 | Ga0501317_001907 | 3300049533 | Bacteria | 1890 |
| 354 | Ga0501317_049908 | 3300049533 | Bacteria | 662 |
| 355 | Ga0501318_005102 | 3300049534 | Bacteria | 1288 |
| 356 | Ga0501319_000100 | 3300049535 | Bacteria | 3013 |
| 357 | Ga0501319_001480 | 3300049535 | Bacteria | 1366 |
| 358 | Ga0501320_000117 | 3300049536 | Bacteria | 3648 |
| 359 | Ga0501320_001756 | 3300049536 | Bacteria | 1639 |
| 360 | Ga0501320_006516 | 3300049536 | Bacteria | 1097 |
| 361 | Ga0501320_007924 | 3300049536 | Bacteria | 1034 |
| 362 | Ga0501323_000907 | 3300049539 | Bacteria | 2421 |
| 363 | Ga0501323_009216 | 3300049539 | Bacteria | 1160 |
| 364 | Ga0501325_001184 | 3300049541 | Bacteria | 1541 |
| 365 | Ga0501329_02168 | 3300049545 | Bacteria | 926 |
| 366 | Ga0501334_02520 | 3300049550 | Bacteria | 1092 |
| 367 | Ga0501335_003844 | 3300049551 | Bacteria | 1290 |
| 368 | Ga0501337_000224 | 3300049553 | Bacteria | 2505 |
| 369 | Ga0501034_0215137 | 3300049571 | Bacteria | 1876 |
| 370 | Ga0501037_0388073 | 3300049573 | Bacteria | 959 |
| 371 | Ga0501039_0480871 | 3300049575 | Bacteria | 975 |
| 372 | Ga0501198_000043 | 3300049649 | Bacteria | 44170 |
| 373 | Ga0501206_019380 | 3300049653 | Bacteria | 962 |
| 374 | Ga0501222_000051 | 3300049662 | Bacteria | 43800 |
| 375 | Ga0501253_005661 | 3300049683 | Bacteria | 1652 |
| 376 | Ga0501265_002364 | 3300049762 | Bacteria | 2141 |
| 377 | Ga0501266_031103 | 3300049763 | Bacteria | 762 |
| 378 | Ga0501280_001594 | 3300049776 | Bacteria | 4074 |
| 379 | Ga0501044_0652370 | 3300049823 | Bacteria | 941 |
| 380 | nmdc:mga03683_117953_c1 | 3300050489 | Bacteria | 1178 |
| 381 | nmdc:mga0k408_1021_c1 | 3300050493 | Bacteria | 15347 |
| 382 | nmdc:mga0k408_179204_c1 | 3300050493 | Bacteria | 1264 |
| 383 | nmdc:mga0k408_223236_c1 | 3300050493 | Bacteria | 1125 |
| 384 | nmdc:mga0k408_435442_c1 | 3300050493 | Bacteria | 779 |
| 385 | nmdc:mga0k408_60623_c1 | 3300050493 | Bacteria | 2199 |
| 386 | nmdc:mga06z11_347050_c1 | 3300050494 | Bacteria | 888 |
| 387 | nmdc:mga06z11_68404_c1 | 3300050494 | Bacteria | 1872 |
| 388 | nmdc:mga07m45_200893_c1 | 3300050496 | Bacteria | 1160 |
| 389 | nmdc:mga07m45_65556_c1 | 3300050496 | Bacteria | 1759 |
| 390 | nmdc:mga07m45_74067_c1 | 3300050496 | Bacteria | 1940 |
| 391 | nmdc:mga0qj67_225567_c1 | 3300050509 | Bacteria | 1521 |
| 392 | nmdc:mga0n895_570_c1 | 3300050512 | Bacteria | 25297 |
| 393 | nmdc:mga0rr50_450116_c1 | 3300050513 | Bacteria | 1092 |
| 394 | nmdc:mga0rr50_549647_c1 | 3300050513 | Bacteria | 983 |
| 395 | nmdc:mga0rr50_7779_c1 | 3300050513 | Bacteria | 6642 |
| 396 | nmdc:mga08x19_15557_c1 | 3300050514 | Bacteria | 4630 |
| 397 | nmdc:mga08x19_16375_c1 | 3300050514 | Bacteria | 4522 |
| 398 | nmdc:mga08x19_333175_c1 | 3300050514 | Bacteria | 1058 |
| 399 | nmdc:mga0a205_16068_c1 | 3300050515 | Bacteria | 7006 |
| 400 | Ga0500651_0000076 | 3300053093 | Bacteria | 63637 |
| 401 | Ga0500593_020089 | 3300053117 | Bacteria | 2927 |
