F451106

General Info

Members Datasets Scaffolds Average Seq Length
473 226 466 206

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0019850|Ga0501044_0019850_161_802
Length 213
Sequence MTMEMGGPLDDGGITPAPDPFGLFRDWLAEAEKSEPNDPNAMALATADADGAPNVRMVLLKGVDSGFVFYSNAQSAKGGELAANPRAALNFHWKTLRKAVRVKGPIVQVSDAEADAYFATRPKDSQIGAWASPQSRPMPTSEHGGRWVFEKAIADYALKYGLGTVPRPPYWTGWRLSPTRIEFWRDRPFRLHDRLVYARSHADAPWATQRLFP

Samples

Sample ID Description Type Environment
1 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
2 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
3 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
4 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
5 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
6 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
7 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
221 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 1.27
Rhizoplane 2.96
Rhizosphere 90.7
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100162972 3300005329 Bacteria 2116
2 Ga0070670_100482539 3300005331 Bacteria 1101
3 Ga0068869_100044377 3300005334 Bacteria 3197
4 Ga0070666_10131893 3300005335 Bacteria 1737
5 Ga0070666_10297612 3300005335 Bacteria 1149
6 Ga0070680_100000533 3300005336 Bacteria 25986
7 Ga0070680_100046764 3300005336 Bacteria 3521
8 Ga0070680_100241226 3300005336 Bacteria 1528
9 Ga0068868_100120854 3300005338 Bacteria 2136
10 Ga0068868_100162476 3300005338 Bacteria 1845
11 Ga0070660_100295644 3300005339 Bacteria 1327
12 Ga0070660_100296667 3300005339 Bacteria 1325
13 Ga0070689_100155994 3300005340 Bacteria 1843
14 Ga0070689_100234614 3300005340 Bacteria 1509
15 Ga0070661_100000861 3300005344 Bacteria 21787
16 Ga0070661_100206633 3300005344 Bacteria 1502
17 Ga0070669_100101825 3300005353 Bacteria 2168
18 Ga0070674_100001707 3300005356 Bacteria 11902
19 Ga0070673_100447535 3300005364 Bacteria 1161
20 Ga0070667_100003789 3300005367 Bacteria 12861
21 Ga0070667_100118565 3300005367 Bacteria 2300
22 Ga0070711_100559274 3300005439 Bacteria 950
23 Ga0070678_100521404 3300005456 Bacteria 1051
24 Ga0070678_100746995 3300005456 Bacteria 885
25 Ga0070662_100463872 3300005457 Bacteria 1053
26 Ga0070681_10000001 3300005458 Bacteria 946857
27 Ga0070681_10122488 3300005458 Bacteria 2534
28 Ga0070679_100000890 3300005530 Bacteria 25937
29 Ga0070679_100046230 3300005530 Bacteria 4339
30 Ga0070684_100733876 3300005535 Bacteria 922
31 Ga0068853_100001056 3300005539 Bacteria 19457
32 Ga0068853_100092195 3300005539 Bacteria 2665
33 Ga0068853_100405328 3300005539 Bacteria 1277
34 Ga0070672_100223700 3300005543 Bacteria 1579
35 Ga0070693_100152211 3300005547 Bacteria 1466
36 Ga0070665_100026065 3300005548 Bacteria 5887
37 Ga0070665_100039425 3300005548 Bacteria 4749
38 Ga0070665_100666384 3300005548 Bacteria 1053
39 Ga0070665_100715381 3300005548 Bacteria 1014
40 Ga0070665_100970110 3300005548 Bacteria 862
41 Ga0068855_100000032 3300005563 Bacteria 168335
42 Ga0068855_100007214 3300005563 Bacteria 13486
43 Ga0068855_100081450 3300005563 Bacteria 3752
44 Ga0068855_100120752 3300005563 Bacteria 2999
45 Ga0068857_100097875 3300005577 Bacteria 2631
46 Ga0068857_100104849 3300005577 Bacteria 2539
47 Ga0068857_100401916 3300005577 Bacteria 1275
48 Ga0068857_100529113 3300005577 Bacteria 1109
49 Ga0068856_100082046 3300005614 Bacteria 3199
50 Ga0068856_100352822 3300005614 Bacteria 1489
51 Ga0068852_100046670 3300005616 Bacteria 3692
52 Ga0068852_100322548 3300005616 Bacteria 1500
53 Ga0068852_100644268 3300005616 Bacteria 1067
54 Ga0068852_101443301 3300005616 Bacteria 710
55 Ga0068859_100351427 3300005617 Bacteria 1569
56 Ga0068859_100355300 3300005617 Bacteria 1560
57 Ga0068864_100726747 3300005618 Bacteria 972
58 Ga0068866_10058047 3300005718 Bacteria 1997
59 Ga0068866_10191756 3300005718 Bacteria 1215
60 Ga0068861_100033290 3300005719 Bacteria 3801
61 Ga0068861_100290814 3300005719 Bacteria 1411
62 Ga0068870_10014019 3300005840 Bacteria 3778
63 Ga0068863_100463508 3300005841 Bacteria 1244
64 Ga0068858_100026869 3300005842 Bacteria 5347
65 Ga0068858_100141635 3300005842 Bacteria 2257
66 Ga0068860_100037003 3300005843 Bacteria 4672
67 Ga0068860_100603692 3300005843 Bacteria 1103
68 Ga0068860_100690384 3300005843 Bacteria 1030
69 Ga0068862_100061607 3300005844 Bacteria 3225
70 Ga0068862_100539137 3300005844 Bacteria 1113
71 Ga0081455_10321761 3300005937 Bacteria 1101
72 Ga0081538_10006877 3300005981 Bacteria 9901
73 Ga0075432_10121871 3300006058 Bacteria 980
74 Ga0070712_100403935 3300006175 Bacteria 1129
75 Ga0075369_10033546 3300006186 Bacteria 2176
76 Ga0097621_100134618 3300006237 Bacteria 2107
77 Ga0097621_100323588 3300006237 Bacteria 1366
78 Ga0097621_100626984 3300006237 Bacteria 985
79 Ga0068871_100005261 3300006358 Bacteria 9060
80 Ga0068871_100256054 3300006358 Bacteria 1526
81 Ga0068871_100495113 3300006358 Bacteria 1101
82 Ga0068871_101137543 3300006358 Bacteria 731
83 Ga0075428_100497211 3300006844 Bacteria 1305
84 Ga0075431_100211138 3300006847 Bacteria 1983
85 Ga0075431_100485010 3300006847 Bacteria 1228
86 Ga0068865_100031866 3300006881 Bacteria 3518
87 Ga0097620_100351443 3300006931 Bacteria 1569
88 Ga0097620_100355299 3300006931 Bacteria 1560
89 Ga0105240_10000479 3300009093 Bacteria 73782
90 Ga0105240_10004599 3300009093 Bacteria 20913
91 Ga0105240_10010835 3300009093 Bacteria 12768
92 Ga0105240_10032518 3300009093 Bacteria 6754
93 Ga0105240_10041573 3300009093 Bacteria 5866
94 Ga0105240_10077549 3300009093 Bacteria 4093
95 Ga0105240_10380042 3300009093 Bacteria 1595
96 Ga0105240_10700018 3300009093 Bacteria 1106
97 Ga0105240_10753593 3300009093 Bacteria 1058
98 Ga0105245_10006206 3300009098 Bacteria 10512
99 Ga0105245_10163151 3300009098 Bacteria 2116
100 Ga0105243_10052682 3300009148 Bacteria 3224
101 Ga0105241_10072693 3300009174 Bacteria 2674
102 Ga0105241_10236061 3300009174 Bacteria 1543
103 Ga0105241_10282129 3300009174 Bacteria 1419
104 Ga0105241_10589340 3300009174 Bacteria 1003
105 Ga0105242_10185535 3300009176 Bacteria 1838
106 Ga0105242_10238381 3300009176 Bacteria 1634
107 Ga0105248_10000005 3300009177 Bacteria 673111
108 Ga0105248_10047218 3300009177 Bacteria 4828
109 Ga0105248_10054164 3300009177 Bacteria 4499
110 Ga0105248_10817832 3300009177 Bacteria 1052
111 Ga0105237_10041301 3300009545 Bacteria 4652
112 Ga0105237_10049027 3300009545 Bacteria 4246
113 Ga0105237_10483092 3300009545 Bacteria 1245
114 Ga0105238_10032847 3300009551 Bacteria 5282
115 Ga0105238_10072228 3300009551 Bacteria 3447
116 Ga0105238_10162976 3300009551 Bacteria 2206
117 Ga0105238_10441385 3300009551 Bacteria 1298
118 Ga0105238_10441455 3300009551 Bacteria 1298
119 Ga0105249_10074782 3300009553 Bacteria 3137
120 Ga0105239_10000773 3300010375 Bacteria 45320
121 Ga0105239_10019217 3300010375 Bacteria 7548
122 Ga0105239_10037033 3300010375 Bacteria 5351
123 Ga0105239_10360360 3300010375 Bacteria 1642
124 Ga0105239_10470357 3300010375 Bacteria 1427
125 Ga0157370_10028434 3300013104 Bacteria 5499
126 Ga0157370_10392627 3300013104 Bacteria 1277
127 Ga0157369_10038476 3300013105 Bacteria 5230
128 Ga0157369_10144843 3300013105 Bacteria 2512
129 Ga0157369_10195282 3300013105 Bacteria 2126
130 Ga0157378_10009799 3300013297 Bacteria 8351
131 Ga0157378_10260310 3300013297 Bacteria 1664
132 Ga0163162_10037598 3300013306 Bacteria 4830
133 Ga0163162_11139664 3300013306 Bacteria 884
134 Ga0157372_10024742 3300013307 Bacteria 6525
