F451105

General Info

Members Datasets Scaffolds Average Seq Length
473 234 946 177

Family's Representative Sequence

Representative Sequence 3300049758|Ga0501241_005561|Ga0501241_005561_59_664
Length 201
Sequence MQTKDNFTLVLLSNLAGLINLMLERMKKYILIGLLLFTGLGAFAQKFAYVDTEYILKHLPEYKSSLNQLNVLSEQWQQQVDNNFTEIDKMYKAYQADQVLLTEDMRKRRENEIIEKEKQAKDFQRKIFGPDGDLFQTRTKLLSPIQDKVTKAIGEVAKAKFFDFIFDKSSEATMMIYASSSYDVSNDVITRLGYKPGSVLK

Samples

Sample ID Description Type Environment
1 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
204 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
205 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
212 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
213 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
214 2738541283 Pedobacter sp. OK701 Isolate Unclassified
215 2738541284 Pedobacter sp. YR016 Isolate Unclassified
216 2738541302 Pedobacter sp. CF074 Isolate Unclassified
217 2739367651 Pedobacter sp. OK291 Isolate Unclassified
218 2739367656 Pedobacter sp. CF523 Isolate Unclassified
219 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
220 2818991437 Pedobacter terrae 518 Isolate Unclassified
221 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
222 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
223 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
224 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
225 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
226 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
227 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
228 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
229 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
230 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
231 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
232 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
233 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
234 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.08
Metatranscriptomes 1.06
Isolates 4.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.03
Nodule 0
Rhizoplane 0.63
Rhizosphere 84.57
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501241_005561 3300049758 Bacteria 2347
2 SwRhRL2b_contig_1228013 2162886007 Bacteria 2690
3 SwRhRL2b_contig_834969 2162886007 Bacteria 10239
4 JGI24736J21556_1003974 3300001904 Bacteria 2543
5 JGI24739J22299_10026514 3300001989 Bacteria 2032
6 JGI24737J22298_10005348 3300001990 Bacteria 4439
7 JGI24737J22298_10014628 3300001990 Bacteria 2546
8 JGI24735J21928_10000013 3300002067 Bacteria 208663
9 JGI24735J21928_10020637 3300002067 Bacteria 2017
10 JGI24744J21845_10010791 3300002077 Bacteria 1870
11 JGI25162J39368_1000107 3300002737 Bacteria 90782
12 JGI25164J39214_1001450 3300002772 Bacteria 5467
13 JGI25152J39213_1000195 3300002773 Bacteria 40804
14 JGI25150J39212_1000014 3300002774 Bacteria 170955
15 JGI25151J46595_10000042 3300003187 Bacteria 170955
16 JGI25165J46597_1000157 3300003214 Bacteria 108987
17 JGI25153J46596_10000009 3300003215 Bacteria 340925
18 rootH1_10143457 3300003316 Bacteria 4247
19 rootH2_10005336 3300003320 Bacteria 90063
20 rootH1_10004961 3300003323 Bacteria 35392
21 rootH1_10058453 3300003323 Bacteria 2184
22 rootH1_10249225 3300003323 Bacteria 1440
23 Ga0055536_1000019 3300003781 Bacteria 203087
24 Ga0055530_10003097 3300003791 Bacteria 9861
25 Ga0058863_11202680 3300004799 Bacteria 4595
26 Ga0058862_12019096 3300004803 Bacteria 1421
27 Ga0065714_10002525 3300005288 Bacteria 27682
28 Ga0065714_10003416 3300005288 Bacteria 11239
29 Ga0065714_10004756 3300005288 Bacteria 4492
30 Ga0065714_10031937 3300005288 Bacteria 986
31 Ga0065714_10064969 3300005288 Bacteria 14694
32 Ga0065704_10000301 3300005289 Bacteria 42046
33 Ga0065704_10077293 3300005289 Bacteria 4765
34 Ga0070658_10195699 3300005327 Bacteria 1704
35 Ga0070658_10319799 3300005327 Bacteria 1325
36 Ga0070658_11027880 3300005327 Bacteria 717
37 Ga0070676_10000004 3300005328 Bacteria 82919
38 Ga0070683_100229422 3300005329 Bacteria 1765
39 Ga0068869_100307586 3300005334 Bacteria 1282
40 Ga0070680_100010029 3300005336 Bacteria 7298
41 Ga0070680_100088239 3300005336 Bacteria 2565
42 Ga0068868_100034474 3300005338 Bacteria 3908
43 Ga0070660_100006900 3300005339 Bacteria 7878
44 Ga0070660_100099194 3300005339 Bacteria 2306
45 Ga0070660_100820161 3300005339 Unclassified 783
46 Ga0070660_100961576 3300005339 Bacteria 721
47 Ga0070661_100163245 3300005344 Bacteria 1688
48 Ga0070675_100131118 3300005354 Bacteria 2136
49 Ga0070671_100029894 3300005355 Bacteria 4494
50 Ga0070674_100049501 3300005356 Bacteria 2889
51 Ga0070673_100007441 3300005364 Bacteria 7222
52 Ga0070673_101320225 3300005364 Bacteria 678
