F451111

General Info

Members Datasets Scaffolds Average Seq Length
473 273 946 276

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221614|2644086828
Length 316
Sequence EVKHDYHLLPPSPWPLVGSLSATIMAIGGVIWMKGMFGLPEGFPWVFFIGLGGVLYTMWGWWSDVIKESKAGDHTPVVSIGLRYGMIMFIASEVMFFVAWFWIFFEMALFHEARTLSSIEEVRAAWATWPPAGIETVPAWNLPLLNTLILLLSGTTVTWAHHAIQQGDRKGTKIGLALTIALGAVFTLVQVYEYIHILDHKYFFGGEGAENSGLYGSSFFMATGFHGFHVLIGTIFLAICLIRLLRGGMSPQKHFGFEAAAWYWHFVDVVWLFLFAFIYVXGGPLGPPIWTAPIRCWRAFAAAARTVERGVCSKAS

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
187 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
195 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
204 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
205 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
212 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
215 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
216 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
219 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
220 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
221 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
222 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
229 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
232 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
235 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
240 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
241 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
242 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
243 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
244 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
245 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
246 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
247 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
248 2643221583 Caulobacter sp. Root655 Isolate Unclassified
249 2643221584 Caulobacter sp. Root656 Isolate Unclassified
250 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
251 2643221640 Caulobacter sp. Root342 Isolate Unclassified
252 2643221642 Caulobacter sp. Root343 Isolate Unclassified
253 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
254 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
255 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
256 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
257 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
258 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
259 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
260 2818991435 Caulobacter henricii 536 Isolate Unclassified
261 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
262 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
263 2849560528 Caulobacter zeae 410 Isolate Unclassified
264 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
265 2851153111 Caulobacter radicis 736 Isolate Unclassified
266 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
267 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
268 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
269 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
270 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
271 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
272 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
273 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 1.48
Isolates 7.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.87
Nodule 0
Rhizoplane 2.11
Rhizosphere 66.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10018118 3300003215 Bacteria 2747
2 Ga0055526_1011275 3300003771 Bacteria 4049
3 Ga0055537_1001047 3300003773 Bacteria 12396
4 Ga0055524_1005820 3300003775 Bacteria 5443
5 Ga0055536_1009400 3300003781 Bacteria 4042
6 Ga0055528_1010924 3300003790 Bacteria 3648
7 Ga0055528_1012287 3300003790 Bacteria 3335
8 Ga0055530_10002776 3300003791 Bacteria 10818
9 Ga0055530_10003920 3300003791 Bacteria 8076
10 Ga0055531_10000450 3300003794 Bacteria 38240
11 Ga0055531_10001810 3300003794 Bacteria 15173
12 Ga0055531_10008197 3300003794 Bacteria 5561
13 Ga0065165_1000216 3300005262 Bacteria 100208
14 Ga0065165_1000909 3300005262 Bacteria 38173
15 Ga0065165_1044037 3300005262 Bacteria 1307
16 Ga0070670_100000007 3300005331 Bacteria 318672
17 Ga0070666_10128515 3300005335 Bacteria 1760
18 Ga0070660_100113405 3300005339 Bacteria 2159
19 Ga0070668_100000878 3300005347 Bacteria 20896