135 Ga0157372_10043609 3300013307 Bacteria 4966
136 Ga0157372_10050956 3300013307 Bacteria 4605
137 Ga0157372_10176347 3300013307 Bacteria 2474
138 Ga0157372_10785005 3300013307 Bacteria 1107
139 Ga0157375_10528125 3300013308 Bacteria 1343
140 Ga0163163_10002984 3300014325 Bacteria 14317
141 Ga0163163_10113422 3300014325 Bacteria 2741
142 Ga0157380_10029288 3300014326 Bacteria 4208
143 Ga0157380_10629293 3300014326 Bacteria 1067
144 Ga0157379_10098774 3300014968 Bacteria 2621
145 Ga0157379_10119366 3300014968 Bacteria 2372
146 Ga0157376_10051992 3300014969 Bacteria 3405
147 Ga0213874_10002961 3300021377 Bacteria 3712
148 Ga0209233_1000015 3300025261 Bacteria 980563
149 Ga0209233_1002448 3300025261 Bacteria 6842
150 Ga0207642_10035078 3300025899 Bacteria 2139
151 Ga0207642_10138794 3300025899 Bacteria 1279
152 Ga0207688_10044386 3300025901 Bacteria 2477
153 Ga0207645_10020582 3300025907 Bacteria 4316
154 Ga0207643_10523815 3300025908 Bacteria 759
155 Ga0207705_10022034 3300025909 Bacteria 4546
156 Ga0207705_10214193 3300025909 Bacteria 1461
157 Ga0207705_10807895 3300025909 Bacteria 728
158 Ga0207654_10029052 3300025911 Bacteria 3021
159 Ga0207654_10122573 3300025911 Bacteria 1635
160 Ga0207654_10128435 3300025911 Bacteria 1601
161 Ga0207707_10000048 3300025912 Bacteria 117799
162 Ga0207707_10126855 3300025912 Bacteria 2232
163 Ga0207695_10000018 3300025913 Bacteria 766611
164 Ga0207695_10003669 3300025913 Bacteria 21406
165 Ga0207695_10017992 3300025913 Bacteria 8183
166 Ga0207695_10026512 3300025913 Bacteria 6469
167 Ga0207695_10046311 3300025913 Bacteria 4610
168 Ga0207695_10098966 3300025913 Bacteria 2915
169 Ga0207695_10137879 3300025913 Bacteria 2391
170 Ga0207695_10195682 3300025913 Bacteria 1937
171 Ga0207695_10233376 3300025913 Bacteria 1743
172 Ga0207695_10280006 3300025913 Bacteria 1562
173 Ga0207695_10539090 3300025913 Bacteria 1048
174 Ga0207671_10052231 3300025914 Bacteria 3029
175 Ga0207671_10053662 3300025914 Bacteria 2987
176 Ga0207693_10233075 3300025915 Bacteria 1446
177 Ga0207660_10022061 3300025917 Bacteria 4287
178 Ga0207660_10044973 3300025917 Bacteria 3109
179 Ga0207660_10176585 3300025917 Bacteria 1656
180 Ga0207657_10020081 3300025919 Bacteria 6326
181 Ga0207657_10321237 3300025919 Bacteria 1224
182 Ga0207649_10000249 3300025920 Bacteria 43564
183 Ga0207649_10058975 3300025920 Bacteria 2406
184 Ga0207649_10106068 3300025920 Bacteria 1868
185 Ga0207649_10343688 3300025920 Bacteria 1102
186 Ga0207652_10000502 3300025921 Bacteria 39810
187 Ga0207694_10000005 3300025924 Bacteria 823704
188 Ga0207694_10016800 3300025924 Bacteria 5530
189 Ga0207694_10034745 3300025924 Bacteria 3866
190 Ga0207694_10072994 3300025924 Bacteria 2684
191 Ga0207694_10231118 3300025924 Bacteria 1510
192 Ga0207650_10276757 3300025925 Bacteria 1365
193 Ga0207650_10281210 3300025925 Bacteria 1355
194 Ga0207706_10026707 3300025933 Bacteria 5168
195 Ga0207686_10025082 3300025934 Bacteria 3463
196 Ga0207670_10123787 3300025936 Bacteria 1884
197 Ga0207669_10040545 3300025937 Bacteria 2702
198 Ga0207669_10236215 3300025937 Bacteria 1352
199 Ga0207704_10021129 3300025938 Bacteria 3460
200 Ga0207691_10208166 3300025940 Bacteria 1700
201 Ga0207691_10225116 3300025940 Bacteria 1625
202 Ga0207691_11107557 3300025940 Bacteria 659
203 Ga0207711_10000002 3300025941 Bacteria 1228676
204 Ga0207711_10224309 3300025941 Bacteria 1720
205 Ga0207689_10034593 3300025942 Bacteria 4196
206 Ga0207689_10101090 3300025942 Bacteria 2368
207 Ga0207689_10288424 3300025942 Bacteria 1359
208 Ga0207661_10207297 3300025944 Bacteria 1726
209 Ga0207667_10000011 3300025949 Bacteria 447785
210 Ga0207667_10025601 3300025949 Bacteria 6455
211 Ga0207667_10071631 3300025949 Bacteria 3603
212 Ga0207651_10079159 3300025960 Bacteria 2360
213 Ga0207712_10106810 3300025961 Bacteria 2092
214 Ga0207658_10196265 3300025986 Bacteria 1681
215 Ga0207677_10048023 3300026023 Bacteria 2871
216 Ga0207677_10236689 3300026023 Bacteria 1474
217 Ga0207703_10101757 3300026035 Bacteria 2437
218 Ga0207703_10459524 3300026035 Bacteria 1190
219 Ga0207703_11220018 3300026035 Bacteria 723
220 Ga0207639_10005721 3300026041 Bacteria 8417
221 Ga0207639_10159277 3300026041 Bacteria 1900
222 Ga0207639_10330127 3300026041 Bacteria 1357
223 Ga0207708_10539947 3300026075 Bacteria 982
224 Ga0207676_10135741 3300026095 Bacteria 2099
225 Ga0207676_10612000 3300026095 Bacteria 1047
226 Ga0207674_10239216 3300026116 Bacteria 1762
227 Ga0207674_10253848 3300026116 Bacteria 1705
228 Ga0207674_10310155 3300026116 Bacteria 1527
229 Ga0207675_100051411 3300026118 Bacteria 3845
230 Ga0207675_100128193 3300026118 Bacteria 2405
231 Ga0207675_100276982 3300026118 Bacteria 1629
232 Ga0207683_10024158 3300026121 Bacteria 5231
233 Ga0207683_10027890 3300026121 Bacteria 4880
234 Ga0207698_10323709 3300026142 Bacteria 1445
235 Ga0207698_10422497 3300026142 Bacteria 1279
236 Ga0207698_10455524 3300026142 Bacteria 1236
237 Ga0207698_10906708 3300026142 Bacteria 889
238 Ga0207428_10000057 3300027907 Bacteria 158615
239 Ga0268266_10116466 3300028379 Bacteria 2373
240 Ga0268266_10122767 3300028379 Bacteria 2313
241 Ga0268266_10182258 3300028379 Bacteria 1913
242 Ga0268266_10302039 3300028379 Bacteria 1493
243 Ga0268266_10350825 3300028379 Bacteria 1386
244 Ga0268265_10089702 3300028380 Bacteria 2454
245 Ga0268265_10231137 3300028380 Bacteria 1625
246 Ga0268265_10904124 3300028380 Bacteria 867
247 Ga0268264_10039885 3300028381 Bacteria 3879
248 Ga0265318_10000229 3300028577 Bacteria 48662
249 Ga0265318_10012323 3300028577 Bacteria 3645
250 Ga0265338_10000005 3300028800 Bacteria 571137
251 Ga0265338_10010305 3300028800 Bacteria 10984
252 Ga0265338_10167012 3300028800 Bacteria 1693
253 Ga0265330_10010259 3300031235 Bacteria 4421
254 Ga0265330_10105341 3300031235 Bacteria 1206
255 Ga0265332_10035600 3300031238 Bacteria 2161
256 Ga0265332_10080734 3300031238 Bacteria 1380
257 Ga0265332_10223680 3300031238 Bacteria 780
258 Ga0265325_10000063 3300031241 Bacteria 74165
259 Ga0265325_10010028 3300031241 Bacteria 5505
260 Ga0265325_10024481 3300031241 Bacteria 3284
261 Ga0265325_10230398 3300031241 Bacteria 845
262 Ga0265329_10072209 3300031242 Bacteria 1092
263 Ga0265340_10000936 3300031247 Bacteria 16576
264 Ga0265340_10005377 3300031247 Bacteria 7111
265 Ga0265340_10014047 3300031247 Bacteria 4194
266 Ga0265340_10017558 3300031247 Bacteria 3701
267 Ga0265340_10161619 3300031247 Bacteria 1017
268 Ga0265339_10000646 3300031249 Bacteria 26937
269 Ga0265339_10011271 3300031249 Bacteria 5514
270 Ga0265339_10014043 3300031249 Bacteria 4837
271 Ga0265339_10037450 3300031249 Bacteria 2711
272 Ga0265339_10169594 3300031249 Bacteria 1093
273 Ga0265331_10000003 3300031250 Bacteria 499358
274 Ga0265331_10000895 3300031250 Bacteria 24130
275 Ga0265331_10001082 3300031250 Bacteria 20989
276 Ga0265331_10084011 3300031250 Bacteria 1476
277 Ga0265331_10100110 3300031250 Bacteria 1334
278 Ga0265331_10281360 3300031250 Bacteria 745
279 Ga0265327_10000786 3300031251 Bacteria 48928
280 Ga0265316_10051487 3300031344 Bacteria 3234
281 Ga0265316_10056825 3300031344 Bacteria 3054
282 Ga0265316_10144622 3300031344 Bacteria 1784
283 Ga0265316_10187993 3300031344 Bacteria 1536
284 Ga0265316_10225140 3300031344 Bacteria 1383
285 Ga0265316_10242915 3300031344 Bacteria 1324
286 Ga0265313_10002135 3300031595 Bacteria 17576
287 Ga0265313_10003473 3300031595 Bacteria 12725
288 Ga0265313_10005847 3300031595 Bacteria 8924
