F451063

General Info

Members Datasets Scaffolds Average Seq Length
473 359 947 223

Family's Representative Sequence

Representative Sequence 3300042015|Ga0439462_0006852|Ga0439462_0006852_867_1649
Length 260
Sequence MIGFARFTAGGAFINPLSHPKRAGQLQQARRKQRSNNMSLSSLGLLGRKVGMMRLFTDDGDAVPVTVVDVSNNRVTQVKSQDNDGYVALQVTYGSRKASRVAKPLAGHLAKAGVEAGEIIREFRVDAETAAKYQAGGQVPVQALFAAGQKVDVQGTSIGKGFTGTIKRHNFGSQRASHGNSRSHNVPGSISMAQDPGRVFPGKRMSGHLGDVTVTTQNLDIIRVDESRQLLLIKGAVPGAKNGFVTVRPAVKAPAAKGAK

Samples

Sample ID Description Type Environment
1 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
152 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
195 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
196 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
204 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
205 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
206 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
207 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
208 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
209 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
210 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
211 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
212 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
253 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
254 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
272 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
273 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
274 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
275 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
276 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
277 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
290 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
291 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
292 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
293 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
294 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
297 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
298 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
307 2547132374 Acidovorax radicis N35 Isolate Unclassified
308 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
309 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
310 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
311 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
312 2643221570 Acidovorax sp. Root568 Isolate Unclassified
313 2643221596 Acidovorax sp. Root70 Isolate Unclassified
314 2643221609 Acidovorax sp. Root217 Isolate Unclassified
315 2643221611 Acidovorax sp. Root219 Isolate Unclassified
316 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
317 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
318 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
319 2643221652 Acidovorax sp. Root402 Isolate Unclassified
320 2643221658 Variovorax sp. Root411 Isolate Unclassified
321 2643221672 Variovorax sp. Root434 Isolate Unclassified
322 2643221683 Variovorax sp. Root473 Isolate Unclassified
323 2643221717 Acidovorax sp. Root267 Isolate Unclassified
324 2738541277 Variovorax sp. GV051 Isolate Unclassified
325 2738541307 Variovorax sp. GV008 Isolate Unclassified
326 2738543012 Acidovorax sp. CF301 Isolate Unclassified
327 2738543019 Variovorax sp. GV040 Isolate Unclassified
328 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
329 2816332133 Acidovorax radicis 2721A Isolate Unclassified
330 2818991446 Variovorax sp. 1180 Isolate Unclassified
331 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
332 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
333 2842677519 Variovorax sp. R-72495 Isolate Unclassified
334 2842733646 Variovorax sp. R-72446 Isolate Unclassified
335 2842747753 Variovorax sp. R-72060 Isolate Unclassified
336 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
337 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
338 2885198086 Variovorax sp. 679 Isolate Unclassified
339 2885211737 Variovorax sp. 553 Isolate Unclassified
340 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
341 2899924645 Variovorax sp. 369 Isolate Unclassified
342 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
343 2904456579 Variovorax sp. 2002 Isolate Unclassified
344 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
345 2928037797 Variovorax sp. 1126 Isolate Unclassified
346 2928044640 Variovorax sp. 1128 Isolate Unclassified
347 2928051484 Variovorax sp. 1133 Isolate Unclassified
348 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
349 2928070936 Variovorax gossypii 1167 Isolate Unclassified
350 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
351 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
352 2929520902 Variovorax beijingensis 502 Isolate Unclassified
353 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
354 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