20 Ga0070668_100001422 3300005347 Bacteria 17258
21 Ga0070668_100003979 3300005347 Bacteria 10938
22 Ga0070668_100005495 3300005347 Bacteria 9398
23 Ga0070668_100006358 3300005347 Bacteria 8750
24 Ga0070669_100031085 3300005353 Bacteria 3855
25 Ga0070671_100000695 3300005355 Bacteria 24129
26 Ga0070671_100045470 3300005355 Bacteria 3650
27 Ga0070659_100002614 3300005366 Bacteria 12809
28 Ga0070659_100009203 3300005366 Bacteria 7249
29 Ga0070659_100017175 3300005366 Bacteria 5439
30 Ga0070667_100002972 3300005367 Bacteria 14567
31 Ga0070667_100013139 3300005367 Bacteria 6845
32 Ga0070667_100027596 3300005367 Bacteria 4724
33 Ga0070667_100135396 3300005367 Bacteria 2153
34 Ga0070663_100073505 3300005455 Bacteria 2494
35 Ga0070681_10006243 3300005458 Bacteria 11591
36 Ga0070681_10079782 3300005458 Bacteria 3229
37 Ga0070679_100002173 3300005530 Bacteria 17693
38 Ga0070679_100014918 3300005530 Bacteria 7463
39 Ga0070679_100302637 3300005530 Bacteria 1550
40 Ga0068853_100038672 3300005539 Bacteria 4064
41 Ga0068853_100049754 3300005539 Bacteria 3603
42 Ga0070665_100000517 3300005548 Bacteria 54900
43 Ga0070665_100000744 3300005548 Bacteria 43397
44 Ga0070665_100004164 3300005548 Bacteria 15220
45 Ga0070665_100054965 3300005548 Bacteria 3993
46 Ga0068855_100269320 3300005563 Bacteria 1894
47 Ga0070664_100328574 3300005564 Bacteria 1387
48 Ga0070664_100388602 3300005564 Bacteria 1275
49 Ga0068856_100035136 3300005614 Bacteria 4911
50 Ga0068852_100272295 3300005616 Bacteria 1630
51 Ga0068859_100001205 3300005617 Bacteria 26395
52 Ga0068859_100002155 3300005617 Bacteria 20004
53 Ga0068864_100000093 3300005618 Bacteria 93540
54 Ga0068864_100004767 3300005618 Bacteria 11114
55 Ga0068864_100010560 3300005618 Bacteria 7634
56 Ga0068864_100123357 3300005618 Bacteria 2319
57 Ga0068861_100008049 3300005719 Bacteria 7255
58 Ga0068863_100000045 3300005841 Bacteria 147269
59 Ga0068863_100015616 3300005841 Bacteria 7294
60 Ga0068863_100024571 3300005841 Bacteria 5746
61 Ga0068863_100057765 3300005841 Bacteria 3671
62 Ga0068858_100000144 3300005842 Bacteria 75375
63 Ga0068858_100024542 3300005842 Bacteria 5617
64 Ga0068858_100031424 3300005842 Bacteria 4932
65 Ga0068858_100331553 3300005842 Bacteria 1455
66 Ga0068858_100417297 3300005842 Bacteria 1290
67 Ga0068860_100000109 3300005843 Bacteria 132169
68 Ga0068860_100006980 3300005843 Bacteria 11313
69 Ga0068860_100027832 3300005843 Bacteria 5444
70 Ga0068860_100031729 3300005843 Bacteria 5079
71 Ga0068862_100007193 3300005844 Bacteria 9243
72 Ga0068862_100014838 3300005844 Bacteria 6471
73 Ga0068862_100220557 3300005844 Bacteria 1717
74 Ga0075368_10002103 3300006042 Bacteria 6433
75 Ga0075364_10010180 3300006051 Bacteria 5672
76 Ga0075367_10003072 3300006178 Bacteria 7832
77 Ga0075369_10002897 3300006186 Bacteria 6189
78 Ga0075366_10016467 3300006195 Bacteria 4250
79 Ga0075366_10065429 3300006195 Bacteria 2162
80 Ga0075370_10040383 3300006353 Bacteria 2631
81 Ga0075370_10065353 3300006353 Bacteria 2075
82 Ga0068871_100325436 3300006358 Bacteria 1355
83 Ga0068865_100001402 3300006881 Bacteria 14026
84 Ga0097620_100001205 3300006931 Bacteria 26395
85 Ga0097620_100002155 3300006931 Bacteria 20004
86 Ga0105250_10009814 3300009092 Bacteria 4020
87 Ga0105240_10000581 3300009093 Bacteria 67884
88 Ga0105240_10003448 3300009093 Bacteria 24541
89 Ga0105240_10088550 3300009093 Bacteria 3788
90 Ga0105240_10107839 3300009093 Bacteria 3376
91 Ga0105240_10377450 3300009093 Bacteria 1602
92 Ga0105247_10082027 3300009101 Bacteria 2034
93 Ga0105247_10255279 3300009101 Bacteria 1200
94 Ga0105241_10303141 3300009174 Bacteria 1372
95 Ga0105242_10646817 3300009176 Bacteria 1028
96 Ga0105248_10000303 3300009177 Bacteria 58530
97 Ga0105248_10018058 3300009177 Bacteria 7785
98 Ga0105248_10050697 3300009177 Bacteria 4656
99 Ga0105248_10052086 3300009177 Bacteria 4593
100 Ga0105248_10152139 3300009177 Bacteria 2611
101 Ga0105248_10178999 3300009177 Bacteria 2390
102 Ga0105238_10126187 3300009551 Bacteria 2537
103 Ga0105238_10290160 3300009551 Bacteria 1618
104 Ga0105249_10164597 3300009553 Bacteria 2146
105 Ga0105239_10181678 3300010375 Bacteria 2354
106 Ga0105239_10237189 3300010375 Bacteria 2047
107 Ga0157373_10001998 3300013100 Bacteria 15466
108 Ga0157373_10002767 3300013100 Bacteria 13268
109 Ga0157371_10011667 3300013102 Bacteria 6753
110 Ga0157370_10007136 3300013104 Bacteria 12186