| 402 | Ga0500608_014714 | 3300053122 | Bacteria | 3499 |
| 403 | Ga0500655_001275 | 3300053133 | Bacteria | 4783 |
| 404 | Ga0500658_0000913 | 3300053134 | Bacteria | 12085 |
| 405 | Ga0500658_0010142 | 3300053134 | Bacteria | 3472 |
| 406 | Ga0500559_0011421 | 3300053136 | Bacteria | 3792 |
| 407 | Ga0500574_000502 | 3300053141 | Bacteria | 4999 |
| 408 | Ga0500616_0038297 | 3300053153 | Bacteria | 2590 |
| 409 | Ga0500619_000012 | 3300053154 | Bacteria | 57280 |
| 410 | Ga0590071_051845 | 3300059421 | Bacteria | 996 |
| 411 | Ga0590077_017282 | 3300059426 | Bacteria | 1516 |
| 412 | Ga0587084_004600 | 3300059477 | Bacteria | 1587 |
| 413 | Ga0587084_005015 | 3300059477 | Bacteria | 1546 |
| 414 | Ga0587093_000110 | 3300059478 | Bacteria | 3983 |
| 415 | Ga0587093_020661 | 3300059478 | Bacteria | 878 |
| 416 | Ga0587088_018506 | 3300059508 | Bacteria | 1135 |
| 417 | Ga0587092_008739 | 3300059512 | Bacteria | 1344 |
| 418 | Ga0587101_010054 | 3300059623 | Bacteria | 1181 |
| 419 | Ga0587062_027529 | 3300059639 | Bacteria | 850 |
| 420 | Ga0587100_000209 | 3300059648 | Bacteria | 2478 |
| 421 | 2513231523 | 2513020051 | Bacteria | 6053213 |
| 422 | 2548501868 | 2547132374 | Bacteria | 5530232 |
| 423 | 2599626684 | 2599185214 | Bacteria | 8209958 |
| 424 | 2599675930 | 2599185226 | Bacteria | 8233575 |
| 425 | 2599684221 | 2599185227 | Bacteria | 8246414 |
| 426 | 2599696235 | 2599185229 | Bacteria | 8216126 |
| 427 | 2643865334 | 2643221570 | Bacteria | 5103772 |
| 428 | 2643992264 | 2643221596 | Bacteria | 5006805 |
| 429 | 2644060998 | 2643221609 | Bacteria | 6756331 |
| 430 | 2644071694 | 2643221611 | Bacteria | 6820941 |
| 431 | 2644218767 | 2643221639 | Bacteria | 6649903 |
| 432 | 2644247765 | 2643221644 | Bacteria | 6865017 |
| 433 | 2644256854 | 2643221646 | Bacteria | 6433402 |
| 434 | 2644292744 | 2643221652 | Bacteria | 5140275 |
| 435 | 2644325935 | 2643221658 | Bacteria | 6064537 |
| 436 | 2644397450 | 2643221672 | Bacteria | 6322190 |
| 437 | 2644466326 | 2643221683 | Bacteria | 5749203 |
| 438 | 2644647239 | 2643221717 | Bacteria | 5676132 |
| 439 | 2738723299 | 2738541277 | Bacteria | 7458140 |
| 440 | 2738885623 | 2738541307 | Bacteria | 8606193 |
| 441 | 2739247150 | 2738543012 | Bacteria | 7115078 |
| 442 | 2739284030 | 2738543019 | Bacteria | 7459457 |
| 443 | 2792837043 | 2791355137 | Bacteria | 9654227 |
| 444 | 2816476201 | 2816332133 | Bacteria | 7249298 |
| 445 | 2819601758 | 2818991446 | Bacteria | 7757362 |
| 446 | 2831268496 | 2831265667 | Bacteria | 7184833 |
| 447 | 2838061087 | 2838054893 | Bacteria | 7451788 |
| 448 | 2842680703 | 2842677519 | Bacteria | 5615038 |
| 449 | 2842737718 | 2842733646 | Bacteria | 5716726 |
| 450 | 2842752903 | 2842747753 | Bacteria | 5578255 |
| 451 | 2857578645 | 2857576091 | Bacteria | 5465855 |
| 452 | 2881102070 | 2881101125 | Bacteria | 4590519 |
| 453 | 2885200382 | 2885198086 | Bacteria | 7212419 |
| 454 | 2885214035 | 2885211737 | Bacteria | 7212420 |