53 Ga0070659_100000648 3300005366 Bacteria 25427
54 Ga0070659_100005324 3300005366 Bacteria 9233
55 Ga0070659_100194260 3300005366 Bacteria 1669
56 Ga0070678_100001135 3300005456 Bacteria 14048
57 Ga0070662_100000014 3300005457 Bacteria 110124
58 Ga0070662_100728967 3300005457 Bacteria 840
59 Ga0070681_10003603 3300005458 Bacteria 14518
60 Ga0068867_100004612 3300005459 Bacteria 9698
61 Ga0070679_100053436 3300005530 Bacteria 4021
62 Ga0070679_100237004 3300005530 Bacteria 1783
63 Ga0070684_100079582 3300005535 Unclassified 2897
64 Ga0068853_100013243 3300005539 Bacteria 6731
65 Ga0068853_100038942 3300005539 Bacteria 4052
66 Ga0068853_100045399 3300005539 Bacteria 3763
67 Ga0068853_100137656 3300005539 Bacteria 2190
68 Ga0068853_100144670 3300005539 Bacteria 2136
69 Ga0070672_100197335 3300005543 Bacteria 1682
70 Ga0070665_100000032 3300005548 Bacteria 333352
71 Ga0068855_100000517 3300005563 Bacteria 47550
72 Ga0068855_100032958 3300005563 Bacteria 6185
73 Ga0068855_100066880 3300005563 Bacteria 4189
74 Ga0068855_100127601 3300005563 Bacteria 2907
75 Ga0068855_100155510 3300005563 Bacteria 2598
76 Ga0068855_100178733 3300005563 Bacteria 2400
77 Ga0068855_100462333 3300005563 Bacteria 1383
78 Ga0068855_101236191 3300005563 Bacteria 775
79 Ga0068857_100019073 3300005577 Bacteria 6019
80 Ga0068854_100006869 3300005578 Bacteria 7258
81 Ga0068854_100351075 3300005578 Bacteria 1207
82 Ga0068856_100000960 3300005614 Bacteria 30788
83 Ga0068856_100013917 3300005614 Bacteria 7782
84 Ga0068856_100039386 3300005614 Bacteria 4640
85 Ga0068856_100277297 3300005614 Bacteria 1693
86 Ga0068856_100364762 3300005614 Bacteria 1463
87 Ga0068852_100063564 3300005616 Bacteria 3214
88 Ga0068852_100380292 3300005616 Bacteria 1385
89 Ga0068852_101113045 3300005616 Bacteria 810
90 Ga0068852_101235907 3300005616 Bacteria 768
91 Ga0068866_10018250 3300005718 Bacteria 3169
92 Ga0068866_10060832 3300005718 Bacteria 1959
93 Ga0068858_100406825 3300005842 Bacteria 1308
94 Ga0075366_10001935 3300006195 Bacteria 10467
95 Ga0097621_100001338 3300006237 Bacteria 16956
96 Ga0097621_100499949 3300006237 Bacteria 1101
97 Ga0075370_10154537 3300006353 Bacteria 1345
98 Ga0068871_100000294 3300006358 Bacteria 34890
99 Ga0068871_100505947 3300006358 Bacteria 1089
100 Ga0068865_100000045 3300006881 Bacteria 70227
101 Ga0105240_10000103 3300009093 Bacteria 172981
102 Ga0105240_10024698 3300009093 Bacteria 7915
103 Ga0105240_10127127 3300009093 Bacteria 3061
104 Ga0105240_10146866 3300009093 Bacteria 2813
105 Ga0105240_10156262 3300009093 Bacteria 2712
106 Ga0105240_10165596 3300009093 Bacteria 2622
107 Ga0105240_10200838 3300009093 Bacteria 2336
108 Ga0105240_10416711 3300009093 Bacteria 1510
109 Ga0105240_11140179 3300009093 Unclassified 828
110 Ga0105240_11712176 3300009093 Bacteria 656
111 Ga0105243_10405162 3300009148 Bacteria 1268
112 Ga0105241_10000835 3300009174 Bacteria 23355
113 Ga0105241_10001189 3300009174 Bacteria 19876
114 Ga0105241_10025857 3300009174 Bacteria 4364
115 Ga0105241_10052337 3300009174 Bacteria 3117
116 Ga0105241_10242432 3300009174 Bacteria 1525
117 Ga0105241_10366649 3300009174 Bacteria 1255
118 Ga0105242_10013093 3300009176 Bacteria 6399
119 Ga0105242_10271154 3300009176 Unclassified 1537
120 Ga0105242_11102479 3300009176 Bacteria 808
121 Ga0105237_10000578 3300009545 Bacteria 51257
122 Ga0105237_10001647 3300009545 Bacteria 28970
123 Ga0105237_10003311 3300009545 Bacteria 19201
124 Ga0105237_10005389 3300009545 Bacteria 14455
125 Ga0105237_10005538 3300009545 Bacteria 14237
126 Ga0105237_10009387 3300009545 Bacteria 10479
127 Ga0105237_10023569 3300009545 Bacteria 6305
128 Ga0105237_10355586 3300009545 Bacteria 1469
129 Ga0105238_10032636 3300009551 Bacteria 5298
130 Ga0105238_10397159 3300009551 Bacteria 1372
131 Ga0105238_10567883 3300009551 Bacteria 1140
132 Ga0105249_10211976 3300009553 Bacteria 1901
133 Ga0105239_10000001 3300010375 Bacteria 617353
134 Ga0105239_10000007 3300010375 Bacteria 385297
135 Ga0105239_10000212 3300010375 Bacteria 85747
136 Ga0105239_10000352 3300010375 Bacteria 67522
137 Ga0105239_10004099 3300010375 Bacteria 17523
138 Ga0105239_10015494 3300010375 Bacteria 8444
139 Ga0105239_10037544 3300010375 Bacteria 5308
140 Ga0105239_10109843 3300010375 Bacteria 3057
141 Ga0105239_10511345 3300010375 Bacteria 1366
142 Ga0105239_10947860 3300010375 Bacteria 988
143 Ga0105239_11863666 3300010375 Unclassified 697
144 Ga0105246_10459024 3300011119 Bacteria 1072
145 Ga0105246_10693017 3300011119 Unclassified 892
146 Ga0157373_10000245 3300013100 Bacteria 44563
147 Ga0157373_10002793 3300013100 Bacteria 13213
148 Ga0157373_10005931 3300013100 Bacteria 9142
149 Ga0157373_10047530 3300013100 Bacteria 3061