111 Ga0157369_10021257 3300013105 Bacteria 7257
112 Ga0157369_10320503 3300013105 Bacteria 1611
113 Ga0157369_10767705 3300013105 Bacteria 991
114 Ga0157372_10221572 3300013307 Bacteria 2193
115 Ga0163163_10033814 3300014325 Bacteria 4948
116 Ga0163163_10040278 3300014325 Bacteria 4562
117 Ga0163163_10062599 3300014325 Bacteria 3687
118 Ga0163163_10070721 3300014325 Bacteria 3475
119 Ga0163163_10177765 3300014325 Bacteria 2175
120 Ga0163163_10551031 3300014325 Bacteria 1216
121 Ga0157379_10005669 3300014968 Bacteria 10735
122 Ga0182007_10023975 3300015262 Bacteria 2140
123 Ga0163161_10156665 3300017792 Bacteria 1734
124 Ga0213872_10017308 3300021361 Bacteria 3333
125 Ga0213876_10000126 3300021384 Bacteria 83223
126 Ga0209026_1000529 3300025250 Bacteria 26533
127 Ga0209565_1000395 3300025263 Bacteria 36792
128 Ga0209673_1002705 3300025273 Bacteria 11755
129 Ga0209675_1032032 3300025291 Bacteria 1235
130 Ga0209676_1000038 3300025292 Bacteria 449305
131 Ga0209676_1000414 3300025292 Bacteria 76877
132 Ga0209676_1013341 3300025292 Bacteria 3165
133 Ga0209758_1001277 3300025297 Bacteria 31069
134 Ga0209758_1011458 3300025297 Bacteria 5134
135 Ga0209050_1000090 3300025298 Bacteria 253783
136 Ga0209050_1001001 3300025298 Bacteria 35419
137 Ga0209050_1014059 3300025298 Bacteria 3487
138 Ga0209051_1002440 3300025303 Bacteria 13363
139 Ga0209257_1000059 3300025304 Bacteria 378097
140 Ga0209257_1000186 3300025304 Bacteria 154365
141 Ga0209257_1000433 3300025304 Bacteria 80612
142 Ga0209257_1000616 3300025304 Bacteria 57900
143 Ga0209257_1004272 3300025304 Bacteria 11258
144 Ga0207710_10046826 3300025900 Bacteria 1931
145 Ga0207710_10148264 3300025900 Bacteria 1136
146 Ga0207705_10001192 3300025909 Bacteria 21073
147 Ga0207705_10082009 3300025909 Bacteria 2351
148 Ga0207705_10087286 3300025909 Bacteria 2281
149 Ga0207707_10010989 3300025912 Bacteria 7877
150 Ga0207707_10044456 3300025912 Bacteria 3873
151 Ga0207695_10001227 3300025913 Bacteria 43906
152 Ga0207695_10003226 3300025913 Bacteria 23212
153 Ga0207695_10005953 3300025913 Bacteria 15959
154 Ga0207695_10265562 3300025913 Bacteria 1613
155 Ga0207671_10413881 3300025914 Bacteria 1072
156 Ga0207660_10002637 3300025917 Bacteria 11764
157 Ga0207660_10044874 3300025917 Bacteria 3111
158 Ga0207657_10000435 3300025919 Bacteria 44495
159 Ga0207657_10052533 3300025919 Bacteria 3536
160 Ga0207652_10008353 3300025921 Bacteria 8327
161 Ga0207652_10560347 3300025921 Bacteria 1026
162 Ga0207681_10027943 3300025923 Bacteria 3652
163 Ga0207694_10008963 3300025924 Bacteria 7554
164 Ga0207694_10130904 3300025924 Bacteria 2011
165 Ga0207694_10226435 3300025924 Bacteria 1526
166 Ga0207650_10000030 3300025925 Bacteria 235824
167 Ga0207650_10205472 3300025925 Bacteria 1580
168 Ga0207644_10000370 3300025931 Bacteria 29393
169 Ga0207644_10017345 3300025931 Bacteria 4861
170 Ga0207690_10000092 3300025932 Bacteria 74832
171 Ga0207690_10010641 3300025932 Bacteria 5480
172 Ga0207690_10041134 3300025932 Bacteria 3027
173 Ga0207706_10078965 3300025933 Bacteria 2894
174 Ga0207704_10008604 3300025938 Bacteria 4889
175 Ga0207711_10004063 3300025941 Bacteria 12556
176 Ga0207711_10004978 3300025941 Bacteria 11272
177 Ga0207711_10008069 3300025941 Bacteria 8812
178 Ga0207711_10031364 3300025941 Bacteria 4486
179 Ga0207711_10052669 3300025941 Bacteria 3489
180 Ga0207679_10068886 3300025945 Bacteria 2660
181 Ga0207667_10004054 3300025949 Bacteria 17992
182 Ga0207667_10011017 3300025949 Bacteria 10533
183 Ga0207667_10013524 3300025949 Bacteria 9332
184 Ga0207667_10063286 3300025949 Bacteria 3865
185 Ga0207712_10001603 3300025961 Bacteria 15207
186 Ga0207712_10254472 3300025961 Bacteria 1421
187 Ga0207668_10000019 3300025972 Bacteria 152108
188 Ga0207668_10001707 3300025972 Bacteria 12845
189 Ga0207668_10002086 3300025972 Bacteria 11662
190 Ga0207668_10014218 3300025972 Bacteria 4922
191 Ga0207668_10019264 3300025972 Bacteria 4310
192 Ga0207640_10152985 3300025981 Bacteria 1697
193 Ga0207658_10000211 3300025986 Bacteria 60993
194 Ga0207658_10025500 3300025986 Bacteria 4140
195 Ga0207658_10033617 3300025986 Bacteria 3659
196 Ga0207658_10092507 3300025986 Bacteria 2349
197 Ga0207703_10000723 3300026035 Bacteria 32469
198 Ga0207703_10005864 3300026035 Bacteria 9836
199 Ga0207703_10022825 3300026035 Bacteria 4915
200 Ga0207703_10042622 3300026035 Bacteria 3641
201 Ga0207639_10026074 3300026041 Bacteria 4244