| 455 | 2886854518 | 2886848708 | Bacteria | 5632523 |
| 456 | 2899928003 | 2899924645 | Bacteria | 7487985 |
| 457 | 2904453057 | 2904449895 | Bacteria | 6927402 |
| 458 | 2904459905 | 2904456579 | Bacteria | 6819253 |
| 459 | 2919463359 | 2919462493 | Bacteria | 5817112 |
| 460 | 2928039938 | 2928037797 | Bacteria | 7273642 |
| 461 | 2928047313 | 2928044640 | Bacteria | 7271509 |
| 462 | 2928057483 | 2928051484 | Bacteria | 7773759 |
| 463 | 2928068131 | 2928064002 | Bacteria | 7419480 |
| 464 | 2928072716 | 2928070936 | Bacteria | 8062541 |
| 465 | 2928085879 | 2928084124 | Bacteria | 7159212 |
| 466 | 2928120453 | 2928115317 | Bacteria | 6477646 |
| 467 | 2929526015 | 2929520902 | Bacteria | 6765052 |
| 468 | 2932426507 | 2932422444 | Bacteria | 4678430 |
| 469 | 2939634291 | 2939631187 | Bacteria | 6118131 |
| 470 | 2945914787 | 2945909444 | Bacteria | 7065066 |
| 471 | 2945951147 | 2945945610 | Bacteria | 5951079 |
| 472 | 2945974195 | 2945972063 | Bacteria | 6086495 |
| 473 | 2945989814 | 2945984333 | Bacteria | 7358892 |
| 474 | 2990714553 | 2990710928 | Bacteria | 5002431 |
| 475 | Ga0439462_0006852 | |||
| 476 | JGI24740J21852_10001224 | |||
| 477 | JGI24743J22301_10043949 | |||
| 478 | JGI25158J39367_1013243 | |||
| 479 | JGI25152J39213_1001552 | |||
| 480 | JGI25152J39213_1006408 | |||
| 481 | JGI25150J39212_1006119 | |||
| 482 | Ga0006759J45824_1031718 | |||
| 483 | Ga0006759J45824_1038675 | |||
| 484 | JGI25153J46596_10026750 | |||
| 485 | JGI25153J46596_10028761 | |||
| 486 | Ga0006770J48903_1024177 | |||
| 487 | Ga0006777J48905_1013720 | |||
| 488 | rootH1_10034260 | |||
| 489 | rootL2_10120248 | |||
| 490 | rootL2_10156860 | |||
| 491 | rootH1_10036988 | |||
| 492 | JGI26128J50194_1000006 | |||
| 493 | JGI25160J50197_1020736 | |||
| 494 | Ga0007417J51691_1021404 | |||
| 495 | Ga0007410J51695_1009317 | |||
| 496 | Ga0007410J51695_1022915 | |||
| 497 | Ga0007409J51694_1022401 | |||
| 498 | Ga0007416J51690_1031853 | |||
| 499 | Ga0006562J51391_1013065 | |||
| 500 | Ga0007429J51699_1031263 | |||
| 501 | Ga0007411J51799_110034 | |||
| 502 | Ga0007415J51800_107200 | |||
| 503 | Ga0032354_1039438 | |||
| 504 | Ga0055527_1007469 | |||
| 505 | Ga0055535_1000833 | |||
| 506 | Ga0055535_1006474 | |||
| 507 | Ga0055542_1000811 | |||
| 508 | Ga0055529_1000322 | |||
| 509 | Ga0055524_1000140 | |||
| 510 | Ga0055536_1058943 | |||
| 511 | Ga0055530_10009756 | |||
| 512 | Ga0055530_10014360 | |||
| 513 | Ga0055530_10024350 | |||
| 514 | Ga0055540_1003990 | |||
| 515 | Ga0055531_10004806 | |||
| 516 | Ga0055531_10014967 | |||
| 517 | Ga0055543_1003188 | |||
| 518 | Ga0058858_1018080 | |||
| 519 | Ga0065165_1026365 | |||
| 520 | Ga0065165_1088025 | |||
| 521 | Ga0070676_10002282 | |||
| 522 | Ga0070676_10030854 | |||
| 523 | Ga0070676_10052429 | |||
| 524 | Ga0070683_100283216 | |||
| 525 | Ga0070690_100249172 | |||
| 526 | Ga0070677_10035203 | |||
| 527 | Ga0070682_100110807 | |||
| 528 | Ga0070687_100181887 | |||