150 Ga0157373_10051008 3300013100 Bacteria 2946
151 Ga0157373_10224646 3300013100 Bacteria 1325
152 Ga0157373_10291842 3300013100 Bacteria 1156
153 Ga0157371_10000266 3300013102 Bacteria 71146
154 Ga0157371_10000918 3300013102 Bacteria 33144
155 Ga0157371_10001041 3300013102 Bacteria 30406
156 Ga0157371_10004488 3300013102 Bacteria 12174
157 Ga0157371_10006470 3300013102 Bacteria 9654
158 Ga0157371_10046419 3300013102 Bacteria 3090
159 Ga0157370_10000197 3300013104 Bacteria 75846
160 Ga0157370_10006873 3300013104 Bacteria 12456
161 Ga0157370_10009264 3300013104 Bacteria 10549
162 Ga0157370_10012793 3300013104 Bacteria 8675
163 Ga0157370_10032431 3300013104 Bacteria 5102
164 Ga0157370_10060023 3300013104 Bacteria 3612
165 Ga0157370_10078024 3300013104 Bacteria 3119
166 Ga0157370_10101804 3300013104 Bacteria 2690
167 Ga0157370_10227778 3300013104 Bacteria 1725
168 Ga0157369_10000031 3300013105 Bacteria 203214
169 Ga0157369_10000958 3300013105 Bacteria 36639
170 Ga0157369_10056317 3300013105 Bacteria 4242
171 Ga0157369_10071350 3300013105 Bacteria 3729
172 Ga0157374_10001192 3300013296 Bacteria 22198
173 Ga0157374_10001268 3300013296 Bacteria 21543
174 Ga0157374_10073445 3300013296 Bacteria 3229
175 Ga0157374_10132262 3300013296 Bacteria 2415
176 Ga0157374_10174083 3300013296 Bacteria 2100
177 Ga0157374_10389719 3300013296 Bacteria 1388
178 Ga0157378_10072999 3300013297 Bacteria 3084
179 Ga0157378_10075969 3300013297 Bacteria 3026
180 Ga0163162_10000010 3300013306 Bacteria 302032
181 Ga0163162_10000093 3300013306 Bacteria 82738
182 Ga0163162_10001288 3300013306 Bacteria 23443
183 Ga0163162_10066340 3300013306 Bacteria 3658
184 Ga0163162_10147212 3300013306 Bacteria 2472
185 Ga0157372_10000073 3300013307 Bacteria 107356
186 Ga0157372_10000173 3300013307 Bacteria 71416
187 Ga0157372_10001629 3300013307 Bacteria 24359
188 Ga0157372_10020255 3300013307 Bacteria 7174
189 Ga0157372_10071137 3300013307 Bacteria 3917
190 Ga0157372_10102100 3300013307 Bacteria 3275
191 Ga0157372_10516269 3300013307 Bacteria 1393
192 Ga0157375_10007954 3300013308 Bacteria 9284
193 Ga0157375_10084119 3300013308 Bacteria 3229
194 Ga0157375_10564462 3300013308 Bacteria 1299
195 Ga0182008_10000024 3300014497 Bacteria 199978
196 Ga0182008_10000082 3300014497 Bacteria 74716
197 Ga0182008_10000503 3300014497 Bacteria 29456
198 Ga0182008_10350566 3300014497 Bacteria 783
199 Ga0157377_10139061 3300014745 Bacteria 1490
200 Ga0157377_10267965 3300014745 Bacteria 1114
201 Ga0182006_1001579 3300015261 Bacteria 13517
202 Ga0182006_1002473 3300015261 Bacteria 10081
203 Ga0182006_1013801 3300015261 Bacteria 3495
204 Ga0182007_10000002 3300015262 Bacteria 564661
205 Ga0182007_10006896 3300015262 Bacteria 4829
206 Ga0183373_1004 3300015682 Bacteria 537398
207 Ga0163161_10000856 3300017792 Bacteria 23716
208 Ga0163161_10010987 3300017792 Bacteria 6274
209 Ga0163161_10011241 3300017792 Bacteria 6203
210 Ga0163161_10025143 3300017792 Bacteria 4212
211 Ga0206351_10309955 3300020077 Bacteria 1152
212 Ga0206350_11487925 3300020080 Bacteria 1084
213 Ga0213872_10013855 3300021361 Bacteria 3769
214 Ga0224712_10055006 3300022467 Bacteria 1564
215 Ga0209563_109934 3300025230 Bacteria 1417
216 Ga0207427_100025 3300025231 Bacteria 433726
217 Ga0209437_100010 3300025233 Bacteria 838447
218 Ga0209437_100148 3300025233 Bacteria 158795
219 Ga0207425_1000023 3300025245 Bacteria 341339
220 Ga0209026_1000430 3300025250 Bacteria 35017
221 Ga0209026_1000498 3300025250 Bacteria 28577
222 Ga0209026_1003024 3300025250 Bacteria 5798
223 Ga0209129_1000032 3300025258 Bacteria 341150
224 Ga0209129_1004071 3300025258 Bacteria 5956
225 Ga0209233_1000017 3300025261 Bacteria 898076
226 Ga0209233_1003153 3300025261 Bacteria 5849
227 Ga0209455_1003251 3300025272 Bacteria 5852
228 Ga0209676_1000009 3300025292 Bacteria 981719
229 Ga0209025_1000047 3300025294 Bacteria 341150
230 Ga0209758_1000145 3300025297 Bacteria 170553
231 Ga0209050_1000094 3300025298 Bacteria 242893
232 Ga0207647_10000022 3300025904 Bacteria 118094
233 Ga0207647_10002110 3300025904 Bacteria 15216
234 Ga0207647_10008445 3300025904 Bacteria 7384
235 Ga0207647_10085426 3300025904 Bacteria 1887
236 Ga0207645_10000908 3300025907 Bacteria 24560
237 Ga0207705_10000045 3300025909 Bacteria 180625
238 Ga0207705_10237781 3300025909 Bacteria 1387
239 Ga0207705_10720284 3300025909 Bacteria 775
240 Ga0207654_10000605 3300025911 Bacteria 20243
241 Ga0207654_10001374 3300025911 Bacteria 12903
242 Ga0207654_10051992 3300025911 Bacteria 2360
243 Ga0207654_10093678 3300025911 Bacteria 1837
244 Ga0207707_10002289 3300025912 Bacteria 17267
245 Ga0207695_10000019 3300025913 Bacteria 732137
246 Ga0207695_10004821 3300025913 Bacteria 18242