202 Ga0207639_10044521 3300026041 Bacteria 3338
203 Ga0207641_10000011 3300026088 Bacteria 384362
204 Ga0207641_10028568 3300026088 Bacteria 4608
205 Ga0207641_10033334 3300026088 Bacteria 4279
206 Ga0207641_10036274 3300026088 Bacteria 4115
207 Ga0207676_10000114 3300026095 Bacteria 71881
208 Ga0207676_10000757 3300026095 Bacteria 25281
209 Ga0207676_10029070 3300026095 Bacteria 4134
210 Ga0207676_10319597 3300026095 Bacteria 1424
211 Ga0207676_10472395 3300026095 Bacteria 1186
212 Ga0207675_100033303 3300026118 Bacteria 4802
213 Ga0207683_10156543 3300026121 Bacteria 2058
214 Ga0207683_10743746 3300026121 Bacteria 910
215 Ga0209983_1004824 3300027665 Bacteria 2815
216 Ga0209813_10004640 3300027866 Bacteria 3291
217 Ga0209974_10051407 3300027876 Bacteria 1386
218 Ga0268266_10000005 3300028379 Bacteria 1448194
219 Ga0268266_10000611 3300028379 Bacteria 48682
220 Ga0268266_10027265 3300028379 Bacteria 4858
221 Ga0268266_10073494 3300028379 Bacteria 2967
222 Ga0268265_10021303 3300028380 Bacteria 4538
223 Ga0268264_10000002 3300028381 Bacteria 1153045
224 Ga0268264_10000125 3300028381 Bacteria 186416
225 Ga0268264_10012833 3300028381 Bacteria 6896
226 Ga0265319_1084147 3300028563 Bacteria 1008
227 Ga0265334_10010463 3300028573 Bacteria 3919
228 Ga0265338_10011836 3300028800 Bacteria 10025
229 Ga0265338_10034200 3300028800 Bacteria 4916
230 Ga0265338_10072428 3300028800 Bacteria 2942
231 Ga0307511_10133947 3300030521 Bacteria 1482
232 Ga0265770_1008266 3300030878 Bacteria 1480
233 Ga0265760_10069978 3300031090 Bacteria 1075
234 Ga0265327_10000794 3300031251 Bacteria 48452
235 Ga0265327_10002267 3300031251 Bacteria 20718
236 Ga0265327_10005301 3300031251 Bacteria 10820
237 Ga0265327_10071825 3300031251 Bacteria 1730
238 Ga0307513_10000045 3300031456 Bacteria 158626
239 Ga0307513_10001254 3300031456 Bacteria 36787
240 Ga0307513_10007722 3300031456 Bacteria 13886
241 Ga0307513_10009076 3300031456 Bacteria 12606
242 Ga0307513_10299395 3300031456 Bacteria 1376
243 Ga0307408_100360453 3300031548 Bacteria 1237
244 Ga0307516_10000035 3300031730 Bacteria 152658
245 Ga0307413_10122428 3300031824 Bacteria 1764
246 Ga0307413_10136725 3300031824 Bacteria 1686
247 Ga0307406_10004008 3300031901 Bacteria 8010
248 Ga0307412_10003179 3300031911 Bacteria 9125
249 Ga0307412_10152702 3300031911 Bacteria 1706
250 Ga0307414_10080466 3300032004 Bacteria 2382
251 Ga0307414_10162351 3300032004 Bacteria 1776
252 Ga0307414_10297522 3300032004 Bacteria 1363
253 Ga0307510_10018641 3300033180 Bacteria 8161
254 Ga0307510_10107613 3300033180 Bacteria 2546
255 Ga0307510_10160295 3300033180 Bacteria 1848
256 Ga0373936_0042420 3300035113 Bacteria 1826
257 Ga0373927_0000358 3300035695 Bacteria 35421
258 Ga0373925_0000160 3300037068 Bacteria 72172
259 Ga0395899_0000364 3300037312 Bacteria 54980
260 Ga0395899_0026225 3300037312 Bacteria 4398
261 Ga0395900_0000052 3300037418 Bacteria 223910
262 Ga0395900_0147088 3300037418 Bacteria 2409
263 Ga0395898_0062907 3300037466 Bacteria 3602
264 Ga0395898_0250642 3300037466 Bacteria 1688
265 Ga0395905_0007354 3300037471 Bacteria 10965
266 Ga0395905_0098394 3300037471 Bacteria 2747
267 Ga0395905_0175950 3300037471 Bacteria 2009
268 Ga0436364_0638616 3300037853 Bacteria 2491
269 Ga0436364_1165437 3300037853 Bacteria 1222
270 Ga0395901_0000001 3300038443 Bacteria 800383
271 Ga0395901_0364449 3300038443 Bacteria 1489
272 Ga0395901_0766530 3300038443 Bacteria 956
273 Ga0436365_0055940 3300039437 Bacteria 2499
274 Ga0436365_0128814 3300039437 Bacteria 1174
275 Ga0436365_1226135 3300039437 Bacteria 85915
276 Ga0436365_1869595 3300039437 Bacteria 2505
277 Ga0436360_1239249 3300039438 Bacteria 3578
278 Ga0436363_1575233 3300039450 Bacteria 2793
279 Ga0439435_0027056 3300042436 Bacteria 1531
280 Ga0495627_000091 3300046453 Bacteria 109428
281 Ga0495590_0002320 3300046457 Bacteria 7914
282 Ga0495629_0064980 3300046459 Bacteria 2547
283 Ga0495638_0002809 3300046460 Bacteria 13940
284 Ga0495638_0090662 3300046460 Bacteria 1842
285 Ga0495650_0000024 3300046471 Bacteria 496674
286 Ga0495585_0197848 3300046492 Bacteria 1025
287 Ga0495607_0131025 3300046501 Bacteria 1305
288 Ga0495583_0000003 3300046506 Bacteria 709273
289 Ga0495583_0022243 3300046506 Bacteria 3240
290 Ga0495606_0002130 3300046507 Bacteria 23935
291 Ga0495610_0019930 3300046512 Bacteria 3738
292 Ga0495610_0115655 3300046512 Bacteria 1182
293 Ga0495616_0000467 3300046513 Bacteria 30705