| 529 | Ga0070661_100049810 | |||
| 530 | Ga0070668_100250397 | |||
| 531 | Ga0070669_100020298 | |||
| 532 | Ga0070669_100026052 | |||
| 533 | Ga0070675_100103048 | |||
| 534 | Ga0070675_100150753 | |||
| 535 | Ga0070675_100413519 | |||
| 536 | Ga0070674_100075338 | |||
| 537 | Ga0070674_100152064 | |||
| 538 | Ga0070673_100218197 | |||
| 539 | Ga0070673_100225614 | |||
| 540 | Ga0070705_100025070 | |||
| 541 | Ga0070700_100545394 | |||
| 542 | Ga0070694_100007904 | |||
| 543 | Ga0070663_100003492 | |||
| 544 | Ga0070663_100399833 | |||
| 545 | Ga0070678_100147019 | |||
| 546 | Ga0070678_100253493 | |||
| 547 | Ga0070662_100328007 | |||
| 548 | Ga0070681_10001245 | |||
| 549 | Ga0068867_100000552 | |||
| 550 | Ga0068867_100318561 | |||
| 551 | Ga0068867_100532752 | |||
| 552 | Ga0070706_100274369 | |||
| 553 | Ga0070699_100242433 | |||
| 554 | Ga0070679_100105941 | |||
| 555 | Ga0070684_100035127 | |||
| 556 | Ga0070672_100105406 | |||
| 557 | Ga0070672_100265443 | |||
| 558 | Ga0070686_100105179 | |||
| 559 | Ga0070695_100001266 | |||
| 560 | Ga0070696_100183473 | |||
| 561 | Ga0070704_100046248 | |||
| 562 | Ga0068855_100079296 | |||
| 563 | Ga0070664_100062281 | |||
| 564 | Ga0068857_100563020 | |||
| 565 | Ga0068852_100290433 | |||
| 566 | Ga0068851_10015881 | |||
| 567 | Ga0081539_10046061 | |||
| 568 | Ga0075362_10107530 | |||
| 569 | Ga0075366_10029148 | |||
| 570 | Ga0075366_10042881 | |||
| 571 | Ga0075366_10060215 | |||
| 572 | Ga0075366_10350844 | |||
| 573 | Ga0097621_100001348 | |||
| 574 | Ga0097621_100131954 | |||
| 575 | Ga0075370_10025794 | |||
| 576 | Ga0068871_100280954 | |||
| 577 | Ga0075430_100159725 | |||
| 578 | Ga0075433_10035840 | |||
| 579 | Ga0075434_100000895 | |||
| 580 | Ga0075434_100132977 | |||
| 581 | Ga0075436_100002331 | |||
| 582 | Ga0075436_100056181 | |||
| 583 | Ga0075436_100057078 | |||
| 584 | Ga0079104_1000053 | |||
| 585 | Ga0075435_100020698 | |||
| 586 | Ga0075435_100171874 | |||
| 587 | Ga0105240_10806284 | |||
| 588 | Ga0105247_10445598 | |||
| 589 | Ga0105243_10001789 | |||
| 590 | Ga0105243_10378834 | |||
| 591 | Ga0105248_11445766 | |||
| 592 | Ga0157339_1001211 | |||
| 593 | Ga0163162_10790770 | |||
| 594 | Ga0157375_10200738 | |||
| 595 | Ga0157375_10238393 | |||
| 596 | Ga0157380_10224761 | |||
| 597 | Ga0157380_10686365 | |||
| 598 | Ga0182008_10157982 | |||
| 599 | Ga0157376_10414606 | |||
| 600 | Ga0157376_10620812 | |||
| 601 | Ga0182007_10107409 | |||
| 602 | Ga0163161_10150402 | |||
| 603 | Ga0206356_10269682 | |||
| 604 | Ga0206354_10007622 | |||
| 605 | Ga0209672_101179 | |||
| 606 | Ga0209672_103368 | |||
| 607 | Ga0209147_101231 | |||
| 608 | Ga0209258_100696 | |||
| 609 | Ga0209258_101359 | |||
| 610 | Ga0207425_1000501 | |||
| 611 | Ga0207425_1000562 | |||
| 612 | Ga0209148_1000122 | |||
| 613 | Ga0209129_1000269 | |||
| 614 | Ga0209129_1003034 | |||
| 615 | Ga0209129_1030067 | |||
| 616 | Ga0209565_1004855 | |||
| 617 | Ga0209565_1024068 | |||