247 Ga0207695_10015441 3300025913 Bacteria 8991
248 Ga0207695_10028266 3300025913 Bacteria 6224
249 Ga0207695_10109697 3300025913 Bacteria 2741
250 Ga0207695_10111650 3300025913 Bacteria 2712
251 Ga0207695_10136198 3300025913 Bacteria 2408
252 Ga0207695_10520241 3300025913 Unclassified 1071
253 Ga0207695_10840310 3300025913 Bacteria 798
254 Ga0207695_11039321 3300025913 Unclassified 699
255 Ga0207671_10005216 3300025914 Bacteria 12079
256 Ga0207671_10006136 3300025914 Bacteria 10800
257 Ga0207671_10006364 3300025914 Bacteria 10529
258 Ga0207671_10026282 3300025914 Bacteria 4365
259 Ga0207671_10138540 3300025914 Unclassified 1873
260 Ga0207660_10009176 3300025917 Bacteria 6405
261 Ga0207660_10314162 3300025917 Bacteria 1250
262 Ga0207657_10067727 3300025919 Bacteria 3035
263 Ga0207657_10097330 3300025919 Bacteria 2447
264 Ga0207657_10293197 3300025919 Bacteria 1290
265 Ga0207657_10819360 3300025919 Bacteria 719
266 Ga0207649_10131062 3300025920 Bacteria 1703
267 Ga0207652_10013519 3300025921 Bacteria 6602
268 Ga0207694_10256974 3300025924 Bacteria 1430
269 Ga0207694_10831278 3300025924 Bacteria 780
270 Ga0207644_10011765 3300025931 Bacteria 5793
271 Ga0207690_10000766 3300025932 Bacteria 20779
272 Ga0207690_10016419 3300025932 Bacteria 4503
273 Ga0207690_10019300 3300025932 Bacteria 4196
274 Ga0207706_10000057 3300025933 Bacteria 112805
275 Ga0207706_10615757 3300025933 Bacteria 932
276 Ga0207686_10017006 3300025934 Bacteria 4089
277 Ga0207686_10143801 3300025934 Unclassified 1652
278 Ga0207669_10006724 3300025937 Bacteria 5276
279 Ga0207704_10007798 3300025938 Bacteria 5080
280 Ga0207691_10165869 3300025940 Bacteria 1936
281 Ga0207661_10181198 3300025944 Bacteria 1840
282 Ga0207667_10000015 3300025949 Bacteria 417534
283 Ga0207667_10000644 3300025949 Bacteria 45263
284 Ga0207667_10038868 3300025949 Bacteria 5075
285 Ga0207667_10056016 3300025949 Bacteria 4143
286 Ga0207667_10094508 3300025949 Bacteria 3086
287 Ga0207667_11003319 3300025949 Bacteria 822
288 Ga0207651_10074740 3300025960 Bacteria 2414
289 Ga0207712_10288379 3300025961 Bacteria 1342
290 Ga0207640_10002888 3300025981 Bacteria 9216
291 Ga0207640_10183207 3300025981 Bacteria 1572
292 Ga0207677_10019972 3300026023 Bacteria 4058
293 Ga0207703_10165775 3300026035 Bacteria 1939
294 Ga0207639_10013790 3300026041 Bacteria 5666
295 Ga0207639_10046856 3300026041 Bacteria 3264
296 Ga0207639_10052102 3300026041 Bacteria 3117
297 Ga0207678_10042934 3300026067 Bacteria 3914
298 Ga0207702_10001544 3300026078 Bacteria 22767
299 Ga0207702_10020026 3300026078 Bacteria 5544
300 Ga0207702_10020052 3300026078 Bacteria 5540
301 Ga0207702_10035264 3300026078 Bacteria 4183
302 Ga0207702_10225018 3300026078 Bacteria 1750
303 Ga0207648_10003208 3300026089 Bacteria 17220
304 Ga0207674_10033191 3300026116 Bacteria 5405
305 Ga0207683_10059471 3300026121 Bacteria 3357
306 Ga0207698_10000827 3300026142 Bacteria 17910
307 Ga0207698_10294859 3300026142 Bacteria 1507
308 Ga0207698_11268935 3300026142 Bacteria 751
309 Ga0268266_10000030 3300028379 Bacteria 417120
310 Ga0307517_10002681 3300028786 Bacteria 28427
311 Ga0307515_10000376 3300028794 Bacteria 109190
312 Ga0307515_10018566 3300028794 Bacteria 12570
313 Ga0307515_10186908 3300028794 Bacteria 1997
314 Ga0316181_1098129 3300030744 Bacteria 2570
315 Ga0307513_10209894 3300031456 Bacteria 1780
316 Ga0307408_100008258 3300031548 Bacteria 6871
317 Ga0307408_100680229 3300031548 Bacteria 923
318 Ga0307405_10000015 3300031731 Bacteria 206299
319 Ga0307405_10219877 3300031731 Unclassified 1393
320 Ga0307413_10286872 3300031824 Bacteria 1241
321 Ga0307407_10000027 3300031903 Bacteria 107307
322 Ga0307412_10000030 3300031911 Bacteria 208541
323 Ga0307412_10037291 3300031911 Bacteria 3122
324 Ga0307412_10170434 3300031911 Bacteria 1627
325 Ga0307412_10399549 3300031911 Bacteria 1118
326 Ga0307412_10487871 3300031911 Bacteria 1023
327 Ga0307409_100090749 3300031995 Bacteria 2502
328 Ga0307416_100000002 3300032002 Bacteria 509907
329 Ga0307414_10000262 3300032004 Bacteria 33057
330 Ga0307414_10009932 3300032004 Bacteria 5491
331 Ga0307414_10021675 3300032004 Bacteria 4039
332 Ga0307414_10050018 3300032004 Bacteria 2893
333 Ga0307414_10071046 3300032004 Bacteria 2509
334 Ga0307414_10156155 3300032004 Bacteria 1806
335 Ga0307414_10254031 3300032004 Bacteria 1463
336 Ga0307414_10276752 3300032004 Bacteria 1408
337 Ga0307414_10292699 3300032004 Bacteria 1373
338 Ga0307414_10469459 3300032004 Unclassified 1107
339 Ga0307414_10578514 3300032004 Bacteria 1004
340 Ga0307411_10045105 3300032005 Bacteria 2834
341 Ga0307411_10286943 3300032005 Bacteria 1313
342 Ga0307507_10003702 3300033179 Bacteria 28885