294 Ga0495616_0036040 3300046513 Bacteria 2555
295 Ga0495620_0031730 3300046515 Bacteria 2417
296 Ga0495631_0018336 3300046518 Bacteria 3295
297 Ga0495632_0040849 3300046519 Bacteria 2333
298 Ga0495643_0006069 3300046522 Bacteria 8047
299 Ga0495643_0058492 3300046522 Bacteria 2051
300 Ga0495648_0000634 3300046524 Bacteria 37553
301 Ga0495642_0014356 3300046528 Bacteria 3068
302 Ga0495642_0015618 3300046528 Bacteria 2954
303 Ga0495642_0136523 3300046528 Bacteria 1057
304 Ga0495654_0000118 3300046530 Bacteria 88890
305 Ga0495654_0039670 3300046530 Bacteria 2350
306 Ga0495597_0002500 3300046542 Bacteria 11588
307 Ga0495645_0078188 3300046543 Bacteria 2378
308 Ga0495622_0002813 3300046557 Bacteria 8299
309 Ga0495633_0078934 3300046558 Bacteria 1532
310 Ga0495668_0000141 3300046616 Bacteria 108840
311 Ga0495668_0006026 3300046616 Bacteria 8041
312 Ga0495668_0021901 3300046616 Bacteria 3657
313 Ga0495668_0036976 3300046616 Bacteria 2733
314 Ga0495668_0067463 3300046616 Bacteria 1968
315 Ga0495668_0103729 3300046616 Bacteria 1556
316 Ga0495625_0000544 3300046660 Bacteria 55188
317 Ga0495625_0071798 3300046660 Bacteria 2428
318 Ga0495625_0076448 3300046660 Bacteria 2341
319 Ga0495625_0132155 3300046660 Bacteria 1690
320 Ga0495625_0167454 3300046660 Bacteria 1468
321 Ga0495669_0000012 3300046684 Bacteria 157373
322 Ga0495669_0000109 3300046684 Bacteria 53382
323 Ga0495613_0023264 3300046689 Bacteria 4616
324 Ga0495649_0000351 3300046694 Bacteria 39624
325 Ga0495636_0052790 3300047318 Bacteria 1706
326 Ga0495672_0001538 3300047320 Bacteria 22567
327 Ga0495672_0086374 3300047320 Bacteria 1735
328 Ga0495672_0201841 3300047320 Bacteria 994
329 Ga0495687_014576 3300047443 Bacteria 4039
330 Ga0495677_0021757 3300047445 Bacteria 2324
331 Ga0495679_024168 3300047446 Bacteria 2051
332 Ga0495673_0000171 3300047469 Bacteria 106647
333 Ga0495673_0003962 3300047469 Bacteria 9484
334 Ga0495681_0087099 3300047470 Bacteria 1385
335 Ga0495686_0001205 3300047472 Bacteria 29808
336 Ga0495686_0006089 3300047472 Bacteria 9342
337 Ga0495686_0006360 3300047472 Bacteria 9061
338 Ga0495686_0045175 3300047472 Bacteria 2787
339 Ga0495593_0012272 3300047673 Bacteria 4897
340 Ga0496101_0170943 3300048904 Bacteria 1671
341 Ga0496102_0313750 3300048905 Bacteria 1477
342 Ga0496107_0000092 3300048910 Bacteria 43361
343 Ga0496107_0052832 3300048910 Bacteria 2931
344 Ga0496108_0016995 3300048911 Bacteria 5947
345 Ga0496112_0026135 3300048915 Bacteria 5613
346 Ga0496112_0142258 3300048915 Bacteria 2368
347 Ga0496115_0001611 3300048918 Bacteria 16221
348 Ga0496115_0006782 3300048918 Bacteria 8400
349 Ga0496115_0114519 3300048918 Bacteria 2216
350 Ga0496116_0006942 3300048919 Bacteria 10150
351 Ga0496116_0033674 3300048919 Bacteria 3631
352 Ga0496117_0040531 3300048920 Bacteria 3423
353 Ga0496118_0022399 3300048921 Bacteria 5522
354 Ga0496121_0000467 3300048924 Bacteria 78851
355 Ga0496122_0043392 3300048925 Bacteria 3524
356 Ga0496123_0001177 3300048926 Bacteria 38557
357 Ga0496124_0028116 3300048927 Bacteria 5033
358 Ga0496125_0001209 3300048928 Bacteria 38824
359 Ga0496125_0010910 3300048928 Bacteria 9136
360 Ga0496125_0037440 3300048928 Bacteria 4218
361 Ga0496126_0004807 3300048929 Bacteria 15873
362 Ga0495678_003498 3300049459 Bacteria 9666
363 Ga0495682_0024272 3300049460 Bacteria 2261
364 Ga0501311_018598 3300049527 Bacteria 925
365 Ga0501032_0030119 3300049569 Bacteria 3723
366 Ga0501033_0015178 3300049570 Bacteria 5846
367 Ga0501033_0027548 3300049570 Bacteria 4273
368 Ga0501033_0256964 3300049570 Bacteria 1237
369 Ga0501034_0011241 3300049571 Bacteria 9293
370 Ga0501037_0011114 3300049573 Bacteria 6624
371 Ga0501043_0098855 3300049579 Bacteria 2294
372 Ga0501047_0001670 3300049581 Bacteria 21581
373 Ga0501047_0053176 3300049581 Bacteria 3915
374 Ga0501047_0075013 3300049581 Bacteria 3255
375 Ga0501238_000373 3300049671 Bacteria 5628
376 Ga0501257_009920 3300049686 Bacteria 2156
377 Ga0501257_033755 3300049686 Bacteria 1241
378 Ga0501035_0178451 3300049822 Bacteria 1831
379 Ga0501044_0014622 3300049823 Bacteria 8463
380 Ga0501044_0041956 3300049823 Bacteria 4762
381 nmdc:mga00v17_11712_c1 3300050491 Bacteria 4825
382 nmdc:mga0k408_19140_c1 3300050493 Bacteria 3824
383 nmdc:mga0k408_66837_c1 3300050493 Bacteria 2095
384 nmdc:mga06z11_2486_c1 3300050494 Bacteria 7054
385 nmdc:mga04h51_7820_c1 3300050495 Bacteria 2839