| 618 | Ga0209455_1000083 | |||
| 619 | Ga0209673_1000690 | |||
| 620 | Ga0209673_1008953 | |||
| 621 | Ga0209673_1013951 | |||
| 622 | Ga0209130_1008830 | |||
| 623 | Ga0209675_1007426 | |||
| 624 | Ga0209675_1017483 | |||
| 625 | Ga0209676_1004912 | |||
| 626 | Ga0209676_1007067 | |||
| 627 | Ga0209025_1019023 | |||
| 628 | Ga0209025_1022034 | |||
| 629 | Ga0209025_1044999 | |||
| 630 | Ga0209564_1000300 | |||
| 631 | Ga0209564_1011819 | |||
| 632 | Ga0209564_1012459 | |||
| 633 | Ga0209758_1006854 | |||
| 634 | Ga0209758_1029420 | |||
| 635 | Ga0209758_1029560 | |||
| 636 | Ga0209050_1000224 | |||
| 637 | Ga0209050_1001097 | |||
| 638 | Ga0209256_1000045 | |||
| 639 | Ga0209256_1010481 | |||
| 640 | Ga0209256_1010684 | |||
| 641 | Ga0207426_1009492 | |||
| 642 | Ga0207426_1009647 | |||
| 643 | Ga0209051_1000004 | |||
| 644 | Ga0209051_1000313 | |||
| 645 | Ga0209051_1008297 | |||
| 646 | Ga0209051_1011804 | |||
| 647 | Ga0209257_1000315 | |||
| 648 | Ga0209257_1010185 | |||
| 649 | Ga0209257_1028216 | |||
| 650 | Ga0207656_10087178 | |||
| 651 | Ga0207645_10125857 | |||
| 652 | Ga0207684_10009766 | |||
| 653 | Ga0207707_10041835 | |||
| 654 | Ga0207671_10205096 | |||
| 655 | Ga0207660_10298298 | |||
| 656 | Ga0207662_10216238 | |||
| 657 | Ga0207657_10389350 | |||
| 658 | Ga0207649_10009290 | |||
| 659 | Ga0207652_10314673 | |||
| 660 | Ga0207652_10351125 | |||
| 661 | Ga0207681_10212303 | |||
| 662 | Ga0207694_10368402 | |||
| 663 | Ga0207659_10182486 | |||
| 664 | Ga0207687_10427533 | |||
| 665 | Ga0207690_10090774 | |||
| 666 | Ga0207706_10134853 | |||
| 667 | Ga0207686_10669791 | |||
| 668 | Ga0207709_10001005 | |||
| 669 | Ga0207709_10435065 | |||
| 670 | Ga0207691_10041144 | |||
| 671 | Ga0207691_10133738 | |||
| 672 | Ga0207691_10286094 | |||
| 673 | Ga0207689_10429496 | |||
| 674 | Ga0207679_10029503 | |||
| 675 | Ga0207679_10145633 | |||
| 676 | Ga0207667_10062375 | |||
| 677 | Ga0207651_10689140 | |||
| 678 | Ga0207712_10711273 | |||
| 679 | Ga0207668_10074143 | |||
| 680 | Ga0207668_10092589 | |||
| 681 | Ga0207658_10019075 | |||
| 682 | Ga0207658_10559180 | |||
| 683 | Ga0207703_10448855 | |||
| 684 | Ga0207639_10026764 | |||
| 685 | Ga0207678_10475078 | |||
| 686 | Ga0207648_10002176 | |||
| 687 | Ga0207648_10149138 | |||
| 688 | Ga0207648_10285285 | |||
| 689 | Ga0207674_10597833 | |||
| 690 | Ga0207675_100021254 | |||
| 691 | Ga0207683_10161174 | |||
| 692 | Ga0207698_10086124 | |||
| 693 | Ga0209281_1000147 | |||
| 694 | Ga0209973_1008804 | |||
| 695 | Ga0209969_1011948 | |||
| 696 | Ga0209981_1016649 | |||
| 697 | Ga0209996_1000331 | |||
| 698 | Ga0209984_1001403 | |||
| 699 | Ga0209995_1001236 | |||
| 700 | Ga0209995_1031390 | |||
| 701 | Ga0209968_1019826 | |||
| 702 | Ga0209999_1003422 | |||
| 703 | Ga0209971_1008102 | |||
| 704 | Ga0209971_1071942 | |||
| 705 | Ga0209966_1000117 | |||
| 706 | Ga0209998_10010535 | |||
| 707 | Ga0209974_10008712 | |||
| 708 | Ga0268266_10508976 | |||