289 Ga0265313_10039934 3300031595 Bacteria 2324
290 Ga0265313_10082896 3300031595 Bacteria 1453
291 Ga0265313_10175361 3300031595 Bacteria 903
292 Ga0265314_10001323 3300031711 Bacteria 28095
293 Ga0265314_10054102 3300031711 Bacteria 2779
294 Ga0265314_10071726 3300031711 Bacteria 2316
295 Ga0265314_10073703 3300031711 Bacteria 2276
296 Ga0265314_10085281 3300031711 Bacteria 2071
297 Ga0265314_10146547 3300031711 Bacteria 1453
298 Ga0265314_10175459 3300031711 Bacteria 1289
299 Ga0265314_10307967 3300031711 Bacteria 886
300 Ga0265342_10012746 3300031712 Bacteria 5680
301 Ga0265342_10035769 3300031712 Bacteria 3036
302 Ga0265342_10092237 3300031712 Bacteria 1735
303 Ga0307516_10015530 3300031730 Bacteria 8008
304 Ga0307410_10506797 3300031852 Bacteria 994
305 Ga0307412_10300353 3300031911 Bacteria 1269
306 Ga0307409_100062470 3300031995 Bacteria 2916
307 Ga0307415_100345591 3300032126 Bacteria 1250
308 Ga0373926_0207521 3300035083 Bacteria 755
309 Ga0373940_0077836 3300035088 Bacteria 975
310 Ga0373944_0011923 3300035089 Bacteria 2389
311 Ga0373932_0136500 3300035112 Bacteria 831
312 Ga0373945_0052486 3300035116 Bacteria 1502
313 Ga0373943_0085065 3300035170 Bacteria 1628
314 Ga0373946_0127047 3300035171 Bacteria 1169
315 Ga0373962_0038008 3300035242 Bacteria 1346
316 Ga0373935_0038961 3300035692 Bacteria 2977
317 Ga0373935_0638982 3300035692 Bacteria 780
318 Ga0373927_0303908 3300035695 Bacteria 1050
319 Ga0373947_0009240 3300035725 Bacteria 5666
320 Ga0373947_0728784 3300035725 Bacteria 676
321 Ga0373937_0299967 3300036401 Bacteria 1518
322 Ga0373925_0005279 3300037068 Bacteria 9644
323 Ga0373925_0399987 3300037068 Bacteria 1120
324 Ga0395899_0113318 3300037312 Bacteria 1948
325 Ga0395898_0026421 3300037466 Bacteria 5841
326 Ga0395905_0178732 3300037471 Bacteria 1992
327 Ga0395901_0023830 3300038443 Bacteria 6277
328 Ga0436365_0008345 3300039437 Bacteria 2525
329 Ga0436365_0097042 3300039437 Bacteria 195024
330 Ga0436365_1196036 3300039437 Bacteria 119165
331 Ga0436365_1402802 3300039437 Bacteria 1133
332 Ga0436365_1517026 3300039437 Bacteria 2162
333 Ga0436360_0732864 3300039438 Bacteria 1172
334 Ga0436363_0083494 3300039450 Bacteria 5815
335 Ga0436363_0178975 3300039450 Bacteria 5431
336 Ga0436363_1186071 3300039450 Bacteria 1872
337 Ga0436363_1471007 3300039450 Bacteria 1093
338 Ga0436362_1111630 3300039453 Bacteria 983
339 Ga0466957_0504968 3300044842 Bacteria 839
340 Ga0466967_1060077 3300045976 Bacteria 807
341 Ga0495592_0352793 3300046454 Bacteria 943
342 Ga0495651_0514951 3300046462 Bacteria 764
343 Ga0495580_0017366 3300046472 Bacteria 5384
344 Ga0495580_0257762 3300046472 Bacteria 1193
345 Ga0495582_0102300 3300046473 Unclassified 1604
346 Ga0495664_0060357 3300046477 Bacteria 2258
347 Ga0495664_0135203 3300046477 Bacteria 1494
348 Ga0495664_0265704 3300046477 Bacteria 1037
349 Ga0495618_0147575 3300046514 Bacteria 1503
350 Ga0495628_0118867 3300046516 Bacteria 2029
351 Ga0495666_0167718 3300046526 Bacteria 1016
352 Ga0495652_0053995 3300046529 Bacteria 3423
353 Ga0495654_0100240 3300046530 Bacteria 1334
354 Ga0495645_0025189 3300046543 Bacteria 4317
355 Ga0495645_0088099 3300046543 Bacteria 2221
356 Ga0495657_0068478 3300046675 Bacteria 2326
357 Ga0495599_0138186 3300046678 Bacteria 1512
358 Ga0495599_0285473 3300046678 Bacteria 999
359 Ga0495658_0015464 3300046683 Bacteria 3915
360 Ga0495669_0185558 3300046684 Bacteria 992
361 Ga0495589_0028027 3300046794 Bacteria 2845
362 Ga0495581_0060830 3300047315 Bacteria 2183
363 Ga0495581_0122396 3300047315 Unclassified 1514
364 Ga0495675_0144520 3300047444 Bacteria 1473
365 Ga0495677_0053250 3300047445 Bacteria 1492
366 Ga0496100_0205011 3300048903 Bacteria 1439
367 Ga0496101_0527562 3300048904 Bacteria 933
368 Ga0496104_0007150 3300048907 Bacteria 9839
369 Ga0496104_0776106 3300048907 Bacteria 865
370 Ga0496105_0000482 3300048908 Bacteria 26214
371 Ga0496108_0008429 3300048911 Bacteria 8362
372 Ga0496109_0001031 3300048912 Bacteria 23062
373 Ga0496110_0035811 3300048913 Bacteria 4308
374 Ga0496110_0262671 3300048913 Bacteria 1571
375 Ga0496111_0004585 3300048914 Bacteria 8748
376 Ga0496112_0003839 3300048915 Bacteria 12552
377 Ga0496113_0003551 3300048916 Bacteria 9356
378 Ga0496115_0017599 3300048918 Bacteria 5469
379 Ga0496115_0363620 3300048918 Bacteria 1179
380 Ga0496118_0274239 3300048921 Bacteria 943
381 Ga0495682_0002318 3300049460 Bacteria 9063
382 Ga0501032_0041971 3300049569 Bacteria 3104
383 Ga0501032_0055865 3300049569 Bacteria 2655
384 Ga0501032_0223337 3300049569 Bacteria 1225
385 Ga0501033_0004313 3300049570 Bacteria 11418
386 Ga0501034_0014746 3300049571 Bacteria 8044
387 Ga0501034_0024132 3300049571 Bacteria 6186
388 Ga0501034_0113099 3300049571 Bacteria 2705
389 Ga0501034_0163688 3300049571 Unclassified 2194
390 Ga0501034_0968130 3300049571 Bacteria 736
391 Ga0501036_0047332 3300049572 Bacteria 3643
392 Ga0501036_0051291 3300049572 Bacteria 3493
393 Ga0501036_0226813 3300049572 Bacteria 1568
394 Ga0501037_0050147 3300049573 Bacteria 3056
395 Ga0501037_0309474 3300049573 Bacteria 1095
396 Ga0501038_0093089 3300049574 Bacteria 2522
397 Ga0501038_0098841 3300049574 Bacteria 2433
398 Ga0501038_0316478 3300049574 Bacteria 1222
399 Ga0501039_0627589 3300049575 Bacteria 842
400 Ga0501043_0037682 3300049579 Bacteria 3802
401 Ga0501043_0054048 3300049579 Bacteria 3154
402 Ga0501046_0008512 3300049580 Bacteria 8935
403 Ga0501046_0147140 3300049580 Bacteria 1778
404 Ga0501046_0287284 3300049580 Bacteria 1204
405 Ga0501047_0002290 3300049581 Bacteria 18318
406 Ga0501047_0020344 3300049581 Bacteria 6373
407 Ga0501047_0047913 3300049581 Bacteria 4128
408 Ga0501047_0060096 3300049581 Bacteria 3669
409 Ga0501047_0256963 3300049581 Bacteria 1595
410 Ga0501047_0319959 3300049581 Bacteria 1391
411 Ga0501047_0332346 3300049581 Bacteria 1358
412 Ga0501047_0455827 3300049581 Bacteria 1108
413 Ga0501067_0000342 3300049583 Bacteria 25432
414 Ga0501067_0005861 3300049583 Bacteria 6811
415 Ga0501069_0063135 3300049585 Bacteria 2069
416 Ga0501070_0000099 3300049586 Bacteria 75568
417 Ga0501070_0004535 3300049586 Bacteria 11919
418 Ga0501070_0069508 3300049586 Bacteria 2915
419 Ga0501070_0149199 3300049586 Bacteria 1929
420 Ga0501070_0347565 3300049586 Bacteria 1204
421 Ga0501072_0005383 3300049588 Bacteria 9742
422 Ga0501072_0543002 3300049588 Bacteria 918
423 Ga0501073_0027060 3300049589 Bacteria 4104
424 Ga0501073_0042537 3300049589 Bacteria 3206
425 Ga0501073_0381486 3300049589 Bacteria 974
426 Ga0501074_0521808 3300049590 Bacteria 841
427 Ga0501077_0294686 3300049593 Bacteria 1033
428 Ga0501079_0057255 3300049741 Bacteria 3008
429 Ga0501079_0073444 3300049741 Bacteria 2643
430 Ga0501080_0006241 3300049742 Bacteria 10694
431 Ga0501080_0029119 3300049742 Bacteria 5140
432 Ga0501080_0064589 3300049742 Bacteria 3404
433 Ga0501080_0160324 3300049742 Bacteria 2078
434 Ga0501080_0254653 3300049742 Bacteria 1600
435 Ga0501080_0462324 3300049742 Bacteria 1137
436 Ga0501080_0502015 3300049742 Bacteria 1084
437 Ga0501083_0114381 3300049744 Bacteria 1772
438 Ga0501035_0002478 3300049822 Bacteria 18038
439 Ga0501035_0003009 3300049822 Bacteria 16182
440 Ga0501035_0005467 3300049822 Bacteria 12006
441 Ga0501035_0089752 3300049822 Bacteria 2706
442 Ga0501044_0005283 3300049823 Bacteria 14361
443 Ga0501044_0011026 3300049823 Bacteria 9808
444 Ga0501044_0019850 3300049823 Bacteria 7178