386 nmdc:mga07m45_71952_c1 3300050496 Bacteria 1968
387 nmdc:mga0sz30_1754_c1 3300050516 Bacteria 7705
388 Ga0500635_0000212 3300053080 Bacteria 28058
389 Ga0500578_0000159 3300053086 Bacteria 79246
390 Ga0500643_000222 3300053087 Bacteria 53015
391 Ga0500643_014050 3300053087 Bacteria 2799
392 Ga0500644_0001685 3300053088 Bacteria 5760
393 Ga0500651_0238358 3300053093 Bacteria 1061
394 Ga0500651_0377588 3300053093 Bacteria 800
395 Ga0500566_0022904 3300053094 Bacteria 3668
396 Ga0500641_0001616 3300053096 Bacteria 8024
397 Ga0500641_0006780 3300053096 Bacteria 4074
398 Ga0500554_027861 3300053102 Bacteria 1637
399 Ga0500555_043378 3300053103 Bacteria 1246
400 Ga0500556_0001154 3300053104 Bacteria 12786
401 Ga0500562_001061 3300053108 Bacteria 6752
402 Ga0500569_004885 3300053109 Bacteria 2849
403 Ga0500594_0000245 3300053118 Bacteria 13125
404 Ga0500595_006542 3300053119 Bacteria 4931
405 Ga0500595_038612 3300053119 Bacteria 1551
406 Ga0500608_000064 3300053122 Bacteria 46100
407 Ga0500608_004110 3300053122 Bacteria 5579
408 Ga0500614_001094 3300053123 Bacteria 6705
409 Ga0500618_000120 3300053125 Bacteria 64103
410 Ga0500642_0015570 3300053130 Bacteria 2865
411 Ga0500658_0002627 3300053134 Bacteria 6918
412 Ga0500559_0000023 3300053136 Bacteria 127993
413 Ga0500559_0000212 3300053136 Bacteria 46705
414 Ga0500559_0005922 3300053136 Bacteria 5562
415 Ga0500559_0006264 3300053136 Bacteria 5378
416 Ga0500564_000948 3300053138 Bacteria 9410
417 Ga0500573_0001166 3300053140 Bacteria 12249
418 Ga0500577_0000894 3300053142 Bacteria 7711
419 Ga0500622_0013547 3300053156 Bacteria 4400
420 Ga0500622_0023480 3300053156 Bacteria 3266
421 Ga0500622_0030395 3300053156 Bacteria 2836
422 Ga0500622_0129235 3300053156 Bacteria 1216
423 Ga0500638_011919 3300053162 Bacteria 3878
424 Ga0500639_145087 3300053163 Bacteria 1103
425 Ga0500636_0012577 3300053177 Bacteria 4961
426 Ga0500637_0247331 3300053178 Bacteria 996
427 Ga0500637_0250041 3300053178 Bacteria 989
428 Ga0500625_012115 3300053729 Bacteria 3935
429 Ga0500645_001302 3300053730 Bacteria 12960
430 Ga0500645_003499 3300053730 Bacteria 6349
431 Ga0500645_005459 3300053730 Bacteria 4675
432 Ga0500645_010765 3300053730 Bacteria 3009
433 Ga0500609_001642 3300053731 Bacteria 3260
434 Ga0587083_0043789 3300059505 Bacteria 949
435 Ga0587098_009277 3300059604 Bacteria 1065
436 Ga0587062_020085 3300059639 Bacteria 938
437 Ga0587111_0039505 3300060346 Bacteria 1000
438 2644086828 2643221614 Bacteria 4260023
439 2511122969 2510917020 Bacteria 5657507
440 2585148152 2582581279 Bacteria 4980720
441 2585153954 2582581280 Bacteria 5994497
442 2585194947 2582581293 Bacteria 5907401
443 2587919049 2585428106 Bacteria 5179711
444 2643747258 2643221545 Bacteria 5083237
445 2643779854 2643221552 Bacteria 5708754
446 2643884057 2643221574 Bacteria 2789653
447 2643924507 2643221583 Bacteria 5218014
448 2643929959 2643221584 Bacteria 5511711
449 2643998313 2643221598 Bacteria 4578346
450 2644227540 2643221640 Bacteria 5258820
451 2644236942 2643221642 Bacteria 5357871
452 2644341782 2643221661 Bacteria 4267604
453 2644353328 2643221663 Bacteria 3425771
454 2644368069 2643221666 Bacteria 4265935
455 2644507544 2643221691 Bacteria 5093099
456 2644549832 2643221699 Bacteria 5731501
457 2644551338 2643221699 Bacteria 5731501
458 2739791597 2739367756 Bacteria 4553612
459 2792461823 2791355048 Bacteria 5832535
460 2819536036 2818991435 Bacteria 5433759
461 2819644429 2818991454 Bacteria 5563326
462 2843745814 2843744320 Bacteria 5659202
463 2849562273 2849560528 Bacteria 5393480
464 2849577194 2849573788 Bacteria 5421256
465 2851156863 2851153111 Bacteria 5542585
466 2857508534 2857504554 Bacteria 5369913
467 2884961329 2884960567 Bacteria 5437054
468 2898330377 2898329390 Bacteria 5168154
469 2928531746 2928531327 Bacteria 5101314
470 2928973081 2928972540 Bacteria 3058286
471 2941489239 2941485952 Bacteria 3591484
472 2946790109 2946787523 Bacteria 4366789
473 2977242859 2977240413 Bacteria 3191065
474 JGI25153J46596_10018118
475 Ga0055526_1011275
476 Ga0055537_1001047
477 Ga0055524_1005820
478 Ga0055536_1009400
479 Ga0055528_1010924
480 Ga0055528_1012287
481 Ga0055530_10002776
482 Ga0055530_10003920
483 Ga0055531_10000450
484 Ga0055531_10001810
485 Ga0055531_10008197
486 Ga0065165_1000216
487 Ga0065165_1000909
488 Ga0065165_1044037
489 Ga0070670_100000007
490 Ga0070666_10128515
491 Ga0070660_100113405