355 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
356 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
357 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
358 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
359 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.11
Metatranscriptomes 12.47
Isolates 11.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.3
Nodule 0.63
Rhizoplane 2.33
Rhizosphere 65.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439462_0006852 3300042015 Bacteria 2842
2 JGI24740J21852_10001224 3300001979 Bacteria 11607
3 JGI24743J22301_10043949 3300001991 Bacteria 901
4 JGI25158J39367_1013243 3300002739 Bacteria 1081
5 JGI25152J39213_1001552 3300002773 Bacteria 9748
6 JGI25152J39213_1006408 3300002773 Bacteria 3221
7 JGI25150J39212_1006119 3300002774 Bacteria 2511
8 Ga0006759J45824_1031718 3300003163 Bacteria 1084
9 Ga0006759J45824_1038675 3300003163 Bacteria 4286
10 JGI25153J46596_10026750 3300003215 Bacteria 2036
11 JGI25153J46596_10028761 3300003215 Bacteria 1921
12 Ga0006770J48903_1024177 3300003305 Bacteria 1110
13 Ga0006777J48905_1013720 3300003308 Bacteria 1797
14 rootH1_10034260 3300003316 Bacteria 1167
15 rootL2_10120248 3300003322 Bacteria 3323
16 rootL2_10156860 3300003322 Bacteria 1136
17 rootH1_10036988 3300003316 Bacteria 3609
18 rootH1_10036988 3300003323 Bacteria 4221
19 JGI26128J50194_1000006 3300003347 Bacteria 6334
20 JGI25160J50197_1020736 3300003354 Bacteria 1973
21 Ga0007417J51691_1021404 3300003544 Bacteria 4422
22 Ga0007410J51695_1009317 3300003574 Bacteria 4537
23 Ga0007410J51695_1022915 3300003574 Bacteria 2695
24 Ga0007409J51694_1022401 3300003575 Bacteria 4310
25 Ga0007416J51690_1031853 3300003577 Bacteria 4447
26 Ga0006562J51391_1013065 3300003578 Bacteria 1775
27 Ga0007429J51699_1031263 3300003579 Bacteria 2173
28 Ga0007411J51799_110034 3300003611 Bacteria 1429
29 Ga0007415J51800_107200 3300003613 Bacteria 4345
30 Ga0032354_1039438 3300003693 Bacteria 4274
31 Ga0055527_1007469 3300003760 Bacteria 1333
32 Ga0055535_1000833 3300003761 Bacteria 22124
33 Ga0055535_1006474 3300003761 Bacteria 2362
34 Ga0055542_1000811 3300003762 Bacteria 22966
35 Ga0055529_1000322 3300003763 Bacteria 54232
36 Ga0055524_1000140 3300003775 Bacteria 85990
37 Ga0055536_1058943 3300003781 Bacteria 803
38 Ga0055530_10009756 3300003791 Bacteria 3638
39 Ga0055530_10014360 3300003791 Bacteria 2643
40 Ga0055530_10024350 3300003791 Bacteria 1718
41 Ga0055540_1003990 3300003792 Bacteria 6874
42 Ga0055531_10004806 3300003794 Bacteria 8068
43 Ga0055531_10014967 3300003794 Bacteria 3455
44 Ga0055543_1003188 3300004625 Bacteria 4998
45 Ga0058858_1018080 3300004785 Bacteria 2450
46 Ga0065165_1026365 3300005262 Bacteria 1913
47 Ga0065165_1088025 3300005262 Bacteria 795
48 Ga0070676_10002282 3300005328 Bacteria 9791
49 Ga0070676_10030854 3300005328 Bacteria 3059
50 Ga0070676_10052429 3300005328 Bacteria 2398
51 Ga0070683_100283216 3300005329 Bacteria 1577
52 Ga0070690_100249172 3300005330 Bacteria 1256
53 Ga0070677_10035203 3300005333 Bacteria 1940
54 Ga0070682_100110807 3300005337 Bacteria 1829
55 Ga0070687_100181887 3300005343 Bacteria 1260
56 Ga0070661_100049810 3300005344 Bacteria 3066
57 Ga0070668_100250397 3300005347 Bacteria 1470
58 Ga0070669_100020298 3300005353 Bacteria 4745
59 Ga0070669_100026052 3300005353 Bacteria 4206
60 Ga0070675_100103048 3300005354 Bacteria 2405
61 Ga0070675_100150753 3300005354 Bacteria 1993
62 Ga0070675_100413519 3300005354 Bacteria 1205
63 Ga0070674_100075338 3300005356 Bacteria 2396
64 Ga0070674_100152064 3300005356 Bacteria 1747
65 Ga0070673_100218197 3300005364 Bacteria 1650
66 Ga0070673_100225614 3300005364 Bacteria 1623
67 Ga0070705_100025070 3300005440 Bacteria 3228
68 Ga0070700_100545394 3300005441 Bacteria 900
69 Ga0070694_100007904 3300005444 Bacteria 6493
70 Ga0070663_100003492 3300005455 Bacteria 9070
71 Ga0070663_100399833 3300005455 Bacteria 1123
72 Ga0070678_100147019 3300005456 Bacteria 1893
73 Ga0070678_100253493 3300005456 Bacteria 1476
74 Ga0070662_100328007 3300005457 Bacteria 1250
75 Ga0070681_10001245 3300005458 Bacteria 22156
76 Ga0068867_100000552 3300005459 Bacteria 24723
77 Ga0068867_100318561 3300005459 Bacteria 1288
78 Ga0068867_100532752 3300005459 Bacteria 1014
79 Ga0070706_100274369 3300005467 Bacteria 1573
80 Ga0070699_100242433 3300005518 Bacteria 1609
81 Ga0070679_100105941 3300005530 Bacteria 2797
82 Ga0070684_100035127 3300005535 Bacteria 4289
83 Ga0070672_100105406 3300005543 Bacteria 2292
84 Ga0070672_100265443 3300005543 Bacteria 1448
85 Ga0070686_100105179 3300005544 Bacteria 1913
86 Ga0070695_100001266 3300005545 Bacteria 13913
87 Ga0070696_100183473 3300005546 Bacteria 1553
88 Ga0070704_100046248 3300005549 Bacteria 3034
89 Ga0068855_100079296 3300005563 Bacteria 3808
90 Ga0070664_100062281 3300005564 Bacteria 3180
91 Ga0068857_100563020 3300005577 Bacteria 1075
92 Ga0068852_100290433 3300005616 Bacteria 1579
93 Ga0068851_10015881 3300005834 Bacteria 3593