445 Ga0501044_0032666 3300049823 Bacteria 5470
446 Ga0501044_0078111 3300049823 Bacteria 3355
447 nmdc:mga0qj67_498085_c1 3300050509 Bacteria 979
448 nmdc:mga06r32_236028_c1 3300050510 Bacteria 1816
449 nmdc:mga08y16_60_c1 3300050511 Bacteria 93360
450 nmdc:mga0sz30_24194_c1 3300050516 Bacteria 2477
451 nmdc:mga0sz30_83548_c1 3300050516 Bacteria 1383
452 Ga0500643_000003 3300053087 Bacteria 876659
453 Ga0500643_017399 3300053087 Bacteria 2408
454 Ga0500595_000488 3300053119 Bacteria 24394
455 Ga0500595_053327 3300053119 Bacteria 1245
456 Ga0500642_0003203 3300053130 Bacteria 4913
457 Ga0500573_0000037 3300053140 Bacteria 107603
458 Ga0500619_009905 3300053154 Bacteria 2385
459 Ga0501084_0004445 3300054114 Bacteria 11448
460 Ga0501084_0030156 3300054114 Bacteria 4536
461 Ga0501084_0093482 3300054114 Bacteria 2525
462 Ga0590077_034007 3300059426 Bacteria 1120
463 Ga0501082_0062239 3300060353 Bacteria 3212
464 Ga0501082_0064968 3300060353 Bacteria 3143
465 Ga0501082_0167554 3300060353 Bacteria 1909
466 Ga0501082_0429404 3300060353 Bacteria 1154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0968130 Ga0501034_0968130_161_721 181
2 3300035083 Ga0373926_0207521 Ga0373926_0207521_11_580 189
3 3300035171 Ga0373946_0127047 Ga0373946_0127047_579_1148 189
4 3300037068 Ga0373925_0399987 Ga0373925_0399987_113_682 189
5 3300048913 Ga0496110_0262671 Ga0496110_0262671_699_1268 189
6 3300049742 Ga0501080_0462324 Ga0501080_0462324_545_1114 189
7 3300053087 Ga0500643_017399 Ga0500643_017399_1488_2105 191
8 3300045976 Ga0466967_1060077 Ga0466967_1060077_37_642 192
9 iso_pu_bacteria 2883354860 2883358622 192
10 3300005336 Ga0070680_100000533 Ga0070680_1000005332 195
11 3300005458 Ga0070681_10000001 Ga0070681_10000001201 195
12 3300005530 Ga0070679_100000890 Ga0070679_1000008906 195
13 3300005616 Ga0068852_101443301 Ga0068852_1014433011 195
14 3300010375 Ga0105239_10037033 Ga0105239_100370336 195
15 3300025912 Ga0207707_10000048 Ga0207707_10000048113 195
16 3300025917 Ga0207660_10022061 Ga0207660_100220612 195
17 3300025921 Ga0207652_10000502 Ga0207652_1000050211 195
18 3300031250 Ga0265331_10001082 Ga0265331_1000108213 195
19 3300031595 Ga0265313_10003473 Ga0265313_100034736 195
20 3300049575 Ga0501039_0627589 Ga0501039_0627589_34_657 195
21 3300049589 Ga0501073_0381486 Ga0501073_0381486_37_624 195
22 3300005353 Ga0070669_100101825 Ga0070669_1001018253 196
23 3300005356 Ga0070674_100001707 Ga0070674_1000017077 196
24 3300005456 Ga0070678_100521404 Ga0070678_1005214041 196
25 3300005617 Ga0068859_100351427 Ga0068859_1003514272 196
26 3300005718 Ga0068866_10058047 Ga0068866_100580471 196
27 3300005719 Ga0068861_100033290 Ga0068861_1000332905 196
28 3300005843 Ga0068860_100690384 Ga0068860_1006903842 196
29 3300005844 Ga0068862_100061607 Ga0068862_1000616075 196
30 3300005981 Ga0081538_10006877 Ga0081538_100068774 196
31 3300006058 Ga0075432_10121871 Ga0075432_101218712 196
32 3300006844 Ga0075428_100497211 Ga0075428_1004972112 196
33 3300006847 Ga0075431_100211138 Ga0075431_1002111382 196
34 3300006847 Ga0075431_100485010 Ga0075431_1004850102 196
35 3300006881 Ga0068865_100031866 Ga0068865_1000318662 196
36 3300006931 Ga0097620_100351443 Ga0097620_1003514432 196
37 3300014326 Ga0157380_10029288 Ga0157380_100292882 196
38 3300014326 Ga0157380_10629293 Ga0157380_106292932 196
39 3300025899 Ga0207642_10035078 Ga0207642_100350783 196
40 3300025937 Ga0207669_10040545 Ga0207669_100405454 196
41 3300025938 Ga0207704_10021129 Ga0207704_100211292 196
42 3300026075 Ga0207708_10539947 Ga0207708_105399472 196
43 3300026118 Ga0207675_100128193 Ga0207675_1001281932 196
44 3300027907 Ga0207428_10000057 Ga0207428_10000057122 196
45 3300028380 Ga0268265_10231137 Ga0268265_102311373 196
46 3300031852 Ga0307410_10506797 Ga0307410_105067972 196
47 3300031911 Ga0307412_10300353 Ga0307412_103003532 196
48 3300031995 Ga0307409_100062470 Ga0307409_1000624703 196
49 3300032126 Ga0307415_100345591 Ga0307415_1003455912 196
50 3300049571 Ga0501034_0163688 Ga0501034_0163688_1284_1910 196
51 3300049583 Ga0501067_0000342 Ga0501067_0000342_23863_24489 196
52 3300049586 Ga0501070_0347565 Ga0501070_0347565_459_1085 196
53 3300049588 Ga0501072_0005383 Ga0501072_0005383_2767_3393 196
54 3300049589 Ga0501073_0027060 Ga0501073_0027060_2437_3063 196
55 3300049741 Ga0501079_0057255 Ga0501079_0057255_766_1392 196
56 3300050509 nmdc:mga0qj67_498085_c1 nmdc:mga0qj67_498085_c1_240_830 196
57 3300050510 nmdc:mga06r32_236028_c1 nmdc:mga06r32_236028_c1_825_1415 196
58 3300050511 nmdc:mga08y16_60_c1 nmdc:mga08y16_60_c1_29272_29862 196
59 3300054114 Ga0501084_0093482 Ga0501084_0093482_1712_2338 196
60 3300059426 Ga0590077_034007 Ga0590077_034007_91_681 196
61 3300060353 Ga0501082_0429404 Ga0501082_0429404_54_680 196
62 3300039450 Ga0436363_1186071 Ga0436363_1186071_1168_1797 198
63 3300049588 Ga0501072_0543002 Ga0501072_0543002_240_836 198
64 3300009093 Ga0105240_10041573 Ga0105240_100415733 200
65 3300009545 Ga0105237_10483092 Ga0105237_104830922 200
66 3300025913 Ga0207695_10195682 Ga0207695_101956822 200
67 3300037471 Ga0395905_0178732 Ga0395905_0178732_1197_1826 200
68 3300044842 Ga0466957_0504968 Ga0466957_0504968_60_689 200
69 3300046462 Ga0495651_0514951 Ga0495651_0514951_64_690 200
70 3300046477 Ga0495664_0060357 Ga0495664_0060357_499_1125 200
71 3300046516 Ga0495628_0118867 Ga0495628_0118867_110_736 200
72 3300046678 Ga0495599_0285473 Ga0495599_0285473_150_776 200
73 3300009093 Ga0105240_10380042 Ga0105240_103800422 201
74 3300009174 Ga0105241_10282129 Ga0105241_102821292 201
75 3300013104 Ga0157370_10028434 Ga0157370_100284346 201
76 3300013105 Ga0157369_10144843 Ga0157369_101448432 201
77 3300014325 Ga0163163_10002984 Ga0163163_100029844 201
78 3300025909 Ga0207705_10022034 Ga0207705_100220345 201
79 3300025913 Ga0207695_10233376 Ga0207695_102333762 201
80 3300026095 Ga0207676_10135741 Ga0207676_101357411 201
81 3300035725 Ga0373947_0728784 Ga0373947_0728784_23_628 201
82 3300047315 Ga0495581_0060830 Ga0495581_0060830_878_1483 201
83 3300048903 Ga0496100_0205011 Ga0496100_0205011_635_1240 201
84 3300048904 Ga0496101_0527562 Ga0496101_0527562_295_900 201
85 3300048907 Ga0496104_0007150 Ga0496104_0007150_4678_5283 201
86 3300048908 Ga0496105_0000482 Ga0496105_0000482_18516_19121 201
87 3300048911 Ga0496108_0008429 Ga0496108_0008429_5339_5944 201
88 3300048912 Ga0496109_0001031 Ga0496109_0001031_7941_8546 201
89 3300048913 Ga0496110_0035811 Ga0496110_0035811_915_1520 201
90 3300048914 Ga0496111_0004585 Ga0496111_0004585_4555_5160 201
91 3300048915 Ga0496112_0003839 Ga0496112_0003839_2572_3177 201
92 3300048916 Ga0496113_0003551 Ga0496113_0003551_4196_4801 201
93 3300048918 Ga0496115_0017599 Ga0496115_0017599_763_1368 201
94 iso_pu_bacteria 2513237305 2514418906 201
95 iso_pu_bacteria 2721755686 2723577734 201
96 iso_pu_bacteria 2847670302 2847672127 201
97 iso_pu_bacteria 2856314179 2856318063 201
98 iso_pu_bacteria 2878035449 2878037321 201
99 iso_pu_bacteria 2906414383 2906418100 201
100 3300049574 Ga0501038_0316478 Ga0501038_0316478_475_1083 202
101 3300053130 Ga0500642_0003203 Ga0500642_0003203_1910_2518 202
102 3300039450 Ga0436363_1471007 Ga0436363_1471007_26_679 203
103 3300039437 Ga0436365_0008345 Ga0436365_0008345_83_721 204
104 3300053119 Ga0500595_000488 Ga0500595_000488_18319_18939 206
105 3300005336 Ga0070680_100046764 Ga0070680_1000467644 207
106 3300005338 Ga0068868_100162476 Ga0068868_1001624763 207