492 Ga0070668_100000878
493 Ga0070668_100001422
494 Ga0070668_100003979
495 Ga0070668_100005495
496 Ga0070668_100006358
497 Ga0070669_100031085
498 Ga0070671_100000695
499 Ga0070671_100045470
500 Ga0070659_100002614
501 Ga0070659_100009203
502 Ga0070659_100017175
503 Ga0070667_100002972
504 Ga0070667_100013139
505 Ga0070667_100027596
506 Ga0070667_100135396
507 Ga0070663_100073505
508 Ga0070681_10006243
509 Ga0070681_10079782
510 Ga0070679_100002173
511 Ga0070679_100014918
512 Ga0070679_100302637
513 Ga0068853_100038672
514 Ga0068853_100049754
515 Ga0070665_100000517
516 Ga0070665_100000744
517 Ga0070665_100004164
518 Ga0070665_100054965
519 Ga0068855_100269320
520 Ga0070664_100328574
521 Ga0070664_100388602
522 Ga0068856_100035136
523 Ga0068852_100272295
524 Ga0068859_100001205
525 Ga0068859_100002155
526 Ga0068864_100000093
527 Ga0068864_100004767
528 Ga0068864_100010560
529 Ga0068864_100123357
530 Ga0068861_100008049
531 Ga0068863_100000045
532 Ga0068863_100015616
533 Ga0068863_100024571
534 Ga0068863_100057765
535 Ga0068858_100000144
536 Ga0068858_100024542
537 Ga0068858_100031424
538 Ga0068858_100331553
539 Ga0068858_100417297
540 Ga0068860_100000109
541 Ga0068860_100006980
542 Ga0068860_100027832
543 Ga0068860_100031729
544 Ga0068862_100007193
545 Ga0068862_100014838
546 Ga0068862_100220557
547 Ga0075368_10002103
548 Ga0075364_10010180
549 Ga0075367_10003072
550 Ga0075369_10002897
551 Ga0075366_10016467
552 Ga0075366_10065429
553 Ga0075370_10040383
554 Ga0075370_10065353
555 Ga0068871_100325436
556 Ga0068865_100001402
557 Ga0097620_100001205
558 Ga0097620_100002155
559 Ga0105250_10009814
560 Ga0105240_10000581
561 Ga0105240_10003448
562 Ga0105240_10088550
563 Ga0105240_10107839
564 Ga0105240_10377450
565 Ga0105247_10082027
566 Ga0105247_10255279
567 Ga0105241_10303141
568 Ga0105242_10646817
569 Ga0105248_10000303
570 Ga0105248_10018058
571 Ga0105248_10050697
572 Ga0105248_10052086
573 Ga0105248_10152139
574 Ga0105248_10178999
575 Ga0105238_10126187
576 Ga0105238_10290160
577 Ga0105249_10164597
578 Ga0105239_10181678
579 Ga0105239_10237189
580 Ga0157373_10001998
581 Ga0157373_10002767
582 Ga0157371_10011667
583 Ga0157370_10007136
584 Ga0157369_10021257
585 Ga0157369_10320503
586 Ga0157369_10767705
587 Ga0157372_10221572
588 Ga0163163_10033814
589 Ga0163163_10040278
590 Ga0163163_10062599
591 Ga0163163_10070721
592 Ga0163163_10177765
593 Ga0163163_10551031
594 Ga0157379_10005669
595 Ga0182007_10023975
596 Ga0163161_10156665
597 Ga0213872_10017308
598 Ga0213876_10000126
599 Ga0209026_1000529
600 Ga0209565_1000395
601 Ga0209673_1002705
602 Ga0209675_1032032
603 Ga0209676_1000038
604 Ga0209676_1000414
605 Ga0209676_1013341
606 Ga0209758_1001277
607 Ga0209758_1011458
608 Ga0209050_1000090
609 Ga0209050_1001001
610 Ga0209050_1014059
611 Ga0209051_1002440
612 Ga0209257_1000059
613 Ga0209257_1000186
614 Ga0209257_1000433
615 Ga0209257_1000616
616 Ga0209257_1004272
617 Ga0207710_10046826
618 Ga0207710_10148264
619 Ga0207705_10001192
620 Ga0207705_10082009
621 Ga0207705_10087286
622 Ga0207707_10010989
623 Ga0207707_10044456
624 Ga0207695_10001227
625 Ga0207695_10003226
626 Ga0207695_10005953
627 Ga0207695_10265562
628 Ga0207671_10413881
629 Ga0207660_10002637
630 Ga0207660_10044874
631 Ga0207657_10000435
632 Ga0207657_10052533
633 Ga0207652_10008353
634 Ga0207652_10560347
635 Ga0207681_10027943
636 Ga0207694_10008963
637 Ga0207694_10130904
638 Ga0207694_10226435
639 Ga0207650_10000030
640 Ga0207650_10205472
641 Ga0207644_10000370
642 Ga0207644_10017345
643 Ga0207690_10000092
644 Ga0207690_10010641
645 Ga0207690_10041134
646 Ga0207706_10078965
647 Ga0207704_10008604
648 Ga0207711_10004063
649 Ga0207711_10004978
650 Ga0207711_10008069
651 Ga0207711_10031364
652 Ga0207711_10052669
653 Ga0207679_10068886
654 Ga0207667_10004054
655 Ga0207667_10011017
656 Ga0207667_10013524
657 Ga0207667_10063286
658 Ga0207712_10001603
659 Ga0207712_10254472
660 Ga0207668_10000019
661 Ga0207668_10001707
662 Ga0207668_10002086
663 Ga0207668_10014218
664 Ga0207668_10019264
665 Ga0207640_10152985
666 Ga0207658_10000211
667 Ga0207658_10025500
668 Ga0207658_10033617
669 Ga0207658_10092507
670 Ga0207703_10000723
671 Ga0207703_10005864
672 Ga0207703_10022825
673 Ga0207703_10042622
674 Ga0207639_10026074
675 Ga0207639_10044521
676 Ga0207641_10000011
677 Ga0207641_10028568
678 Ga0207641_10033334
679 Ga0207641_10036274
680 Ga0207676_10000114