| 709 | Ga0265336_10000618 | |||
| 710 | Ga0307515_10127712 | |||
| 711 | Ga0307515_10217902 | |||
| 712 | Ga0265324_10057894 | |||
| 713 | Ga0265330_10000464 | |||
| 714 | Ga0265330_10004608 | |||
| 715 | Ga0265332_10000018 | |||
| 716 | Ga0265332_10001783 | |||
| 717 | Ga0265328_10047331 | |||
| 718 | Ga0265325_10002138 | |||
| 719 | Ga0265329_10002128 | |||
| 720 | Ga0265340_10075932 | |||
| 721 | Ga0265331_10000635 | |||
| 722 | Ga0265327_10009087 | |||
| 723 | Ga0265327_10010616 | |||
| 724 | Ga0265327_10021833 | |||
| 725 | Ga0265327_10023957 | |||
| 726 | Ga0265316_10224059 | |||
| 727 | Ga0307513_10120005 | |||
| 728 | Ga0307408_100691981 | |||
| 729 | Ga0307514_10017304 | |||
| 730 | Ga0265314_10001491 | |||
| 731 | Ga0265314_10121847 | |||
| 732 | Ga0265342_10013924 | |||
| 733 | Ga0307516_10020587 | |||
| 734 | Ga0307516_10065214 | |||
| 735 | Ga0307405_10385157 | |||
| 736 | Ga0307412_10092220 | |||
| 737 | Ga0373958_0006443 | |||
| 738 | Ga0373936_0102927 | |||
| 739 | Ga0373961_0003749 | |||
| 740 | Ga0373961_0121031 | |||
| 741 | Ga0373931_0001921 | |||
| 742 | Ga0373931_0061298 | |||
| 743 | Ga0395899_0410943 | |||
| 744 | Ga0395905_0366037 | |||
| 745 | Ga0395905_0394995 | |||
| 746 | Ga0395901_0144460 | |||
| 747 | Ga0436361_0771676 | |||
| 748 | Ga0436361_0791336 | |||
| 749 | Ga0439466_0040946 | |||
| 750 | Ga0451797_0414767 | |||
| 751 | Ga0451833_1140249 | |||
| 752 | Ga0451841_0465717 | |||
| 753 | Ga0451853_2157359 | |||
| 754 | Ga0452268_33226 | |||
| 755 | Ga0439431_0001654 | |||
| 756 | Ga0439445_0016088 | |||
| 757 | Ga0439432_118635 | |||
| 758 | Ga0439449_0016996 | |||
| 759 | Ga0450919_002341 | |||
| 760 | Ga0450888_021693 | |||
| 761 | Ga0450890_011788 | |||
| 762 | Ga0450896_033533 | |||
| 763 | Ga0450898_018202 | |||
| 764 | Ga0450889_020227 | |||
| 765 | Ga0439446_0111632 | |||
| 766 | Ga0439458_0044629 | |||
| 767 | Ga0439434_0014600 | |||
| 768 | Ga0439434_0054453 | |||
| 769 | Ga0450918_000123 | |||
| 770 | Ga0451577_0004088 | |||
| 771 | Ga0453683_0003443 | |||
| 772 | Ga0453683_0094065 | |||
| 773 | Ga0453684_0074718 | |||
| 774 | Ga0466968_0016214 | |||
| 775 | Ga0451576_0000909 | |||
| 776 | Ga0451576_0049923 | |||
| 777 | Ga0451576_0052030 | |||
| 778 | Ga0495627_008591 | |||
| 779 | Ga0495638_0218040 | |||
| 780 | Ga0495651_0331710 | |||
| 781 | Ga0495650_0016911 | |||
| 782 | Ga0495639_0012489 | |||
| 783 | Ga0495610_0070310 | |||
| 784 | Ga0495616_0006407 | |||
| 785 | Ga0495631_0009961 | |||
| 786 | Ga0495632_0216148 | |||
| 787 | Ga0495587_0371677 | |||
| 788 | Ga0495609_0182216 | |||
| 789 | Ga0495621_0017782 | |||
| 790 | Ga0495621_0188722 | |||
| 791 | Ga0495625_0151499 | |||
| 792 | Ga0495588_0026324 | |||
| 793 | Ga0495658_0068289 | |||
| 794 | Ga0495660_0055681 | |||
| 795 | Ga0495676_0035104 | |||
| 796 | Ga0496101_0074792 | |||
| 797 | Ga0496102_0004235 | |||
| 798 | Ga0496103_0022709 | |||
| 799 | Ga0496104_0003354 | |||
| 800 | Ga0496108_0107610 | |||
| 801 | Ga0496111_0102270 | |||