94 Ga0081539_10046061 3300005985 Bacteria 2502
95 Ga0075362_10107530 3300006177 Bacteria 1310
96 Ga0075366_10029148 3300006195 Bacteria 3242
97 Ga0075366_10042881 3300006195 Bacteria 2679
98 Ga0075366_10060215 3300006195 Bacteria 2255
99 Ga0075366_10350844 3300006195 Bacteria 905
100 Ga0097621_100001348 3300006237 Bacteria 16895
101 Ga0097621_100131954 3300006237 Bacteria 2127
102 Ga0075370_10025794 3300006353 Bacteria 3252
103 Ga0068871_100280954 3300006358 Bacteria 1456
104 Ga0075430_100159725 3300006846 Bacteria 1876
105 Ga0075433_10035840 3300006852 Bacteria 4270
106 Ga0075434_100000895 3300006871 Bacteria 23884
107 Ga0075434_100132977 3300006871 Bacteria 2507
108 Ga0075436_100002331 3300006914 Bacteria 13096
109 Ga0075436_100056181 3300006914 Bacteria 2719
110 Ga0075436_100057078 3300006914 Bacteria 2696
111 Ga0079104_1000053 3300006946 Bacteria 168604
112 Ga0075435_100020698 3300007076 Bacteria 5048
113 Ga0075435_100171874 3300007076 Bacteria 1828
114 Ga0105240_10806284 3300009093 Bacteria 1017
115 Ga0105247_10445598 3300009101 Bacteria 932
116 Ga0105243_10001789 3300009148 Bacteria 18454
117 Ga0105243_10378834 3300009148 Bacteria 1308
118 Ga0105248_11445766 3300009177 Bacteria 778
119 Ga0157339_1001211 3300012505 Bacteria 1529
120 Ga0163162_10790770 3300013306 Bacteria 1066
121 Ga0157375_10200738 3300013308 Bacteria 2150
122 Ga0157375_10238393 3300013308 Bacteria 1978
123 Ga0157380_10224761 3300014326 Bacteria 1682
124 Ga0157380_10686365 3300014326 Bacteria 1027
125 Ga0182008_10157982 3300014497 Bacteria 1140
126 Ga0157376_10414606 3300014969 Bacteria 1305
127 Ga0157376_10620812 3300014969 Bacteria 1078
128 Ga0182007_10107409 3300015262 Bacteria 927
129 Ga0163161_10150402 3300017792 Bacteria 1769
130 Ga0206356_10269682 3300020070 Bacteria 1010
131 Ga0206354_10007622 3300020081 Bacteria 932
132 Ga0209672_101179 3300025228 Bacteria 10647
133 Ga0209672_103368 3300025228 Bacteria 3335
134 Ga0209147_101231 3300025229 Bacteria 10201
135 Ga0209258_100696 3300025242 Bacteria 23018
136 Ga0209258_101359 3300025242 Bacteria 8893
137 Ga0207425_1000501 3300025245 Bacteria 24428
138 Ga0207425_1000562 3300025245 Bacteria 21887
139 Ga0209148_1000122 3300025254 Bacteria 186071
140 Ga0209129_1000269 3300025258 Bacteria 51170
141 Ga0209129_1003034 3300025258 Bacteria 7616
142 Ga0209129_1030067 3300025258 Bacteria 911
143 Ga0209565_1004855 3300025263 Bacteria 4015
144 Ga0209565_1024068 3300025263 Bacteria 1243
145 Ga0209455_1000083 3300025272 Bacteria 255660
146 Ga0209673_1000690 3300025273 Bacteria 48324
147 Ga0209673_1008953 3300025273 Bacteria 4398
148 Ga0209673_1013951 3300025273 Bacteria 3138
149 Ga0209130_1008830 3300025284 Bacteria 2933
150 Ga0209675_1007426 3300025291 Bacteria 4204
151 Ga0209675_1017483 3300025291 Bacteria 2046
152 Ga0209676_1004912 3300025292 Bacteria 7197
153 Ga0209676_1007067 3300025292 Bacteria 5379
154 Ga0209025_1019023 3300025294 Bacteria 3844
155 Ga0209025_1022034 3300025294 Bacteria 3400
156 Ga0209025_1044999 3300025294 Bacteria 1836
157 Ga0209564_1000300 3300025295 Bacteria 98386
158 Ga0209564_1011819 3300025295 Bacteria 3873
159 Ga0209564_1012459 3300025295 Bacteria 3707
160 Ga0209758_1006854 3300025297 Bacteria 7968
161 Ga0209758_1029420 3300025297 Bacteria 2298
162 Ga0209758_1029560 3300025297 Bacteria 2288
163 Ga0209050_1000224 3300025298 Bacteria 125433
164 Ga0209050_1001097 3300025298 Bacteria 32856
165 Ga0209256_1000045 3300025299 Bacteria 325506
166 Ga0209256_1010481 3300025299 Bacteria 3873
167 Ga0209256_1010684 3300025299 Bacteria 3801
168 Ga0207426_1009492 3300025302 Bacteria 3846
169 Ga0207426_1009647 3300025302 Bacteria 3801
170 Ga0209051_1000004 3300025303 Bacteria 1155596
171 Ga0209051_1000313 3300025303 Bacteria 75138
172 Ga0209051_1008297 3300025303 Bacteria 5516
173 Ga0209051_1011804 3300025303 Bacteria 4278
174 Ga0209257_1000315 3300025304 Bacteria 102293
175 Ga0209257_1010185 3300025304 Bacteria 4827
176 Ga0209257_1028216 3300025304 Bacteria 1851
177 Ga0207656_10087178 3300025321 Bacteria 1412
178 Ga0207645_10125857 3300025907 Bacteria 1666
179 Ga0207684_10009766 3300025910 Bacteria 8465
180 Ga0207707_10041835 3300025912 Bacteria 4001
181 Ga0207671_10205096 3300025914 Bacteria 1541
182 Ga0207660_10298298 3300025917 Bacteria 1283
183 Ga0207662_10216238 3300025918 Bacteria 1246
184 Ga0207657_10389350 3300025919 Bacteria 1097
185 Ga0207649_10009290 3300025920 Bacteria 5379
186 Ga0207652_10314673 3300025921 Bacteria 1413
187 Ga0207652_10351125 3300025921 Bacteria 1331
188 Ga0207681_10212303 3300025923 Bacteria 1492
189 Ga0207694_10368402 3300025924 Bacteria 1191
190 Ga0207659_10182486 3300025926 Bacteria 1664
191 Ga0207687_10427533 3300025927 Bacteria 1094
192 Ga0207690_10090774 3300025932 Bacteria 2157
193 Ga0207706_10134853 3300025933 Bacteria 2172
194 Ga0207686_10669791 3300025934 Bacteria 822
195 Ga0207709_10001005 3300025935 Bacteria 20902
196 Ga0207709_10435065 3300025935 Bacteria 1010