343 Ga0307510_10000464 3300033180 Bacteria 39482
344 Ga0373941_0066666 3300035115 Bacteria 1185
345 Ga0395899_0000001 3300037312 Bacteria 1750322
346 Ga0395899_0000209 3300037312 Bacteria 85489
347 Ga0395899_0005213 3300037312 Bacteria 10108
348 Ga0395899_0006710 3300037312 Bacteria 8917
349 Ga0395900_0002637 3300037418 Bacteria 19590
350 Ga0395900_0003042 3300037418 Bacteria 18269
351 Ga0395898_0030948 3300037466 Bacteria 5352
352 Ga0395905_0000175 3300037471 Bacteria 104024
353 Ga0395905_0000981 3300037471 Bacteria 36581
354 Ga0395905_0379734 3300037471 Bacteria 1307
355 Ga0395901_0000313 3300038443 Bacteria 59766
356 Ga0395901_0006459 3300038443 Bacteria 11878
357 Ga0395901_0386306 3300038443 Bacteria 1440
358 Ga0436361_0826589 3300039447 Bacteria 6397
359 Ga0451802_1385587 3300041460 Bacteria 1044
360 Ga0451807_1566446 3300041486 Bacteria 1994
361 Ga0451833_0253040 3300041491 Bacteria 937
362 Ga0451841_0541331 3300041498 Bacteria 592
363 Ga0439448_0022452 3300042005 Bacteria 1961
364 Ga0439455_0013236 3300042012 Bacteria 1865
365 Ga0466966_0097593 3300044684 Bacteria 1819
366 Ga0466961_0041495 3300044693 Bacteria 2950
367 Ga0466958_0045362 3300045836 Bacteria 2651
368 Ga0495627_015273 3300046453 Bacteria 2654
369 Ga0495592_0101599 3300046454 Bacteria 2049
370 Ga0495651_0125297 3300046462 Bacteria 1882
371 Ga0495651_0132698 3300046462 Bacteria 1816
372 Ga0495650_0000162 3300046471 Bacteria 148927
373 Ga0495650_0068078 3300046471 Bacteria 1405
374 Ga0495605_0037534 3300046474 Bacteria 2436
375 Ga0495585_0000153 3300046492 Bacteria 74267
376 Ga0495585_0000853 3300046492 Bacteria 26111
377 Ga0495585_0151449 3300046492 Bacteria 1209
378 Ga0495596_0018860 3300046500 Bacteria 2840
379 Ga0495583_0036412 3300046506 Bacteria 2341
380 Ga0495583_0087453 3300046506 Bacteria 1346
381 Ga0495606_0000033 3300046507 Bacteria 247739
382 Ga0495606_0035896 3300046507 Bacteria 3384
383 Ga0495606_0060769 3300046507 Bacteria 2419
384 Ga0495606_0063167 3300046507 Bacteria 2361
385 Ga0495606_0069868 3300046507 Bacteria 2217
386 Ga0495610_0000768 3300046512 Bacteria 30249
387 Ga0495610_0002354 3300046512 Bacteria 15971
388 Ga0495616_0005550 3300046513 Bacteria 7743
389 Ga0495616_0005656 3300046513 Bacteria 7654
390 Ga0495618_0386343 3300046514 Bacteria 858
391 Ga0495631_0010907 3300046518 Bacteria 4485
392 Ga0495637_0127520 3300046520 Bacteria 974
393 Ga0495637_0163899 3300046520 Bacteria 832
394 Ga0495648_0025326 3300046524 Bacteria 4018
395 Ga0495648_0059526 3300046524 Bacteria 2278
396 Ga0495648_0295203 3300046524 Bacteria 762
397 Ga0495652_0124076 3300046529 Bacteria 2055
398 Ga0495652_0500263 3300046529 Bacteria 843
399 Ga0495609_0001772 3300046538 Bacteria 13870
400 Ga0495609_0052751 3300046538 Bacteria 1809
401 Ga0495633_0000389 3300046558 Bacteria 46261
402 Ga0495633_0003449 3300046558 Bacteria 10516
403 Ga0495633_0070113 3300046558 Bacteria 1636
404 Ga0495667_0830451 3300046559 Bacteria 569
405 Ga0495668_0000009 3300046616 Bacteria 492623
406 Ga0495625_0000131 3300046660 Bacteria 117738
407 Ga0495625_0000867 3300046660 Bacteria 41148
408 Ga0495625_0000951 3300046660 Bacteria 38714
409 Ga0495625_0022678 3300046660 Bacteria 4809
410 Ga0495625_0024395 3300046660 Bacteria 4604
411 Ga0495625_0049998 3300046660 Bacteria 3002
412 Ga0495625_0060367 3300046660 Bacteria 2686
413 Ga0495625_0063977 3300046660 Bacteria 2596
414 Ga0495661_0005171 3300046665 Bacteria 9292
415 Ga0495661_0005492 3300046665 Bacteria 8994
416 Ga0495646_0177700 3300046680 Bacteria 1170
417 Ga0495658_0019197 3300046683 Bacteria 3565
418 Ga0495671_0097139 3300046692 Bacteria 1441
419 Ga0495671_0184333 3300046692 Bacteria 1014
420 Ga0495649_0000009 3300046694 Bacteria 451725
421 Ga0495600_0241936 3300046809 Bacteria 1150
422 Ga0495660_0003893 3300046810 Bacteria 9127
423 Ga0495683_0092960 3300047323 Bacteria 1459
424 Ga0495683_0095205 3300047323 Unclassified 1438
425 Ga0495687_001889 3300047443 Bacteria 18066
426 Ga0495687_004663 3300047443 Bacteria 9146
427 Ga0495673_0022106 3300047469 Bacteria 3123
428 Ga0495686_0000973 3300047472 Bacteria 35208
429 Ga0495686_0034656 3300047472 Bacteria 3249
430 Ga0495686_0042781 3300047472 Bacteria 2877
431 Ga0495686_0078327 3300047472 Bacteria 2023
432 Ga0495614_0044265 3300048089 Bacteria 1909
433 Ga0495626_0058724 3300048091 Bacteria 1757
434 Ga0496122_0000869 3300048925 Bacteria 56890
435 Ga0496123_0009832 3300048926 Bacteria 8542
436 Ga0495678_004234 3300049459 Bacteria 8417
437 Ga0501035_0941998 3300049822 Bacteria 682
438 nmdc:mga0k408_3829_c1 3300050493 Bacteria 7978
439 nmdc:mga0k408_544998_c1 3300050493 Bacteria 686
440 nmdc:mga07m45_142874_c1 3300050496 Bacteria 1386
441 Ga0500635_0022030 3300053080 Bacteria 1971