| 802 | Ga0496114_0047986 | |||
| 803 | Ga0496116_0076380 | |||
| 804 | Ga0496124_0027342 | |||
| 805 | Ga0496124_0420871 | |||
| 806 | Ga0496124_0504887 | |||
| 807 | Ga0496125_0042934 | |||
| 808 | Ga0501306_004860 | |||
| 809 | Ga0501306_008244 | |||
| 810 | Ga0501308_003803 | |||
| 811 | Ga0501308_006728 | |||
| 812 | Ga0501309_023468 | |||
| 813 | Ga0501310_026846 | |||
| 814 | Ga0501304_001350 | |||
| 815 | Ga0501305_004654 | |||
| 816 | Ga0501305_005663 | |||
| 817 | Ga0501307_021344 | |||
| 818 | Ga0501292_003303 | |||
| 819 | Ga0501298_035454 | |||
| 820 | Ga0501311_010004 | |||
| 821 | Ga0501312_002796 | |||
| 822 | Ga0501312_014826 | |||
| 823 | Ga0501312_037297 | |||
| 824 | Ga0501313_003567 | |||
| 825 | Ga0501316_021927 | |||
| 826 | Ga0501317_001907 | |||
| 827 | Ga0501317_049908 | |||
| 828 | Ga0501318_005102 | |||
| 829 | Ga0501319_000100 | |||
| 830 | Ga0501319_001480 | |||
| 831 | Ga0501320_000117 | |||
| 832 | Ga0501320_001756 | |||
| 833 | Ga0501320_006516 | |||
| 834 | Ga0501320_007924 | |||
| 835 | Ga0501323_000907 | |||
| 836 | Ga0501323_009216 | |||
| 837 | Ga0501325_001184 | |||
| 838 | Ga0501329_02168 | |||
| 839 | Ga0501334_02520 | |||
| 840 | Ga0501335_003844 | |||
| 841 | Ga0501337_000224 | |||
| 842 | Ga0501034_0215137 | |||
| 843 | Ga0501037_0388073 | |||
| 844 | Ga0501039_0480871 | |||
| 845 | Ga0501198_000043 | |||
| 846 | Ga0501206_019380 | |||
| 847 | Ga0501222_000051 | |||
| 848 | Ga0501253_005661 | |||
| 849 | Ga0501265_002364 | |||
| 850 | Ga0501266_031103 | |||
| 851 | Ga0501280_001594 | |||
| 852 | Ga0501044_0652370 | |||
| 853 | nmdc:mga03683_117953_c1 | |||
| 854 | nmdc:mga0k408_1021_c1 | |||
| 855 | nmdc:mga0k408_179204_c1 | |||
| 856 | nmdc:mga0k408_223236_c1 | |||
| 857 | nmdc:mga0k408_435442_c1 | |||
| 858 | nmdc:mga0k408_60623_c1 | |||
| 859 | nmdc:mga06z11_347050_c1 | |||
| 860 | nmdc:mga06z11_68404_c1 | |||
| 861 | nmdc:mga07m45_200893_c1 | |||
| 862 | nmdc:mga07m45_65556_c1 | |||
| 863 | nmdc:mga07m45_74067_c1 | |||
| 864 | nmdc:mga0qj67_225567_c1 | |||
| 865 | nmdc:mga0n895_570_c1 | |||
| 866 | nmdc:mga0rr50_450116_c1 | |||
| 867 | nmdc:mga0rr50_549647_c1 | |||
| 868 | nmdc:mga0rr50_7779_c1 | |||
| 869 | nmdc:mga08x19_15557_c1 | |||
| 870 | nmdc:mga08x19_16375_c1 | |||
| 871 | nmdc:mga08x19_333175_c1 | |||
| 872 | nmdc:mga0a205_16068_c1 | |||
| 873 | Ga0500651_0000076 | |||
| 874 | Ga0500593_020089 | |||
| 875 | Ga0500608_014714 | |||
| 876 | Ga0500655_001275 | |||
| 877 | Ga0500658_0000913 | |||
| 878 | Ga0500658_0010142 | |||
| 879 | Ga0500559_0011421 | |||
| 880 | Ga0500574_000502 | |||
| 881 | Ga0500616_0038297 | |||
| 882 | Ga0500619_000012 | |||
| 883 | Ga0590071_051845 | |||
| 884 | Ga0590077_017282 | |||
| 885 | Ga0587084_004600 | |||
| 886 | Ga0587084_005015 | |||
| 887 | Ga0587093_000110 | |||
| 888 | Ga0587093_020661 | |||
| 889 | Ga0587088_018506 | |||
| 890 | Ga0587092_008739 | |||
| 891 | Ga0587101_010054 | |||
| 892 | Ga0587062_027529 | |||