197 Ga0207691_10041144 3300025940 Bacteria 4268
198 Ga0207691_10133738 3300025940 Bacteria 2189
199 Ga0207691_10286094 3300025940 Bacteria 1418
200 Ga0207689_10429496 3300025942 Bacteria 1103
201 Ga0207679_10029503 3300025945 Bacteria 3820
202 Ga0207679_10145633 3300025945 Bacteria 1921
203 Ga0207667_10062375 3300025949 Bacteria 3897
204 Ga0207651_10689140 3300025960 Bacteria 899
205 Ga0207712_10711273 3300025961 Bacteria 877
206 Ga0207668_10074143 3300025972 Bacteria 2442
207 Ga0207668_10092589 3300025972 Bacteria 2225
208 Ga0207658_10019075 3300025986 Bacteria 4744
209 Ga0207658_10559180 3300025986 Bacteria 1024
210 Ga0207703_10448855 3300026035 Bacteria 1204
211 Ga0207639_10026764 3300026041 Bacteria 4193
212 Ga0207678_10475078 3300026067 Bacteria 1088
213 Ga0207648_10002176 3300026089 Bacteria 21281
214 Ga0207648_10149138 3300026089 Bacteria 2063
215 Ga0207648_10285285 3300026089 Bacteria 1477
216 Ga0207674_10597833 3300026116 Bacteria 1066
217 Ga0207675_100021254 3300026118 Bacteria 6044
218 Ga0207683_10161174 3300026121 Bacteria 2028
219 Ga0207698_10086124 3300026142 Bacteria 2554
220 Ga0209281_1000147 3300027111 Bacteria 168586
221 Ga0209973_1008804 3300027252 Bacteria 1161
222 Ga0209969_1011948 3300027360 Bacteria 1250
223 Ga0209981_1016649 3300027378 Bacteria 1034
224 Ga0209996_1000331 3300027395 Bacteria 5870
225 Ga0209984_1001403 3300027424 Bacteria 2608
226 Ga0209995_1001236 3300027471 Bacteria 3933
227 Ga0209995_1031390 3300027471 Bacteria 890
228 Ga0209968_1019826 3300027526 Bacteria 1084
229 Ga0209999_1003422 3300027543 Bacteria 2834
230 Ga0209971_1008102 3300027682 Bacteria 2494
231 Ga0209971_1071942 3300027682 Bacteria 840
232 Ga0209966_1000117 3300027695 Bacteria 35145
233 Ga0209998_10010535 3300027717 Bacteria 1914
234 Ga0209974_10008712 3300027876 Bacteria 3457
235 Ga0268266_10508976 3300028379 Bacteria 1150
236 Ga0265336_10000618 3300028666 Bacteria 19547
237 Ga0307515_10127712 3300028794 Bacteria 2826
238 Ga0307515_10217902 3300028794 Bacteria 1735
239 Ga0265324_10057894 3300029957 Bacteria 1326
240 Ga0265330_10000464 3300031235 Bacteria 27117
241 Ga0265330_10004608 3300031235 Bacteria 6970
242 Ga0265332_10000018 3300031238 Bacteria 224913
243 Ga0265332_10001783 3300031238 Bacteria 11615
244 Ga0265328_10047331 3300031239 Bacteria 1581
245 Ga0265325_10002138 3300031241 Bacteria 13479
246 Ga0265329_10002128 3300031242 Bacteria 9177
247 Ga0265340_10075932 3300031247 Bacteria 1587
248 Ga0265331_10000635 3300031250 Bacteria 30467
249 Ga0265327_10009087 3300031251 Bacteria 7252
250 Ga0265327_10010616 3300031251 Bacteria 6447
251 Ga0265327_10021833 3300031251 Bacteria 3850
252 Ga0265327_10023957 3300031251 Bacteria 3598
253 Ga0265316_10224059 3300031344 Bacteria 1386
254 Ga0307513_10120005 3300031456 Bacteria 2599
255 Ga0307408_100691981 3300031548 Bacteria 915
256 Ga0307514_10017304 3300031649 Bacteria 5933
257 Ga0265314_10001491 3300031711 Bacteria 25976
258 Ga0265314_10121847 3300031711 Bacteria 1640
259 Ga0265342_10013924 3300031712 Bacteria 5364
260 Ga0307516_10020587 3300031730 Bacteria 6812
261 Ga0307516_10065214 3300031730 Bacteria 3518
262 Ga0307405_10385157 3300031731 Bacteria 1093
263 Ga0307412_10092220 3300031911 Bacteria 2122
264 Ga0373958_0006443 3300034819 Bacteria 1830
265 Ga0373936_0102927 3300035113 Bacteria 1206
266 Ga0373961_0003749 3300035241 Bacteria 3717
267 Ga0373961_0121031 3300035241 Bacteria 867
268 Ga0373931_0001921 3300035691 Bacteria 9104
269 Ga0373931_0061298 3300035691 Bacteria 2028
270 Ga0395899_0410943 3300037312 Bacteria 894
271 Ga0395905_0366037 3300037471 Bacteria 1335
272 Ga0395905_0394995 3300037471 Bacteria 1277
273 Ga0395901_0144460 3300038443 Bacteria 2501
274 Ga0436361_0771676 3300039447 Bacteria 1677
275 Ga0436361_0791336 3300039447 Bacteria 1134
276 Ga0439466_0040946 3300041411 Bacteria 1548
277 Ga0451797_0414767 3300041453 Bacteria 734
278 Ga0451833_1140249 3300041491 Bacteria 955
279 Ga0451841_0465717 3300041498 Bacteria 1948
280 Ga0451853_2157359 3300041512 Bacteria 1112
281 Ga0452268_33226 3300041907 Bacteria 707
282 Ga0439431_0001654 3300041997 Bacteria 4929
283 Ga0439445_0016088 3300042004 Bacteria 1837
284 Ga0439432_118635 3300042006 Bacteria 784
285 Ga0439449_0016996 3300042007 Bacteria 2731
286 Ga0450919_002341 3300042121 Bacteria 2455
287 Ga0450888_021693 3300042126 Bacteria 821
288 Ga0450890_011788 3300042127 Bacteria 1131
289 Ga0450896_033533 3300042133 Bacteria 783
290 Ga0450898_018202 3300042134 Bacteria 1215
291 Ga0450889_020227 3300042144 Bacteria 736
292 Ga0439446_0111632 3300042156 Bacteria 873
293 Ga0439458_0044629 3300042157 Bacteria 1083
294 Ga0439434_0014600 3300042435 Bacteria 2337
295 Ga0439434_0054453 3300042435 Bacteria 1244
296 Ga0450918_000123 3300042531 Bacteria 16624
297 Ga0451577_0004088 3300042876 Bacteria 15682
298 Ga0453683_0003443 3300044673 Bacteria 11656
299 Ga0453683_0094065 3300044673 Bacteria 1880
300 Ga0453684_0074718 3300044712 Bacteria 4265