442 Ga0500651_0000455 3300053093 Bacteria 21853
443 Ga0500608_031279 3300053122 Bacteria 2525
444 Ga0500608_096051 3300053122 Bacteria 1378
445 Ga0500618_000012 3300053125 Bacteria 185382
446 Ga0500642_0063813 3300053130 Bacteria 1661
447 Ga0500561_0015344 3300053137 Bacteria 1698
448 Ga0500568_0069878 3300053139 Bacteria 1346
449 Ga0500622_0000838 3300053156 Bacteria 26284
450 Ga0500624_000118 3300053157 Bacteria 35980
451 2586206301 2585427687 Bacteria 5544917
452 2599480388 2599185184 Bacteria 6430550
453 2738755411 2738541283 Bacteria 7222293
454 2738763534 2738541284 Bacteria 5199923
455 2738856150 2738541302 Bacteria 5944758
456 2739588289 2739367651 Bacteria 6359826
457 2739613938 2739367656 Bacteria 5152243
458 2776615028 2775506987 Bacteria 5373360
459 2819546267 2818991437 Bacteria 5805520
460 2842723904 2842722452 Bacteria 6263924
461 2842912364 2842909656 Bacteria 6185908
462 2849282797 2849281842 Bacteria 6065644
463 2852624801 2852623160 Bacteria 4376875
464 2857629293 2857627736 Bacteria 5625397
465 2884936311 2884933994 Bacteria 4535041
466 2904446538 2904445276 Bacteria 5310396
467 2919438306 2919437846 Bacteria 6199444
468 2928083370 2928078545 Bacteria 6534839
469 2928151368 2928147474 Bacteria 6512076
470 2932087285 2932082852 Bacteria 6563563
471 2945999351 2945997725 Bacteria 6404843
472 2954021748 2954016120 Bacteria 6446024
473 2977236022 2977232053 Bacteria 5485925
474 Ga0501241_005561
475 SwRhRL2b_contig_1228013
476 SwRhRL2b_contig_834969
477 JGI24736J21556_1003974
478 JGI24739J22299_10026514
479 JGI24737J22298_10005348
480 JGI24737J22298_10014628
481 JGI24735J21928_10000013
482 JGI24735J21928_10020637
483 JGI24744J21845_10010791
484 JGI25162J39368_1000107
485 JGI25164J39214_1001450
486 JGI25152J39213_1000195
487 JGI25150J39212_1000014
488 JGI25151J46595_10000042
489 JGI25165J46597_1000157
490 JGI25153J46596_10000009
491 rootH1_10143457
492 rootH2_10005336
493 rootH1_10004961
494 rootH1_10058453
495 rootH1_10249225
496 Ga0055536_1000019
497 Ga0055530_10003097
498 Ga0058863_11202680
499 Ga0058862_12019096
500 Ga0065714_10002525
501 Ga0065714_10003416
502 Ga0065714_10004756
503 Ga0065714_10031937
504 Ga0065714_10064969
505 Ga0065704_10000301
506 Ga0065704_10077293
507 Ga0070658_10195699
508 Ga0070658_10319799
509 Ga0070658_11027880
510 Ga0070676_10000004
511 Ga0070683_100229422
512 Ga0068869_100307586
513 Ga0070680_100010029
514 Ga0070680_100088239
515 Ga0068868_100034474
516 Ga0070660_100006900
517 Ga0070660_100099194
518 Ga0070660_100820161
519 Ga0070660_100961576
520 Ga0070661_100163245
521 Ga0070675_100131118
522 Ga0070671_100029894
523 Ga0070674_100049501
524 Ga0070673_100007441
525 Ga0070673_101320225
526 Ga0070659_100000648
527 Ga0070659_100005324
528 Ga0070659_100194260
529 Ga0070678_100001135
530 Ga0070662_100000014
531 Ga0070662_100728967
532 Ga0070681_10003603
533 Ga0068867_100004612
534 Ga0070679_100053436
535 Ga0070679_100237004
536 Ga0070684_100079582
537 Ga0068853_100013243
538 Ga0068853_100038942
539 Ga0068853_100045399
540 Ga0068853_100137656
541 Ga0068853_100144670
542 Ga0070672_100197335
543 Ga0070665_100000032
544 Ga0068855_100000517
545 Ga0068855_100032958
546 Ga0068855_100066880
547 Ga0068855_100127601
548 Ga0068855_100155510
549 Ga0068855_100178733
550 Ga0068855_100462333
551 Ga0068855_101236191
552 Ga0068857_100019073
553 Ga0068854_100006869
554 Ga0068854_100351075
555 Ga0068856_100000960
556 Ga0068856_100013917
557 Ga0068856_100039386
558 Ga0068856_100277297
559 Ga0068856_100364762
560 Ga0068852_100063564
561 Ga0068852_100380292
562 Ga0068852_101113045
563 Ga0068852_101235907
564 Ga0068866_10018250
565 Ga0068866_10060832
566 Ga0068858_100406825
567 Ga0075366_10001935
568 Ga0097621_100001338
569 Ga0097621_100499949
570 Ga0075370_10154537
571 Ga0068871_100000294
572 Ga0068871_100505947
573 Ga0068865_100000045
574 Ga0105240_10000103
575 Ga0105240_10024698
576 Ga0105240_10127127
577 Ga0105240_10146866
578 Ga0105240_10156262
579 Ga0105240_10165596
580 Ga0105240_10200838
581 Ga0105240_10416711
582 Ga0105240_11140179
583 Ga0105240_11712176
584 Ga0105243_10405162
585 Ga0105241_10000835
586 Ga0105241_10001189
587 Ga0105241_10025857
588 Ga0105241_10052337
589 Ga0105241_10242432
590 Ga0105241_10366649
591 Ga0105242_10013093
592 Ga0105242_10271154
593 Ga0105242_11102479
594 Ga0105237_10000578
595 Ga0105237_10001647
596 Ga0105237_10003311
597 Ga0105237_10005389
598 Ga0105237_10005538
599 Ga0105237_10009387
600 Ga0105237_10023569
601 Ga0105237_10355586
602 Ga0105238_10032636
603 Ga0105238_10397159
604 Ga0105238_10567883
605 Ga0105249_10211976
606 Ga0105239_10000001
607 Ga0105239_10000007
608 Ga0105239_10000212
609 Ga0105239_10000352
610 Ga0105239_10004099