107 3300005339 Ga0070660_100295644 Ga0070660_1002956442 207
108 3300005530 Ga0070679_100046230 Ga0070679_1000462301 207
109 3300005539 Ga0068853_100405328 Ga0068853_1004053281 207
110 3300005548 Ga0070665_100039425 Ga0070665_1000394252 207
111 3300005548 Ga0070665_100970110 Ga0070665_1009701101 207
112 3300005563 Ga0068855_100007214 Ga0068855_10000721414 207
113 3300005563 Ga0068855_100120752 Ga0068855_1001207521 207
114 3300005577 Ga0068857_100104849 Ga0068857_1001048493 207
115 3300005937 Ga0081455_10321761 Ga0081455_103217612 207
116 3300006237 Ga0097621_100626984 Ga0097621_1006269842 207
117 3300006358 Ga0068871_100256054 Ga0068871_1002560542 207
118 3300009093 Ga0105240_10004599 Ga0105240_1000459910 207
119 3300009093 Ga0105240_10010835 Ga0105240_1001083514 207
120 3300009093 Ga0105240_10032518 Ga0105240_100325188 207
121 3300009093 Ga0105240_10700018 Ga0105240_107000182 207
122 3300009174 Ga0105241_10236061 Ga0105241_102360612 207
123 3300009177 Ga0105248_10047218 Ga0105248_100472184 207
124 3300009177 Ga0105248_10054164 Ga0105248_100541644 207
125 3300009545 Ga0105237_10041301 Ga0105237_100413014 207
126 3300009545 Ga0105237_10049027 Ga0105237_100490275 207
127 3300009551 Ga0105238_10032847 Ga0105238_100328473 207
128 3300009551 Ga0105238_10162976 Ga0105238_101629763 207
129 3300009551 Ga0105238_10441385 Ga0105238_104413852 207
130 3300009551 Ga0105238_10441455 Ga0105238_104414552 207
131 3300009553 Ga0105249_10074782 Ga0105249_100747823 207
132 3300010375 Ga0105239_10019217 Ga0105239_100192175 207
133 3300010375 Ga0105239_10360360 Ga0105239_103603602 207
134 3300010375 Ga0105239_10470357 Ga0105239_104703572 207
135 3300013104 Ga0157370_10392627 Ga0157370_103926272 207
136 3300013105 Ga0157369_10038476 Ga0157369_100384763 207
137 3300013297 Ga0157378_10260310 Ga0157378_102603103 207
138 3300013306 Ga0163162_10037598 Ga0163162_100375985 207
139 3300013306 Ga0163162_11139664 Ga0163162_111396641 207
140 3300013307 Ga0157372_10176347 Ga0157372_101763473 207
141 3300014325 Ga0163163_10113422 Ga0163163_101134223 207
142 3300014968 Ga0157379_10119366 Ga0157379_101193662 207
143 3300014969 Ga0157376_10051992 Ga0157376_100519922 207
144 3300025909 Ga0207705_10807895 Ga0207705_108078951 207
145 3300025911 Ga0207654_10029052 Ga0207654_100290523 207
146 3300025913 Ga0207695_10003669 Ga0207695_1000366910 207
147 3300025913 Ga0207695_10017992 Ga0207695_100179927 207
148 3300025913 Ga0207695_10026512 Ga0207695_100265126 207
149 3300025913 Ga0207695_10280006 Ga0207695_102800062 207
150 3300025914 Ga0207671_10053662 Ga0207671_100536624 207
151 3300025915 Ga0207693_10233075 Ga0207693_102330752 207
152 3300025917 Ga0207660_10176585 Ga0207660_101765852 207
153 3300025919 Ga0207657_10321237 Ga0207657_103212372 207
154 3300025920 Ga0207649_10343688 Ga0207649_103436882 207
155 3300025924 Ga0207694_10016800 Ga0207694_100168005 207
156 3300025924 Ga0207694_10034745 Ga0207694_100347454 207
157 3300025924 Ga0207694_10072994 Ga0207694_100729943 207
158 3300025940 Ga0207691_11107557 Ga0207691_111075571 207
159 3300025949 Ga0207667_10071631 Ga0207667_100716315 207
160 3300026041 Ga0207639_10159277 Ga0207639_101592772 207
161 3300026041 Ga0207639_10330127 Ga0207639_103301272 207
162 3300026116 Ga0207674_10239216 Ga0207674_102392162 207
163 3300026121 Ga0207683_10024158 Ga0207683_100241584 207
164 3300028379 Ga0268266_10350825 Ga0268266_103508252 207
165 3300028380 Ga0268265_10089702 Ga0268265_100897022 207
166 3300031247 Ga0265340_10014047 Ga0265340_100140474 207
167 3300031249 Ga0265339_10169594 Ga0265339_101695942 207
168 3300031344 Ga0265316_10225140 Ga0265316_102251402 207
169 3300031711 Ga0265314_10054102 Ga0265314_100541024 207
170 3300037312 Ga0395899_0113318 Ga0395899_0113318_695_1318 207
171 3300037466 Ga0395898_0026421 Ga0395898_0026421_668_1291 207
172 3300038443 Ga0395901_0023830 Ga0395901_0023830_3300_3923 207
173 3300039437 Ga0436365_1517026 Ga0436365_1517026_920_1594 207
174 3300039450 Ga0436363_0178975 Ga0436363_0178975_1867_2490 207
175 3300039453 Ga0436362_1111630 Ga0436362_1111630_274_921 207
176 3300046454 Ga0495592_0352793 Ga0495592_0352793_100_723 207
177 3300046530 Ga0495654_0100240 Ga0495654_0100240_453_1076 207
178 3300046794 Ga0495589_0028027 Ga0495589_0028027_762_1385 207
179 3300047444 Ga0495675_0144520 Ga0495675_0144520_840_1463 207
180 3300048907 Ga0496104_0776106 Ga0496104_0776106_36_659 207
181 3300048918 Ga0496115_0363620 Ga0496115_0363620_320_943 207
182 3300049570 Ga0501033_0004313 Ga0501033_0004313_7224_7847 207
183 3300049572 Ga0501036_0047332 Ga0501036_0047332_355_978 207
184 3300049573 Ga0501037_0050147 Ga0501037_0050147_481_1104 207
185 3300049579 Ga0501043_0054048 Ga0501043_0054048_1897_2520 207
186 3300049581 Ga0501047_0319959 Ga0501047_0319959_182_805 207
187 3300049742 Ga0501080_0160324 Ga0501080_0160324_1147_1770 207
188 3300049822 Ga0501035_0005467 Ga0501035_0005467_4238_4861 207
189 3300049823 Ga0501044_0011026 Ga0501044_0011026_8448_9071 207
190 3300053119 Ga0500595_053327 Ga0500595_053327_151_774 207
191 3300005340 Ga0070689_100234614 Ga0070689_1002346142 208
192 3300005344 Ga0070661_100000861 Ga0070661_1000008616 208
193 3300005539 Ga0068853_100001056 Ga0068853_10000105622 208
194 3300005539 Ga0068853_100092195 Ga0068853_1000921952 208
195 3300005547 Ga0070693_100152211 Ga0070693_1001522112 208
196 3300005563 Ga0068855_100000032 Ga0068855_100000032159 208
197 3300005614 Ga0068856_100352822 Ga0068856_1003528222 208
198 3300005616 Ga0068852_100046670 Ga0068852_1000466702 208
199 3300005616 Ga0068852_100322548 Ga0068852_1003225481 208
200 3300005616 Ga0068852_100644268 Ga0068852_1006442681 208
201 3300006237 Ga0097621_100323588 Ga0097621_1003235882 208
202 3300006358 Ga0068871_100495113 Ga0068871_1004951131 208
203 3300009093 Ga0105240_10000479 Ga0105240_1000047964 208
204 3300009093 Ga0105240_10077549 Ga0105240_100775494 208
205 3300009093 Ga0105240_10753593 Ga0105240_107535932 208
206 3300009098 Ga0105245_10006206 Ga0105245_100062066 208
207 3300009174 Ga0105241_10072693 Ga0105241_100726932 208
208 3300009177 Ga0105248_10000005 Ga0105248_10000005321 208
209 3300009177 Ga0105248_10817832 Ga0105248_108178322 208
210 3300009551 Ga0105238_10072228 Ga0105238_100722285 208
211 3300010375 Ga0105239_10000773 Ga0105239_1000077348 208
212 3300013105 Ga0157369_10195282 Ga0157369_101952821 208
213 3300013307 Ga0157372_10024742 Ga0157372_100247424 208
214 3300013307 Ga0157372_10043609 Ga0157372_100436093 208
215 3300013307 Ga0157372_10050956 Ga0157372_100509564 208
216 3300021377 Ga0213874_10002961 Ga0213874_100029613 208
217 3300025911 Ga0207654_10122573 Ga0207654_101225732 208
218 3300025913 Ga0207695_10000018 Ga0207695_10000018705 208
219 3300025913 Ga0207695_10539090 Ga0207695_105390902 208
220 3300025920 Ga0207649_10000249 Ga0207649_1000024919 208
221 3300025920 Ga0207649_10058975 Ga0207649_100589752 208
222 3300025924 Ga0207694_10000005 Ga0207694_10000005155 208
223 3300025941 Ga0207711_10000002 Ga0207711_10000002321 208
224 3300025949 Ga0207667_10000011 Ga0207667_10000011430 208
225 3300026041 Ga0207639_10005721 Ga0207639_100057217 208
226 3300026142 Ga0207698_10323709 Ga0207698_103237092 208
227 3300026142 Ga0207698_10455524 Ga0207698_104555242 208
228 3300028577 Ga0265318_10000229 Ga0265318_1000022910 208
229 3300028577 Ga0265318_10012323 Ga0265318_100123232 208
230 3300028800 Ga0265338_10000005 Ga0265338_10000005564 208