301 Ga0466968_0016214 3300044735 Bacteria 2964
302 Ga0451576_0000909 3300045051 Bacteria 56035
303 Ga0451576_0049923 3300045051 Bacteria 4390
304 Ga0451576_0052030 3300045051 Bacteria 4292
305 Ga0495627_008591 3300046453 Bacteria 3813
306 Ga0495638_0218040 3300046460 Bacteria 1068
307 Ga0495651_0331710 3300046462 Bacteria 1011
308 Ga0495650_0016911 3300046471 Bacteria 3672
309 Ga0495639_0012489 3300046475 Bacteria 3663
310 Ga0495610_0070310 3300046512 Bacteria 1635
311 Ga0495616_0006407 3300046513 Bacteria 7120
312 Ga0495631_0009961 3300046518 Bacteria 4725
313 Ga0495632_0216148 3300046519 Bacteria 868
314 Ga0495587_0371677 3300046536 Bacteria 796
315 Ga0495609_0182216 3300046538 Bacteria 884
316 Ga0495621_0017782 3300046539 Bacteria 2302
317 Ga0495621_0188722 3300046539 Bacteria 825
318 Ga0495625_0151499 3300046660 Bacteria 1558
319 Ga0495588_0026324 3300046674 Bacteria 2903
320 Ga0495658_0068289 3300046683 Bacteria 2058
321 Ga0495660_0055681 3300046810 Bacteria 2140
322 Ga0495676_0035104 3300047321 Bacteria 4197
323 Ga0496101_0074792 3300048904 Bacteria 2492
324 Ga0496102_0004235 3300048905 Bacteria 12129
325 Ga0496103_0022709 3300048906 Bacteria 3778
326 Ga0496104_0003354 3300048907 Bacteria 13832
327 Ga0496108_0107610 3300048911 Bacteria 2381
328 Ga0496111_0102270 3300048914 Bacteria 2106
329 Ga0496114_0047986 3300048917 Bacteria 3551
330 Ga0496116_0076380 3300048919 Bacteria 2098
331 Ga0496124_0027342 3300048927 Bacteria 5121
332 Ga0496124_0420871 3300048927 Bacteria 920
333 Ga0496124_0504887 3300048927 Bacteria 810
334 Ga0496125_0042934 3300048928 Bacteria 3844
335 Ga0501306_004860 3300049127 Bacteria 1519
336 Ga0501306_008244 3300049127 Bacteria 1267
337 Ga0501308_003803 3300049128 Bacteria 1421
338 Ga0501308_006728 3300049128 Bacteria 1186
339 Ga0501309_023468 3300049129 Bacteria 877
340 Ga0501310_026846 3300049130 Bacteria 748
341 Ga0501304_001350 3300049160 Bacteria 1557
342 Ga0501305_004654 3300049161 Bacteria 1624
343 Ga0501305_005663 3300049161 Bacteria 1524
344 Ga0501307_021344 3300049162 Bacteria 844
345 Ga0501292_003303 3300049515 Bacteria 2148
346 Ga0501298_035454 3300049521 Bacteria 996
347 Ga0501311_010004 3300049527 Bacteria 1144
348 Ga0501312_002796 3300049528 Bacteria 1918
349 Ga0501312_014826 3300049528 Bacteria 1100
350 Ga0501312_037297 3300049528 Bacteria 783
351 Ga0501313_003567 3300049529 Bacteria 1555
352 Ga0501316_021927 3300049532 Bacteria 810
353 Ga0501317_001907 3300049533 Bacteria 1890
354 Ga0501317_049908 3300049533 Bacteria 662
355 Ga0501318_005102 3300049534 Bacteria 1288
356 Ga0501319_000100 3300049535 Bacteria 3013
357 Ga0501319_001480 3300049535 Bacteria 1366
358 Ga0501320_000117 3300049536 Bacteria 3648
359 Ga0501320_001756 3300049536 Bacteria 1639
360 Ga0501320_006516 3300049536 Bacteria 1097
361 Ga0501320_007924 3300049536 Bacteria 1034
362 Ga0501323_000907 3300049539 Bacteria 2421
363 Ga0501323_009216 3300049539 Bacteria 1160
364 Ga0501325_001184 3300049541 Bacteria 1541
365 Ga0501329_02168 3300049545 Bacteria 926
366 Ga0501334_02520 3300049550 Bacteria 1092
367 Ga0501335_003844 3300049551 Bacteria 1290
368 Ga0501337_000224 3300049553 Bacteria 2505
369 Ga0501034_0215137 3300049571 Bacteria 1876
370 Ga0501037_0388073 3300049573 Bacteria 959
371 Ga0501039_0480871 3300049575 Bacteria 975
372 Ga0501198_000043 3300049649 Bacteria 44170
373 Ga0501206_019380 3300049653 Bacteria 962
374 Ga0501222_000051 3300049662 Bacteria 43800
375 Ga0501253_005661 3300049683 Bacteria 1652
376 Ga0501265_002364 3300049762 Bacteria 2141
377 Ga0501266_031103 3300049763 Bacteria 762
378 Ga0501280_001594 3300049776 Bacteria 4074
379 Ga0501044_0652370 3300049823 Bacteria 941
380 nmdc:mga03683_117953_c1 3300050489 Bacteria 1178
381 nmdc:mga0k408_1021_c1 3300050493 Bacteria 15347
382 nmdc:mga0k408_179204_c1 3300050493 Bacteria 1264
383 nmdc:mga0k408_223236_c1 3300050493 Bacteria 1125
384 nmdc:mga0k408_435442_c1 3300050493 Bacteria 779
385 nmdc:mga0k408_60623_c1 3300050493 Bacteria 2199
386 nmdc:mga06z11_347050_c1 3300050494 Bacteria 888
387 nmdc:mga06z11_68404_c1 3300050494 Bacteria 1872
388 nmdc:mga07m45_200893_c1 3300050496 Bacteria 1160
389 nmdc:mga07m45_65556_c1 3300050496 Bacteria 1759
390 nmdc:mga07m45_74067_c1 3300050496 Bacteria 1940
391 nmdc:mga0qj67_225567_c1 3300050509 Bacteria 1521
392 nmdc:mga0n895_570_c1 3300050512 Bacteria 25297
393 nmdc:mga0rr50_450116_c1 3300050513 Bacteria 1092
394 nmdc:mga0rr50_549647_c1 3300050513 Bacteria 983
395 nmdc:mga0rr50_7779_c1 3300050513 Bacteria 6642
396 nmdc:mga08x19_15557_c1 3300050514 Bacteria 4630
397 nmdc:mga08x19_16375_c1 3300050514 Bacteria 4522
398 nmdc:mga08x19_333175_c1 3300050514 Bacteria 1058
399 nmdc:mga0a205_16068_c1 3300050515 Bacteria 7006
400 Ga0500651_0000076 3300053093 Bacteria 63637
401 Ga0500593_020089 3300053117 Bacteria 2927
402 Ga0500608_014714 3300053122 Bacteria 3499
403 Ga0500655_001275 3300053133 Bacteria 4783
404 Ga0500658_0000913 3300053134 Bacteria 12085