611 Ga0105239_10015494
612 Ga0105239_10037544
613 Ga0105239_10109843
614 Ga0105239_10511345
615 Ga0105239_10947860
616 Ga0105239_11863666
617 Ga0105246_10459024
618 Ga0105246_10693017
619 Ga0157373_10000245
620 Ga0157373_10002793
621 Ga0157373_10005931
622 Ga0157373_10047530
623 Ga0157373_10051008
624 Ga0157373_10224646
625 Ga0157373_10291842
626 Ga0157371_10000266
627 Ga0157371_10000918
628 Ga0157371_10001041
629 Ga0157371_10004488
630 Ga0157371_10006470
631 Ga0157371_10046419
632 Ga0157370_10000197
633 Ga0157370_10006873
634 Ga0157370_10009264
635 Ga0157370_10012793
636 Ga0157370_10032431
637 Ga0157370_10060023
638 Ga0157370_10078024
639 Ga0157370_10101804
640 Ga0157370_10227778
641 Ga0157369_10000031
642 Ga0157369_10000958
643 Ga0157369_10056317
644 Ga0157369_10071350
645 Ga0157374_10001192
646 Ga0157374_10001268
647 Ga0157374_10073445
648 Ga0157374_10132262
649 Ga0157374_10174083
650 Ga0157374_10389719
651 Ga0157378_10072999
652 Ga0157378_10075969
653 Ga0163162_10000010
654 Ga0163162_10000093
655 Ga0163162_10001288
656 Ga0163162_10066340
657 Ga0163162_10147212
658 Ga0157372_10000073
659 Ga0157372_10000173
660 Ga0157372_10001629
661 Ga0157372_10020255
662 Ga0157372_10071137
663 Ga0157372_10102100
664 Ga0157372_10516269
665 Ga0157375_10007954
666 Ga0157375_10084119
667 Ga0157375_10564462
668 Ga0182008_10000024
669 Ga0182008_10000082
670 Ga0182008_10000503
671 Ga0182008_10350566
672 Ga0157377_10139061
673 Ga0157377_10267965
674 Ga0182006_1001579
675 Ga0182006_1002473
676 Ga0182006_1013801
677 Ga0182007_10000002
678 Ga0182007_10006896
679 Ga0183373_1004
680 Ga0163161_10000856
681 Ga0163161_10010987
682 Ga0163161_10011241
683 Ga0163161_10025143
684 Ga0206351_10309955
685 Ga0206350_11487925
686 Ga0213872_10013855
687 Ga0224712_10055006
688 Ga0209563_109934
689 Ga0207427_100025
690 Ga0209437_100010
691 Ga0209437_100148
692 Ga0207425_1000023
693 Ga0209026_1000430
694 Ga0209026_1000498
695 Ga0209026_1003024
696 Ga0209129_1000032
697 Ga0209129_1004071
698 Ga0209233_1000017
699 Ga0209233_1003153
700 Ga0209455_1003251
701 Ga0209676_1000009
702 Ga0209025_1000047
703 Ga0209758_1000145
704 Ga0209050_1000094
705 Ga0207647_10000022
706 Ga0207647_10002110
707 Ga0207647_10008445
708 Ga0207647_10085426
709 Ga0207645_10000908
710 Ga0207705_10000045
711 Ga0207705_10237781
712 Ga0207705_10720284
713 Ga0207654_10000605
714 Ga0207654_10001374
715 Ga0207654_10051992
716 Ga0207654_10093678
717 Ga0207707_10002289
718 Ga0207695_10000019
719 Ga0207695_10004821
720 Ga0207695_10015441
721 Ga0207695_10028266
722 Ga0207695_10109697
723 Ga0207695_10111650
724 Ga0207695_10136198
725 Ga0207695_10520241
726 Ga0207695_10840310
727 Ga0207695_11039321
728 Ga0207671_10005216
729 Ga0207671_10006136
730 Ga0207671_10006364
731 Ga0207671_10026282
732 Ga0207671_10138540
733 Ga0207660_10009176
734 Ga0207660_10314162
735 Ga0207657_10067727
736 Ga0207657_10097330
737 Ga0207657_10293197
738 Ga0207657_10819360
739 Ga0207649_10131062
740 Ga0207652_10013519
741 Ga0207694_10256974
742 Ga0207694_10831278
743 Ga0207644_10011765
744 Ga0207690_10000766
745 Ga0207690_10016419
746 Ga0207690_10019300
747 Ga0207706_10000057
748 Ga0207706_10615757
749 Ga0207686_10017006
750 Ga0207686_10143801
751 Ga0207669_10006724
752 Ga0207704_10007798
753 Ga0207691_10165869
754 Ga0207661_10181198
755 Ga0207667_10000015
756 Ga0207667_10000644
757 Ga0207667_10038868
758 Ga0207667_10056016
759 Ga0207667_10094508
760 Ga0207667_11003319
761 Ga0207651_10074740
762 Ga0207712_10288379
763 Ga0207640_10002888
764 Ga0207640_10183207
765 Ga0207677_10019972
766 Ga0207703_10165775
767 Ga0207639_10013790
768 Ga0207639_10046856
769 Ga0207639_10052102
770 Ga0207678_10042934
771 Ga0207702_10001544
772 Ga0207702_10020026
773 Ga0207702_10020052
774 Ga0207702_10035264
775 Ga0207702_10225018
776 Ga0207648_10003208
777 Ga0207674_10033191
778 Ga0207683_10059471
779 Ga0207698_10000827
780 Ga0207698_10294859
781 Ga0207698_11268935
782 Ga0268266_10000030
783 Ga0307517_10002681
784 Ga0307515_10000376
785 Ga0307515_10018566
786 Ga0307515_10186908
787 Ga0316181_1098129
788 Ga0307513_10209894
789 Ga0307408_100008258
790 Ga0307408_100680229
791 Ga0307405_10000015
792 Ga0307405_10219877
793 Ga0307413_10286872
794 Ga0307407_10000027
795 Ga0307412_10000030
796 Ga0307412_10037291
797 Ga0307412_10170434
798 Ga0307412_10399549
799 Ga0307412_10487871
800 Ga0307409_100090749
801 Ga0307416_100000002
802 Ga0307414_10000262
803 Ga0307414_10009932
804 Ga0307414_10021675
805 Ga0307414_10050018
806 Ga0307414_10071046
807 Ga0307414_10156155
808 Ga0307414_10254031
809 Ga0307414_10276752
810 Ga0307414_10292699
811 Ga0307414_10469459
812 Ga0307414_10578514
813 Ga0307411_10045105
814 Ga0307411_10286943
815 Ga0307507_10003702