231 3300028800 Ga0265338_10167012 Ga0265338_101670122 208
232 3300031235 Ga0265330_10010259 Ga0265330_100102594 208
233 3300031235 Ga0265330_10105341 Ga0265330_101053412 208
234 3300031238 Ga0265332_10080734 Ga0265332_100807342 208
235 3300031238 Ga0265332_10223680 Ga0265332_102236801 208
236 3300031241 Ga0265325_10000063 Ga0265325_1000006333 208
237 3300031241 Ga0265325_10010028 Ga0265325_100100283 208
238 3300031241 Ga0265325_10024481 Ga0265325_100244812 208
239 3300031241 Ga0265325_10230398 Ga0265325_102303981 208
240 3300031242 Ga0265329_10072209 Ga0265329_100722092 208
241 3300031247 Ga0265340_10000936 Ga0265340_100009362 208
242 3300031247 Ga0265340_10005377 Ga0265340_1000537712 208
243 3300031247 Ga0265340_10017558 Ga0265340_100175584 208
244 3300031249 Ga0265339_10000646 Ga0265339_1000064629 208
245 3300031249 Ga0265339_10011271 Ga0265339_100112716 208
246 3300031249 Ga0265339_10014043 Ga0265339_100140435 208
247 3300031249 Ga0265339_10037450 Ga0265339_100374504 208
248 3300031250 Ga0265331_10000003 Ga0265331_10000003255 208
249 3300031250 Ga0265331_10000895 Ga0265331_1000089511 208
250 3300031250 Ga0265331_10084011 Ga0265331_100840112 208
251 3300031250 Ga0265331_10100110 Ga0265331_101001102 208
252 3300031251 Ga0265327_10000786 Ga0265327_1000078619 208
253 3300031344 Ga0265316_10051487 Ga0265316_100514873 208
254 3300031344 Ga0265316_10056825 Ga0265316_100568253 208
255 3300031344 Ga0265316_10187993 Ga0265316_101879932 208
256 3300031344 Ga0265316_10242915 Ga0265316_102429152 208
257 3300031595 Ga0265313_10002135 Ga0265313_1000213511 208
258 3300031595 Ga0265313_10005847 Ga0265313_1000584710 208
259 3300031595 Ga0265313_10039934 Ga0265313_100399343 208
260 3300031595 Ga0265313_10082896 Ga0265313_100828962 208
261 3300031711 Ga0265314_10001323 Ga0265314_100013239 208
262 3300031711 Ga0265314_10071726 Ga0265314_100717262 208
263 3300031711 Ga0265314_10073703 Ga0265314_100737033 208
264 3300031711 Ga0265314_10085281 Ga0265314_100852812 208
265 3300031711 Ga0265314_10146547 Ga0265314_101465472 208
266 3300031711 Ga0265314_10175459 Ga0265314_101754592 208
267 3300031711 Ga0265314_10307967 Ga0265314_103079671 208
268 3300031712 Ga0265342_10012746 Ga0265342_100127463 208
269 3300031712 Ga0265342_10035769 Ga0265342_100357694 208
270 3300031730 Ga0307516_10015530 Ga0307516_1001553010 208
271 3300035089 Ga0373944_0011923 Ga0373944_0011923_72_698 208
272 3300035116 Ga0373945_0052486 Ga0373945_0052486_381_1007 208
273 3300035170 Ga0373943_0085065 Ga0373943_0085065_931_1572 208
274 3300035692 Ga0373935_0038961 Ga0373935_0038961_1163_1789 208
275 3300035695 Ga0373927_0303908 Ga0373927_0303908_333_959 208
276 3300035725 Ga0373947_0009240 Ga0373947_0009240_2929_3570 208
277 3300036401 Ga0373937_0299967 Ga0373937_0299967_568_1194 208
278 3300037068 Ga0373925_0005279 Ga0373925_0005279_3483_4109 208
279 3300039437 Ga0436365_0097042 Ga0436365_0097042_108061_108687 208
280 3300039437 Ga0436365_1196036 Ga0436365_1196036_68431_69057 208
281 3300039438 Ga0436360_0732864 Ga0436360_0732864_159_785 208
282 3300039450 Ga0436363_0083494 Ga0436363_0083494_1236_1862 208
283 3300046472 Ga0495580_0017366 Ga0495580_0017366_2465_3091 208
284 3300046472 Ga0495580_0257762 Ga0495580_0257762_521_1147 208
285 3300046473 Ga0495582_0102300 Ga0495582_0102300_70_696 208
286 3300046477 Ga0495664_0135203 Ga0495664_0135203_303_929 208
287 3300046477 Ga0495664_0265704 Ga0495664_0265704_178_804 208
288 3300046514 Ga0495618_0147575 Ga0495618_0147575_528_1178 208
289 3300046526 Ga0495666_0167718 Ga0495666_0167718_72_698 208
290 3300046529 Ga0495652_0053995 Ga0495652_0053995_56_682 208
291 3300046543 Ga0495645_0025189 Ga0495645_0025189_1830_2456 208
292 3300046543 Ga0495645_0088099 Ga0495645_0088099_608_1234 208
293 3300046678 Ga0495599_0138186 Ga0495599_0138186_170_820 208
294 3300046683 Ga0495658_0015464 Ga0495658_0015464_2459_3085 208
295 3300047315 Ga0495581_0122396 Ga0495581_0122396_548_1174 208
296 3300049460 Ga0495682_0002318 Ga0495682_0002318_5389_6015 208
297 3300049569 Ga0501032_0041971 Ga0501032_0041971_324_950 208
298 3300049569 Ga0501032_0055865 Ga0501032_0055865_1269_1895 208
299 3300049569 Ga0501032_0223337 Ga0501032_0223337_472_1098 208
300 3300049571 Ga0501034_0014746 Ga0501034_0014746_2835_3461 208
301 3300049571 Ga0501034_0024132 Ga0501034_0024132_4574_5200 208
302 3300049572 Ga0501036_0051291 Ga0501036_0051291_820_1446 208
303 3300049572 Ga0501036_0226813 Ga0501036_0226813_429_1055 208
304 3300049573 Ga0501037_0309474 Ga0501037_0309474_281_907 208
305 3300049574 Ga0501038_0093089 Ga0501038_0093089_910_1536 208
306 3300049574 Ga0501038_0098841 Ga0501038_0098841_1299_1925 208
307 3300049579 Ga0501043_0037682 Ga0501043_0037682_2514_3140 208
308 3300049580 Ga0501046_0008512 Ga0501046_0008512_4128_4754 208
309 3300049580 Ga0501046_0147140 Ga0501046_0147140_1023_1649 208
310 3300049580 Ga0501046_0287284 Ga0501046_0287284_54_680 208
311 3300049581 Ga0501047_0002290 Ga0501047_0002290_15957_16583 208
312 3300049581 Ga0501047_0020344 Ga0501047_0020344_4028_4654 208
313 3300049581 Ga0501047_0047913 Ga0501047_0047913_67_693 208
314 3300049581 Ga0501047_0060096 Ga0501047_0060096_2567_3193 208
315 3300049581 Ga0501047_0256963 Ga0501047_0256963_30_656 208
316 3300049581 Ga0501047_0332346 Ga0501047_0332346_268_894 208
317 3300049581 Ga0501047_0455827 Ga0501047_0455827_181_807 208
318 3300049583 Ga0501067_0005861 Ga0501067_0005861_2380_3006 208
319 3300049585 Ga0501069_0063135 Ga0501069_0063135_941_1567 208
320 3300049586 Ga0501070_0000099 Ga0501070_0000099_65224_65850 208
321 3300049586 Ga0501070_0004535 Ga0501070_0004535_3574_4200 208
322 3300049586 Ga0501070_0069508 Ga0501070_0069508_372_998 208
323 3300049586 Ga0501070_0149199 Ga0501070_0149199_61_687 208
324 3300049589 Ga0501073_0042537 Ga0501073_0042537_868_1494 208
325 3300049590 Ga0501074_0521808 Ga0501074_0521808_156_782 208
326 3300049593 Ga0501077_0294686 Ga0501077_0294686_140_766 208
327 3300049741 Ga0501079_0073444 Ga0501079_0073444_472_1098 208
328 3300049742 Ga0501080_0006241 Ga0501080_0006241_6845_7471 208
329 3300049742 Ga0501080_0029119 Ga0501080_0029119_794_1420 208
330 3300049742 Ga0501080_0064589 Ga0501080_0064589_1937_2563 208
331 3300049742 Ga0501080_0254653 Ga0501080_0254653_468_1094 208
332 3300049822 Ga0501035_0002478 Ga0501035_0002478_684_1310 208
333 3300049822 Ga0501035_0003009 Ga0501035_0003009_7646_8272 208
334 3300049822 Ga0501035_0089752 Ga0501035_0089752_1142_1768 208
335 3300049823 Ga0501044_0005283 Ga0501044_0005283_230_856 208
336 3300049823 Ga0501044_0019850 Ga0501044_0019850_161_802 208
337 3300049823 Ga0501044_0032666 Ga0501044_0032666_4433_5059 208
338 3300049823 Ga0501044_0078111 Ga0501044_0078111_1398_2024 208
339 3300053154 Ga0500619_009905 Ga0500619_009905_845_1471 208
340 3300054114 Ga0501084_0004445 Ga0501084_0004445_2147_2773 208
341 3300054114 Ga0501084_0030156 Ga0501084_0030156_241_867 208
342 3300060353 Ga0501082_0064968 Ga0501082_0064968_1901_2527 208
343 3300060353 Ga0501082_0167554 Ga0501082_0167554_999_1625 208
344 3300005329 Ga0070683_100162972 Ga0070683_1001629722 209
345 3300005331 Ga0070670_100482539 Ga0070670_1004825392 209
346 3300005334 Ga0068869_100044377 Ga0068869_1000443773 209
347 3300005335 Ga0070666_10131893 Ga0070666_101318932 209
348 3300005335 Ga0070666_10297612 Ga0070666_102976122 209
349 3300005336 Ga0070680_100241226 Ga0070680_1002412262 209
350 3300005338 Ga0068868_100120854 Ga0068868_1001208541 209