405 Ga0500658_0010142 3300053134 Bacteria 3472
406 Ga0500559_0011421 3300053136 Bacteria 3792
407 Ga0500574_000502 3300053141 Bacteria 4999
408 Ga0500616_0038297 3300053153 Bacteria 2590
409 Ga0500619_000012 3300053154 Bacteria 57280
410 Ga0590071_051845 3300059421 Bacteria 996
411 Ga0590077_017282 3300059426 Bacteria 1516
412 Ga0587084_004600 3300059477 Bacteria 1587
413 Ga0587084_005015 3300059477 Bacteria 1546
414 Ga0587093_000110 3300059478 Bacteria 3983
415 Ga0587093_020661 3300059478 Bacteria 878
416 Ga0587088_018506 3300059508 Bacteria 1135
417 Ga0587092_008739 3300059512 Bacteria 1344
418 Ga0587101_010054 3300059623 Bacteria 1181
419 Ga0587062_027529 3300059639 Bacteria 850
420 Ga0587100_000209 3300059648 Bacteria 2478
421 2513231523 2513020051 Bacteria 6053213
422 2548501868 2547132374 Bacteria 5530232
423 2599626684 2599185214 Bacteria 8209958
424 2599675930 2599185226 Bacteria 8233575
425 2599684221 2599185227 Bacteria 8246414
426 2599696235 2599185229 Bacteria 8216126
427 2643865334 2643221570 Bacteria 5103772
428 2643992264 2643221596 Bacteria 5006805
429 2644060998 2643221609 Bacteria 6756331
430 2644071694 2643221611 Bacteria 6820941
431 2644218767 2643221639 Bacteria 6649903
432 2644247765 2643221644 Bacteria 6865017
433 2644256854 2643221646 Bacteria 6433402
434 2644292744 2643221652 Bacteria 5140275
435 2644325935 2643221658 Bacteria 6064537
436 2644397450 2643221672 Bacteria 6322190
437 2644466326 2643221683 Bacteria 5749203
438 2644647239 2643221717 Bacteria 5676132
439 2738723299 2738541277 Bacteria 7458140
440 2738885623 2738541307 Bacteria 8606193
441 2739247150 2738543012 Bacteria 7115078
442 2739284030 2738543019 Bacteria 7459457
443 2792837043 2791355137 Bacteria 9654227
444 2816476201 2816332133 Bacteria 7249298
445 2819601758 2818991446 Bacteria 7757362
446 2831268496 2831265667 Bacteria 7184833
447 2838061087 2838054893 Bacteria 7451788
448 2842680703 2842677519 Bacteria 5615038
449 2842737718 2842733646 Bacteria 5716726
450 2842752903 2842747753 Bacteria 5578255
451 2857578645 2857576091 Bacteria 5465855
452 2881102070 2881101125 Bacteria 4590519
453 2885200382 2885198086 Bacteria 7212419
454 2885214035 2885211737 Bacteria 7212420
455 2886854518 2886848708 Bacteria 5632523
456 2899928003 2899924645 Bacteria 7487985
457 2904453057 2904449895 Bacteria 6927402
458 2904459905 2904456579 Bacteria 6819253
459 2919463359 2919462493 Bacteria 5817112
460 2928039938 2928037797 Bacteria 7273642
461 2928047313 2928044640 Bacteria 7271509
462 2928057483 2928051484 Bacteria 7773759
463 2928068131 2928064002 Bacteria 7419480
464 2928072716 2928070936 Bacteria 8062541
465 2928085879 2928084124 Bacteria 7159212
466 2928120453 2928115317 Bacteria 6477646
467 2929526015 2929520902 Bacteria 6765052
468 2932426507 2932422444 Bacteria 4678430
469 2939634291 2939631187 Bacteria 6118131
470 2945914787 2945909444 Bacteria 7065066
471 2945951147 2945945610 Bacteria 5951079
472 2945974195 2945972063 Bacteria 6086495
473 2945989814 2945984333 Bacteria 7358892
474 2990714553 2990710928 Bacteria 5002431
475 Ga0439462_0006852
476 JGI24740J21852_10001224
477 JGI24743J22301_10043949
478 JGI25158J39367_1013243
479 JGI25152J39213_1001552
480 JGI25152J39213_1006408
481 JGI25150J39212_1006119
482 Ga0006759J45824_1031718
483 Ga0006759J45824_1038675
484 JGI25153J46596_10026750
485 JGI25153J46596_10028761
486 Ga0006770J48903_1024177
487 Ga0006777J48905_1013720
488 rootH1_10034260
489 rootL2_10120248
490 rootL2_10156860
491 rootH1_10036988
492 JGI26128J50194_1000006
493 JGI25160J50197_1020736
494 Ga0007417J51691_1021404
495 Ga0007410J51695_1009317
496 Ga0007410J51695_1022915
497 Ga0007409J51694_1022401
498 Ga0007416J51690_1031853
499 Ga0006562J51391_1013065
500 Ga0007429J51699_1031263
501 Ga0007411J51799_110034
502 Ga0007415J51800_107200
503 Ga0032354_1039438
504 Ga0055527_1007469
505 Ga0055535_1000833
506 Ga0055535_1006474
507 Ga0055542_1000811
508 Ga0055529_1000322
509 Ga0055524_1000140
510 Ga0055536_1058943
511 Ga0055530_10009756
512 Ga0055530_10014360
513 Ga0055530_10024350
514 Ga0055540_1003990
515 Ga0055531_10004806
516 Ga0055531_10014967
517 Ga0055543_1003188
518 Ga0058858_1018080
519 Ga0065165_1026365
520 Ga0065165_1088025
521 Ga0070676_10002282
522 Ga0070676_10030854
523 Ga0070676_10052429
524 Ga0070683_100283216
525 Ga0070690_100249172
526 Ga0070677_10035203
527 Ga0070682_100110807
528 Ga0070687_100181887
529 Ga0070661_100049810
530 Ga0070668_100250397
531 Ga0070669_100020298
532 Ga0070669_100026052
533 Ga0070675_100103048
534 Ga0070675_100150753
535 Ga0070675_100413519
536 Ga0070674_100075338
537 Ga0070674_100152064
538 Ga0070673_100218197
539 Ga0070673_100225614
540 Ga0070705_100025070
541 Ga0070700_100545394
542 Ga0070694_100007904
543 Ga0070663_100003492
544 Ga0070663_100399833
545 Ga0070678_100147019
546 Ga0070678_100253493
547 Ga0070662_100328007
548 Ga0070681_10001245
549 Ga0068867_100000552
550 Ga0068867_100318561
551 Ga0068867_100532752