816 Ga0307510_10000464
817 Ga0373941_0066666
818 Ga0395899_0000001
819 Ga0395899_0000209
820 Ga0395899_0005213
821 Ga0395899_0006710
822 Ga0395900_0002637
823 Ga0395900_0003042
824 Ga0395898_0030948
825 Ga0395905_0000175
826 Ga0395905_0000981
827 Ga0395905_0379734
828 Ga0395901_0000313
829 Ga0395901_0006459
830 Ga0395901_0386306
831 Ga0436361_0826589
832 Ga0451802_1385587
833 Ga0451807_1566446
834 Ga0451833_0253040
835 Ga0451841_0541331
836 Ga0439448_0022452
837 Ga0439455_0013236
838 Ga0466966_0097593
839 Ga0466961_0041495
840 Ga0466958_0045362
841 Ga0495627_015273
842 Ga0495592_0101599
843 Ga0495651_0125297
844 Ga0495651_0132698
845 Ga0495650_0000162
846 Ga0495650_0068078
847 Ga0495605_0037534
848 Ga0495585_0000153
849 Ga0495585_0000853
850 Ga0495585_0151449
851 Ga0495596_0018860
852 Ga0495583_0036412
853 Ga0495583_0087453
854 Ga0495606_0000033
855 Ga0495606_0035896
856 Ga0495606_0060769
857 Ga0495606_0063167
858 Ga0495606_0069868
859 Ga0495610_0000768
860 Ga0495610_0002354
861 Ga0495616_0005550
862 Ga0495616_0005656
863 Ga0495618_0386343
864 Ga0495631_0010907
865 Ga0495637_0127520
866 Ga0495637_0163899
867 Ga0495648_0025326
868 Ga0495648_0059526
869 Ga0495648_0295203
870 Ga0495652_0124076
871 Ga0495652_0500263
872 Ga0495609_0001772
873 Ga0495609_0052751
874 Ga0495633_0000389
875 Ga0495633_0003449
876 Ga0495633_0070113
877 Ga0495667_0830451
878 Ga0495668_0000009
879 Ga0495625_0000131
880 Ga0495625_0000867
881 Ga0495625_0000951
882 Ga0495625_0022678
883 Ga0495625_0024395
884 Ga0495625_0049998
885 Ga0495625_0060367
886 Ga0495625_0063977
887 Ga0495661_0005171
888 Ga0495661_0005492
889 Ga0495646_0177700
890 Ga0495658_0019197
891 Ga0495671_0097139
892 Ga0495671_0184333
893 Ga0495649_0000009
894 Ga0495600_0241936
895 Ga0495660_0003893
896 Ga0495683_0092960
897 Ga0495683_0095205
898 Ga0495687_001889
899 Ga0495687_004663
900 Ga0495673_0022106
901 Ga0495686_0000973
902 Ga0495686_0034656
903 Ga0495686_0042781
904 Ga0495686_0078327
905 Ga0495614_0044265
906 Ga0495626_0058724
907 Ga0496122_0000869
908 Ga0496123_0009832
909 Ga0495678_004234
910 Ga0501035_0941998
911 nmdc:mga0k408_3829_c1
912 nmdc:mga0k408_544998_c1
913 nmdc:mga07m45_142874_c1
914 Ga0500635_0022030
915 Ga0500651_0000455
916 Ga0500608_031279
917 Ga0500608_096051
918 Ga0500618_000012
919 Ga0500642_0063813
920 Ga0500561_0015344
921 Ga0500568_0069878
922 Ga0500622_0000838
923 Ga0500624_000118
924 2586206301
925 2599480388
926 2738755411
927 2738763534
928 2738856150
929 2739588289
930 2739613938
931 2776615028
932 2819546267
933 2842723904
934 2842912364
935 2849282797
936 2852624801
937 2857629293
938 2884936311
939 2904446538
940 2919438306
941 2928083370
942 2928151368
943 2932087285
944 2945999351
945 2954021748
946 2977236022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03938

OmpH

Outer membrane protein (OmpH-like)

46

192

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h7e-assembly1.cif.gz_A crystal structure of a de novo enzyme, ferric enterobactin esterase syn-f4 (k4t) at 2.0 angstrom resolution 0.7194 42 124
4kqt-assembly1.cif.gz_A crystal structure of a putative outer membrane chaperone (omph-like) (cc_1914) from caulobacter crescentus cb15 at 2.83 a resolution (psi community target, shapiro) 0.7178 20 171
8h7c-assembly1.cif.gz_A crystal structure of a de novo enzyme, ferric enterobactin esterase syn-f4 (k4t) - pt derivative 0.7089 42 124
3a8p-assembly1.cif.gz_A crystal structure of the tiam2 phccex domain 0.6968 46 121
7f6j-assembly1.cif.gz_C crystal structure of the pdzd8 coiled-coil domain - rab7 complex 0.674 38 120
ID Description Score Start End Superfamily
af_A3KFD0_4_221_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7847 45 95 1.20.1070.10
4kp4A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.781 46 102 1.10.287.130
af_A0A2R8QMD9_236_345_1.20.81.10 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain 0.7103 38 126 1.20.81.10
af_A4I8D3_75_422_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.6971 31 140 1.20.1560.10
4kp4B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.6814 46 122 1.10.287.130
ID Description Score Start End GO Terms
AF-X0YLK7-F1-model_v4 Outer membrane chaperone Skp (OmpH) 0.9828 32 172 GO:0005829
GO:0022417
GO:0050821
GO:0051082
GO:0061077
AF-A0A3D1CW46-F1-model_v4 OmpH family outer membrane protein 0.9759 29 173 GO:0005829
GO:0022417
GO:0050821
GO:0051082
GO:0061077
AF-A0A7C5QEA2-F1-model_v4 OmpH family outer membrane protein 0.9734 23 172 GO:0005829
GO:0022417
GO:0050821
GO:0051082
GO:0061077
AF-A0A846FRX5-F1-model_v4 deleted 0.9686 23 171
AF-D5BFN0-F1-model_v4 OmpH family outer membrane protein 0.9658 32 172 GO:0005829
GO:0022417
GO:0050821
GO:0051082
GO:0061077

Map