351 3300005339 Ga0070660_100296667 Ga0070660_1002966672 209
352 3300005340 Ga0070689_100155994 Ga0070689_1001559941 209
353 3300005344 Ga0070661_100206633 Ga0070661_1002066332 209
354 3300005364 Ga0070673_100447535 Ga0070673_1004475352 209
355 3300005367 Ga0070667_100003789 Ga0070667_1000037893 209
356 3300005367 Ga0070667_100118565 Ga0070667_1001185653 209
357 3300005439 Ga0070711_100559274 Ga0070711_1005592742 209
358 3300005456 Ga0070678_100746995 Ga0070678_1007469951 209
359 3300005457 Ga0070662_100463872 Ga0070662_1004638721 209
360 3300005458 Ga0070681_10122488 Ga0070681_101224882 209
361 3300005535 Ga0070684_100733876 Ga0070684_1007338762 209
362 3300005543 Ga0070672_100223700 Ga0070672_1002237002 209
363 3300005548 Ga0070665_100026065 Ga0070665_1000260654 209
364 3300005548 Ga0070665_100666384 Ga0070665_1006663842 209
365 3300005548 Ga0070665_100715381 Ga0070665_1007153812 209
366 3300005563 Ga0068855_100081450 Ga0068855_1000814506 209
367 3300005577 Ga0068857_100097875 Ga0068857_1000978753 209
368 3300005577 Ga0068857_100401916 Ga0068857_1004019162 209
369 3300005577 Ga0068857_100529113 Ga0068857_1005291132 209
370 3300005614 Ga0068856_100082046 Ga0068856_1000820462 209
371 3300005617 Ga0068859_100355300 Ga0068859_1003553002 209
372 3300005618 Ga0068864_100726747 Ga0068864_1007267472 209
373 3300005718 Ga0068866_10191756 Ga0068866_101917562 209
374 3300005719 Ga0068861_100290814 Ga0068861_1002908142 209
375 3300005840 Ga0068870_10014019 Ga0068870_100140193 209
376 3300005841 Ga0068863_100463508 Ga0068863_1004635081 209
377 3300005842 Ga0068858_100026869 Ga0068858_1000268693 209
378 3300005842 Ga0068858_100141635 Ga0068858_1001416352 209
379 3300005843 Ga0068860_100037003 Ga0068860_1000370035 209
380 3300005843 Ga0068860_100603692 Ga0068860_1006036922 209
381 3300005844 Ga0068862_100539137 Ga0068862_1005391371 209
382 3300006175 Ga0070712_100403935 Ga0070712_1004039352 209
383 3300006186 Ga0075369_10033546 Ga0075369_100335462 209
384 3300006237 Ga0097621_100134618 Ga0097621_1001346182 209
385 3300006358 Ga0068871_100005261 Ga0068871_1000052615 209
386 3300006358 Ga0068871_101137543 Ga0068871_1011375431 209
387 3300006931 Ga0097620_100355299 Ga0097620_1003552992 209
388 3300009098 Ga0105245_10163151 Ga0105245_101631513 209
389 3300009148 Ga0105243_10052682 Ga0105243_100526823 209
390 3300009174 Ga0105241_10589340 Ga0105241_105893402 209
391 3300009176 Ga0105242_10185535 Ga0105242_101855352 209
392 3300009176 Ga0105242_10238381 Ga0105242_102383812 209
393 3300013297 Ga0157378_10009799 Ga0157378_1000979912 209
394 3300013307 Ga0157372_10785005 Ga0157372_107850052 209
395 3300013308 Ga0157375_10528125 Ga0157375_105281252 209
396 3300014968 Ga0157379_10098774 Ga0157379_100987743 209
397 3300025261 Ga0209233_1000015 Ga0209233_1000015913 209
398 3300025261 Ga0209233_1002448 Ga0209233_10024486 209
399 3300025899 Ga0207642_10138794 Ga0207642_101387942 209
400 3300025901 Ga0207688_10044386 Ga0207688_100443863 209
401 3300025907 Ga0207645_10020582 Ga0207645_100205824 209
402 3300025908 Ga0207643_10523815 Ga0207643_105238151 209
403 3300025909 Ga0207705_10214193 Ga0207705_102141932 209
404 3300025911 Ga0207654_10128435 Ga0207654_101284352 209
405 3300025912 Ga0207707_10126855 Ga0207707_101268552 209
406 3300025913 Ga0207695_10046311 Ga0207695_100463112 209
407 3300025913 Ga0207695_10098966 Ga0207695_100989662 209
408 3300025913 Ga0207695_10137879 Ga0207695_101378792 209
409 3300025914 Ga0207671_10052231 Ga0207671_100522313 209
410 3300025917 Ga0207660_10044973 Ga0207660_100449733 209
411 3300025919 Ga0207657_10020081 Ga0207657_100200815 209
412 3300025920 Ga0207649_10106068 Ga0207649_101060682 209
413 3300025924 Ga0207694_10231118 Ga0207694_102311182 209
414 3300025925 Ga0207650_10276757 Ga0207650_102767572 209
415 3300025925 Ga0207650_10281210 Ga0207650_102812102 209
416 3300025933 Ga0207706_10026707 Ga0207706_100267075 209
417 3300025934 Ga0207686_10025082 Ga0207686_100250822 209
418 3300025936 Ga0207670_10123787 Ga0207670_101237871 209
419 3300025937 Ga0207669_10236215 Ga0207669_102362152 209
420 3300025940 Ga0207691_10208166 Ga0207691_102081662 209
421 3300025940 Ga0207691_10225116 Ga0207691_102251162 209
422 3300025941 Ga0207711_10224309 Ga0207711_102243092 209
423 3300025942 Ga0207689_10034593 Ga0207689_100345932 209
424 3300025942 Ga0207689_10101090 Ga0207689_101010903 209
425 3300025942 Ga0207689_10288424 Ga0207689_102884242 209
426 3300025944 Ga0207661_10207297 Ga0207661_102072972 209
427 3300025949 Ga0207667_10025601 Ga0207667_100256015 209
428 3300025960 Ga0207651_10079159 Ga0207651_100791593 209
429 3300025961 Ga0207712_10106810 Ga0207712_101068102 209
430 3300025986 Ga0207658_10196265 Ga0207658_101962652 209
431 3300026023 Ga0207677_10048023 Ga0207677_100480233 209
432 3300026023 Ga0207677_10236689 Ga0207677_102366892 209
433 3300026035 Ga0207703_10101757 Ga0207703_101017572 209
434 3300026035 Ga0207703_10459524 Ga0207703_104595242 209
435 3300026035 Ga0207703_11220018 Ga0207703_112200181 209
436 3300026095 Ga0207676_10612000 Ga0207676_106120002 209
437 3300026116 Ga0207674_10253848 Ga0207674_102538483 209
438 3300026116 Ga0207674_10310155 Ga0207674_103101553 209
439 3300026118 Ga0207675_100051411 Ga0207675_1000514113 209
440 3300026118 Ga0207675_100276982 Ga0207675_1002769822 209
441 3300026121 Ga0207683_10027890 Ga0207683_100278902 209
442 3300026142 Ga0207698_10422497 Ga0207698_104224971 209
443 3300026142 Ga0207698_10906708 Ga0207698_109067081 209
444 3300028379 Ga0268266_10116466 Ga0268266_101164663 209
445 3300028379 Ga0268266_10122767 Ga0268266_101227672 209
446 3300028379 Ga0268266_10182258 Ga0268266_101822582 209
447 3300028379 Ga0268266_10302039 Ga0268266_103020393 209
448 3300028380 Ga0268265_10904124 Ga0268265_109041242 209
449 3300028381 Ga0268264_10039885 Ga0268264_100398854 209
450 3300028800 Ga0265338_10010305 Ga0265338_100103052 209
451 3300031238 Ga0265332_10035600 Ga0265332_100356003 209
452 3300031247 Ga0265340_10161619 Ga0265340_101616192 209
453 3300031250 Ga0265331_10281360 Ga0265331_102813601 209
454 3300031344 Ga0265316_10144622 Ga0265316_101446221 209
455 3300031595 Ga0265313_10175361 Ga0265313_101753611 209
456 3300031712 Ga0265342_10092237 Ga0265342_100922371 209
457 3300035088 Ga0373940_0077836 Ga0373940_0077836_296_925 209
458 3300035112 Ga0373932_0136500 Ga0373932_0136500_179_808 209
459 3300035242 Ga0373962_0038008 Ga0373962_0038008_450_1079 209
460 3300035692 Ga0373935_0638982 Ga0373935_0638982_60_689 209
461 3300039437 Ga0436365_1402802 Ga0436365_1402802_23_652 209
462 3300046675 Ga0495657_0068478 Ga0495657_0068478_1567_2196 209
463 3300046684 Ga0495669_0185558 Ga0495669_0185558_83_712 209
464 3300047445 Ga0495677_0053250 Ga0495677_0053250_461_1090 209
465 3300048921 Ga0496118_0274239 Ga0496118_0274239_56_706 209
466 3300049571 Ga0501034_0113099 Ga0501034_0113099_1439_2068 209
467 3300049742 Ga0501080_0502015 Ga0501080_0502015_386_1015 209
468 3300049744 Ga0501083_0114381 Ga0501083_0114381_1071_1700 209
469 3300050516 nmdc:mga0sz30_24194_c1 nmdc:mga0sz30_24194_c1_496_1146 209
470 3300050516 nmdc:mga0sz30_83548_c1 nmdc:mga0sz30_83548_c1_50_700 209
471 3300053087 Ga0500643_000003 Ga0500643_000003_675073_675726 209
472 3300053140 Ga0500573_0000037 Ga0500573_0000037_63502_64131 209
473 3300060353 Ga0501082_0062239 Ga0501082_0062239_2449_3078 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10590