552 Ga0070706_100274369
553 Ga0070699_100242433
554 Ga0070679_100105941
555 Ga0070684_100035127
556 Ga0070672_100105406
557 Ga0070672_100265443
558 Ga0070686_100105179
559 Ga0070695_100001266
560 Ga0070696_100183473
561 Ga0070704_100046248
562 Ga0068855_100079296
563 Ga0070664_100062281
564 Ga0068857_100563020
565 Ga0068852_100290433
566 Ga0068851_10015881
567 Ga0081539_10046061
568 Ga0075362_10107530
569 Ga0075366_10029148
570 Ga0075366_10042881
571 Ga0075366_10060215
572 Ga0075366_10350844
573 Ga0097621_100001348
574 Ga0097621_100131954
575 Ga0075370_10025794
576 Ga0068871_100280954
577 Ga0075430_100159725
578 Ga0075433_10035840
579 Ga0075434_100000895
580 Ga0075434_100132977
581 Ga0075436_100002331
582 Ga0075436_100056181
583 Ga0075436_100057078
584 Ga0079104_1000053
585 Ga0075435_100020698
586 Ga0075435_100171874
587 Ga0105240_10806284
588 Ga0105247_10445598
589 Ga0105243_10001789
590 Ga0105243_10378834
591 Ga0105248_11445766
592 Ga0157339_1001211
593 Ga0163162_10790770
594 Ga0157375_10200738
595 Ga0157375_10238393
596 Ga0157380_10224761
597 Ga0157380_10686365
598 Ga0182008_10157982
599 Ga0157376_10414606
600 Ga0157376_10620812
601 Ga0182007_10107409
602 Ga0163161_10150402
603 Ga0206356_10269682
604 Ga0206354_10007622
605 Ga0209672_101179
606 Ga0209672_103368
607 Ga0209147_101231
608 Ga0209258_100696
609 Ga0209258_101359
610 Ga0207425_1000501
611 Ga0207425_1000562
612 Ga0209148_1000122
613 Ga0209129_1000269
614 Ga0209129_1003034
615 Ga0209129_1030067
616 Ga0209565_1004855
617 Ga0209565_1024068
618 Ga0209455_1000083
619 Ga0209673_1000690
620 Ga0209673_1008953
621 Ga0209673_1013951
622 Ga0209130_1008830
623 Ga0209675_1007426
624 Ga0209675_1017483
625 Ga0209676_1004912
626 Ga0209676_1007067
627 Ga0209025_1019023
628 Ga0209025_1022034
629 Ga0209025_1044999
630 Ga0209564_1000300
631 Ga0209564_1011819
632 Ga0209564_1012459
633 Ga0209758_1006854
634 Ga0209758_1029420
635 Ga0209758_1029560
636 Ga0209050_1000224
637 Ga0209050_1001097
638 Ga0209256_1000045
639 Ga0209256_1010481
640 Ga0209256_1010684
641 Ga0207426_1009492
642 Ga0207426_1009647
643 Ga0209051_1000004
644 Ga0209051_1000313
645 Ga0209051_1008297
646 Ga0209051_1011804
647 Ga0209257_1000315
648 Ga0209257_1010185
649 Ga0209257_1028216
650 Ga0207656_10087178
651 Ga0207645_10125857
652 Ga0207684_10009766
653 Ga0207707_10041835
654 Ga0207671_10205096
655 Ga0207660_10298298
656 Ga0207662_10216238
657 Ga0207657_10389350
658 Ga0207649_10009290
659 Ga0207652_10314673
660 Ga0207652_10351125
661 Ga0207681_10212303
662 Ga0207694_10368402
663 Ga0207659_10182486
664 Ga0207687_10427533
665 Ga0207690_10090774
666 Ga0207706_10134853
667 Ga0207686_10669791
668 Ga0207709_10001005
669 Ga0207709_10435065
670 Ga0207691_10041144
671 Ga0207691_10133738
672 Ga0207691_10286094
673 Ga0207689_10429496
674 Ga0207679_10029503
675 Ga0207679_10145633
676 Ga0207667_10062375
677 Ga0207651_10689140
678 Ga0207712_10711273
679 Ga0207668_10074143
680 Ga0207668_10092589
681 Ga0207658_10019075
682 Ga0207658_10559180
683 Ga0207703_10448855
684 Ga0207639_10026764
685 Ga0207678_10475078
686 Ga0207648_10002176
687 Ga0207648_10149138
688 Ga0207648_10285285
689 Ga0207674_10597833
690 Ga0207675_100021254
691 Ga0207683_10161174
692 Ga0207698_10086124
693 Ga0209281_1000147
694 Ga0209973_1008804
695 Ga0209969_1011948
696 Ga0209981_1016649
697 Ga0209996_1000331
698 Ga0209984_1001403
699 Ga0209995_1001236
700 Ga0209995_1031390
701 Ga0209968_1019826
702 Ga0209999_1003422
703 Ga0209971_1008102
704 Ga0209971_1071942
705 Ga0209966_1000117
706 Ga0209998_10010535
707 Ga0209974_10008712
708 Ga0268266_10508976
709 Ga0265336_10000618
710 Ga0307515_10127712
711 Ga0307515_10217902
712 Ga0265324_10057894
713 Ga0265330_10000464
714 Ga0265330_10004608
715 Ga0265332_10000018
716 Ga0265332_10001783
717 Ga0265328_10047331
718 Ga0265325_10002138
719 Ga0265329_10002128
720 Ga0265340_10075932
721 Ga0265331_10000635
722 Ga0265327_10009087
723 Ga0265327_10010616
724 Ga0265327_10021833
725 Ga0265327_10023957
726 Ga0265316_10224059
727 Ga0307513_10120005
728 Ga0307408_100691981
729 Ga0307514_10017304
730 Ga0265314_10001491
731 Ga0265314_10121847
732 Ga0265342_10013924
733 Ga0307516_10020587
734 Ga0307516_10065214
735 Ga0307405_10385157
736 Ga0307412_10092220
737 Ga0373958_0006443
738 Ga0373936_0102927
739 Ga0373961_0003749
740 Ga0373961_0121031
741 Ga0373931_0001921
742 Ga0373931_0061298
743 Ga0395899_0410943
744 Ga0395905_0366037
745 Ga0395905_0394995
746 Ga0395901_0144460
747 Ga0436361_0771676
748 Ga0436361_0791336
749 Ga0439466_0040946
750 Ga0451797_0414767
751 Ga0451833_1140249
752 Ga0451841_0465717
753 Ga0451853_2157359
754 Ga0452268_33226
755 Ga0439431_0001654
756 Ga0439445_0016088
757 Ga0439432_118635
758 Ga0439449_0016996
759 Ga0450919_002341
760 Ga0450888_021693
761 Ga0450890_011788
762 Ga0450896_033533
763 Ga0450898_018202
764 Ga0450889_020227
765 Ga0439446_0111632
766 Ga0439458_0044629
767 Ga0439434_0014600
768 Ga0439434_0054453
769 Ga0450918_000123