| 893 | Ga0587100_000209 | |||
| 894 | 2513231523 | |||
| 895 | 2548501868 | |||
| 896 | 2599626684 | |||
| 897 | 2599675930 | |||
| 898 | 2599684221 | |||
| 899 | 2599696235 | |||
| 900 | 2643865334 | |||
| 901 | 2643992264 | |||
| 902 | 2644060998 | |||
| 903 | 2644071694 | |||
| 904 | 2644218767 | |||
| 905 | 2644247765 | |||
| 906 | 2644256854 | |||
| 907 | 2644292744 | |||
| 908 | 2644325935 | |||
| 909 | 2644397450 | |||
| 910 | 2644466326 | |||
| 911 | 2644647239 | |||
| 912 | 2738723299 | |||
| 913 | 2738885623 | |||
| 914 | 2739247150 | |||
| 915 | 2739284030 | |||
| 916 | 2792837043 | |||
| 917 | 2816476201 | |||
| 918 | 2819601758 | |||
| 919 | 2831268496 | |||
| 920 | 2838061087 | |||
| 921 | 2842680703 | |||
| 922 | 2842737718 | |||
| 923 | 2842752903 | |||
| 924 | 2857578645 | |||
| 925 | 2881102070 | |||
| 926 | 2885200382 | |||
| 927 | 2885214035 | |||
| 928 | 2886854518 | |||
| 929 | 2899928003 | |||
| 930 | 2904453057 | |||
| 931 | 2904459905 | |||
| 932 | 2919463359 | |||
| 933 | 2928039938 | |||
| 934 | 2928047313 | |||
| 935 | 2928057483 | |||
| 936 | 2928068131 | |||
| 937 | 2928072716 | |||
| 938 | 2928085879 | |||
| 939 | 2928120453 | |||
| 940 | 2929526015 | |||
| 941 | 2932426507 | |||
| 942 | 2939634291 | |||
| 943 | 2945914787 | |||
| 944 | 2945951147 | |||
| 945 | 2945974195 | |||
| 946 | 2945989814 | |||
| 947 | 2990714553 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.8107 | 7 | 216 |
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.8014 | 7 | 216 |
| 6pvk-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class a | 0.8013 | 7 | 216 |
| 6pvk-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class a | 0.7969 | 7 | 216 |
| 6ppf-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class b | 0.7917 | 7 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vw3C01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.8965 | 8 | 216 | 2.40.30.10 |
| af_Q2FW06_34_105_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.6893 | 39 | 103 | 3.30.160.810 |
| af_P9WH87_35_101_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.6737 | 39 | 103 | 3.30.160.810 |
| af_Q9LIT4_106_169_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.6628 | 39 | 103 | 3.30.160.810 |
| af_P9WH87_35_101_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.6459 | 39 | 103 | 3.30.160.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9LAN4-F1-model_v4 | 50S ribosomal protein L3 | 0.7772 | 8 | 128 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A3B9LAN4-F1-model_v4 | 50S ribosomal protein L3 | 0.7712 | 8 | 128 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2G6EGS8-F1-model_v4 | 50S ribosomal protein L3 | 0.7376 | 6 | 133 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2G6EGS8-F1-model_v4 | 50S ribosomal protein L3 | 0.727 | 6 | 133 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A7X5F9K6-F1-model_v4 | 50S ribosomal protein L3 | 0.7186 | 7 | 215 |
GO:0003735
GO:0006412 GO:0022625 |