PNP_phzG_C

Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region

171

213

0.98

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

28

113

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ci0-assembly1.cif.gz_B pnp oxidase from saccharomyces cerevisiae 0.9547 16 209
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9487 12 209
1nrg-assembly1.cif.gz_A-2 structure and properties of recombinant human pyridoxine-5'-phosphate oxidase 0.9478 16 209
6h00-assembly1.cif.gz_A-2 crystal structure of human pyridoxine 5-phophate oxidase, r116q variant 0.9423 18 209
1dnl-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution 0.9422 12 209
ID Description Score Start End Superfamily
af_Q9UTQ1_28_231_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9565 19 209 2.30.110.10
af_Q9VHZ5_37_246_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9446 14 209 2.30.110.10
6h00A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9423 18 209 2.30.110.10
1g78A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9399 12 209 2.30.110.10
1g78A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9352 12 209 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A2N3E282-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.987 17 171 GO:0004733
GO:0008615
GO:0010181
AF-A0A0F2S1F8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9868 17 149 GO:0004733
GO:0008615
GO:0010181
AF-A0A519NY72-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9859 17 178 GO:0004733
GO:0008615
GO:0010181
AF-A0A1L3L8Y1-F1-model_v4 deleted 0.9828 17 209
AF-A0A2T4VXA0-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9825 21 209 GO:0004733
GO:0008615
GO:0010181

Feature Viewer

pLDDT pTM Quality
90.32 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map