770 Ga0451577_0004088
771 Ga0453683_0003443
772 Ga0453683_0094065
773 Ga0453684_0074718
774 Ga0466968_0016214
775 Ga0451576_0000909
776 Ga0451576_0049923
777 Ga0451576_0052030
778 Ga0495627_008591
779 Ga0495638_0218040
780 Ga0495651_0331710
781 Ga0495650_0016911
782 Ga0495639_0012489
783 Ga0495610_0070310
784 Ga0495616_0006407
785 Ga0495631_0009961
786 Ga0495632_0216148
787 Ga0495587_0371677
788 Ga0495609_0182216
789 Ga0495621_0017782
790 Ga0495621_0188722
791 Ga0495625_0151499
792 Ga0495588_0026324
793 Ga0495658_0068289
794 Ga0495660_0055681
795 Ga0495676_0035104
796 Ga0496101_0074792
797 Ga0496102_0004235
798 Ga0496103_0022709
799 Ga0496104_0003354
800 Ga0496108_0107610
801 Ga0496111_0102270
802 Ga0496114_0047986
803 Ga0496116_0076380
804 Ga0496124_0027342
805 Ga0496124_0420871
806 Ga0496124_0504887
807 Ga0496125_0042934
808 Ga0501306_004860
809 Ga0501306_008244
810 Ga0501308_003803
811 Ga0501308_006728
812 Ga0501309_023468
813 Ga0501310_026846
814 Ga0501304_001350
815 Ga0501305_004654
816 Ga0501305_005663
817 Ga0501307_021344
818 Ga0501292_003303
819 Ga0501298_035454
820 Ga0501311_010004
821 Ga0501312_002796
822 Ga0501312_014826
823 Ga0501312_037297
824 Ga0501313_003567
825 Ga0501316_021927
826 Ga0501317_001907
827 Ga0501317_049908
828 Ga0501318_005102
829 Ga0501319_000100
830 Ga0501319_001480
831 Ga0501320_000117
832 Ga0501320_001756
833 Ga0501320_006516
834 Ga0501320_007924
835 Ga0501323_000907
836 Ga0501323_009216
837 Ga0501325_001184
838 Ga0501329_02168
839 Ga0501334_02520
840 Ga0501335_003844
841 Ga0501337_000224
842 Ga0501034_0215137
843 Ga0501037_0388073
844 Ga0501039_0480871
845 Ga0501198_000043
846 Ga0501206_019380
847 Ga0501222_000051
848 Ga0501253_005661
849 Ga0501265_002364
850 Ga0501266_031103
851 Ga0501280_001594
852 Ga0501044_0652370
853 nmdc:mga03683_117953_c1
854 nmdc:mga0k408_1021_c1
855 nmdc:mga0k408_179204_c1
856 nmdc:mga0k408_223236_c1
857 nmdc:mga0k408_435442_c1
858 nmdc:mga0k408_60623_c1
859 nmdc:mga06z11_347050_c1
860 nmdc:mga06z11_68404_c1
861 nmdc:mga07m45_200893_c1
862 nmdc:mga07m45_65556_c1
863 nmdc:mga07m45_74067_c1
864 nmdc:mga0qj67_225567_c1
865 nmdc:mga0n895_570_c1
866 nmdc:mga0rr50_450116_c1
867 nmdc:mga0rr50_549647_c1
868 nmdc:mga0rr50_7779_c1
869 nmdc:mga08x19_15557_c1
870 nmdc:mga08x19_16375_c1
871 nmdc:mga08x19_333175_c1
872 nmdc:mga0a205_16068_c1
873 Ga0500651_0000076
874 Ga0500593_020089
875 Ga0500608_014714
876 Ga0500655_001275
877 Ga0500658_0000913
878 Ga0500658_0010142
879 Ga0500559_0011421
880 Ga0500574_000502
881 Ga0500616_0038297
882 Ga0500619_000012
883 Ga0590071_051845
884 Ga0590077_017282
885 Ga0587084_004600
886 Ga0587084_005015
887 Ga0587093_000110
888 Ga0587093_020661
889 Ga0587088_018506
890 Ga0587092_008739
891 Ga0587101_010054
892 Ga0587062_027529
893 Ga0587100_000209
894 2513231523
895 2548501868
896 2599626684
897 2599675930
898 2599684221
899 2599696235
900 2643865334
901 2643992264
902 2644060998
903 2644071694
904 2644218767
905 2644247765
906 2644256854
907 2644292744
908 2644325935
909 2644397450
910 2644466326
911 2644647239
912 2738723299
913 2738885623
914 2739247150
915 2739284030
916 2792837043
917 2816476201
918 2819601758
919 2831268496
920 2838061087
921 2842680703
922 2842737718
923 2842752903
924 2857578645
925 2881102070
926 2885200382
927 2885214035
928 2886854518
929 2899928003
930 2904453057
931 2904459905
932 2919463359
933 2928039938
934 2928047313
935 2928057483
936 2928068131
937 2928072716
938 2928085879
939 2928120453
940 2929526015
941 2932426507
942 2939634291
943 2945914787
944 2945951147
945 2945974195
946 2945989814
947 2990714553

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

68

230

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8107 7 216
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8014 7 216
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.8013 7 216
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.7969 7 216
6ppf-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class b 0.7917 7 216
ID Description Score Start End Superfamily
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8965 8 216 2.40.30.10
af_Q2FW06_34_105_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6893 39 103 3.30.160.810
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6737 39 103 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6628 39 103 3.30.160.810
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6459 39 103 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A3B9LAN4-F1-model_v4 50S ribosomal protein L3 0.7772 8 128 GO:0003735
GO:0006412
GO:0022625
AF-A0A3B9LAN4-F1-model_v4 50S ribosomal protein L3 0.7712 8 128 GO:0003735
GO:0006412
GO:0022625
AF-A0A2G6EGS8-F1-model_v4 50S ribosomal protein L3 0.7376 6 133 GO:0003735
GO:0006412
GO:0022625
AF-A0A2G6EGS8-F1-model_v4 50S ribosomal protein L3 0.727 6 133 GO:0003735
GO:0006412
GO:0022625
AF-A0A7X5F9K6-F1-model_v4 50S ribosomal protein L3 0.7186 7 215 GO:0003735
GO:0006412
GO:0022625

Map