681 Ga0207676_10000757
682 Ga0207676_10029070
683 Ga0207676_10319597
684 Ga0207676_10472395
685 Ga0207675_100033303
686 Ga0207683_10156543
687 Ga0207683_10743746
688 Ga0209983_1004824
689 Ga0209813_10004640
690 Ga0209974_10051407
691 Ga0268266_10000005
692 Ga0268266_10000611
693 Ga0268266_10027265
694 Ga0268266_10073494
695 Ga0268265_10021303
696 Ga0268264_10000002
697 Ga0268264_10000125
698 Ga0268264_10012833
699 Ga0265319_1084147
700 Ga0265334_10010463
701 Ga0265338_10011836
702 Ga0265338_10034200
703 Ga0265338_10072428
704 Ga0307511_10133947
705 Ga0265770_1008266
706 Ga0265760_10069978
707 Ga0265327_10000794
708 Ga0265327_10002267
709 Ga0265327_10005301
710 Ga0265327_10071825
711 Ga0307513_10000045
712 Ga0307513_10001254
713 Ga0307513_10007722
714 Ga0307513_10009076
715 Ga0307513_10299395
716 Ga0307408_100360453
717 Ga0307516_10000035
718 Ga0307413_10122428
719 Ga0307413_10136725
720 Ga0307406_10004008
721 Ga0307412_10003179
722 Ga0307412_10152702
723 Ga0307414_10080466
724 Ga0307414_10162351
725 Ga0307414_10297522
726 Ga0307510_10018641
727 Ga0307510_10107613
728 Ga0307510_10160295
729 Ga0373936_0042420
730 Ga0373927_0000358
731 Ga0373925_0000160
732 Ga0395899_0000364
733 Ga0395899_0026225
734 Ga0395900_0000052
735 Ga0395900_0147088
736 Ga0395898_0062907
737 Ga0395898_0250642
738 Ga0395905_0007354
739 Ga0395905_0098394
740 Ga0395905_0175950
741 Ga0436364_0638616
742 Ga0436364_1165437
743 Ga0395901_0000001
744 Ga0395901_0364449
745 Ga0395901_0766530
746 Ga0436365_0055940
747 Ga0436365_0128814
748 Ga0436365_1226135
749 Ga0436365_1869595
750 Ga0436360_1239249
751 Ga0436363_1575233
752 Ga0439435_0027056
753 Ga0495627_000091
754 Ga0495590_0002320
755 Ga0495629_0064980
756 Ga0495638_0002809
757 Ga0495638_0090662
758 Ga0495650_0000024
759 Ga0495585_0197848
760 Ga0495607_0131025
761 Ga0495583_0000003
762 Ga0495583_0022243
763 Ga0495606_0002130
764 Ga0495610_0019930
765 Ga0495610_0115655
766 Ga0495616_0000467
767 Ga0495616_0036040
768 Ga0495620_0031730
769 Ga0495631_0018336
770 Ga0495632_0040849
771 Ga0495643_0006069
772 Ga0495643_0058492
773 Ga0495648_0000634
774 Ga0495642_0014356
775 Ga0495642_0015618
776 Ga0495642_0136523
777 Ga0495654_0000118
778 Ga0495654_0039670
779 Ga0495597_0002500
780 Ga0495645_0078188
781 Ga0495622_0002813
782 Ga0495633_0078934
783 Ga0495668_0000141
784 Ga0495668_0006026
785 Ga0495668_0021901
786 Ga0495668_0036976
787 Ga0495668_0067463
788 Ga0495668_0103729
789 Ga0495625_0000544
790 Ga0495625_0071798
791 Ga0495625_0076448
792 Ga0495625_0132155
793 Ga0495625_0167454
794 Ga0495669_0000012
795 Ga0495669_0000109
796 Ga0495613_0023264
797 Ga0495649_0000351
798 Ga0495636_0052790
799 Ga0495672_0001538
800 Ga0495672_0086374
801 Ga0495672_0201841
802 Ga0495687_014576
803 Ga0495677_0021757
804 Ga0495679_024168
805 Ga0495673_0000171
806 Ga0495673_0003962
807 Ga0495681_0087099
808 Ga0495686_0001205
809 Ga0495686_0006089
810 Ga0495686_0006360
811 Ga0495686_0045175
812 Ga0495593_0012272
813 Ga0496101_0170943
814 Ga0496102_0313750
815 Ga0496107_0000092
816 Ga0496107_0052832
817 Ga0496108_0016995
818 Ga0496112_0026135
819 Ga0496112_0142258
820 Ga0496115_0001611
821 Ga0496115_0006782
822 Ga0496115_0114519
823 Ga0496116_0006942
824 Ga0496116_0033674
825 Ga0496117_0040531
826 Ga0496118_0022399
827 Ga0496121_0000467
828 Ga0496122_0043392
829 Ga0496123_0001177
830 Ga0496124_0028116
831 Ga0496125_0001209
832 Ga0496125_0010910
833 Ga0496125_0037440
834 Ga0496126_0004807
835 Ga0495678_003498
836 Ga0495682_0024272
837 Ga0501311_018598
838 Ga0501032_0030119
839 Ga0501033_0015178
840 Ga0501033_0027548
841 Ga0501033_0256964
842 Ga0501034_0011241
843 Ga0501037_0011114
844 Ga0501043_0098855
845 Ga0501047_0001670
846 Ga0501047_0053176
847 Ga0501047_0075013
848 Ga0501238_000373
849 Ga0501257_009920
850 Ga0501257_033755
851 Ga0501035_0178451
852 Ga0501044_0014622
853 Ga0501044_0041956
854 nmdc:mga00v17_11712_c1
855 nmdc:mga0k408_19140_c1
856 nmdc:mga0k408_66837_c1
857 nmdc:mga06z11_2486_c1
858 nmdc:mga04h51_7820_c1
859 nmdc:mga07m45_71952_c1
860 nmdc:mga0sz30_1754_c1
861 Ga0500635_0000212
862 Ga0500578_0000159
863 Ga0500643_000222
864 Ga0500643_014050
865 Ga0500644_0001685
866 Ga0500651_0238358
867 Ga0500651_0377588
868 Ga0500566_0022904
869 Ga0500641_0001616
870 Ga0500641_0006780
871 Ga0500554_027861
872 Ga0500555_043378
873 Ga0500556_0001154
874 Ga0500562_001061
875 Ga0500569_004885
876 Ga0500594_0000245
877 Ga0500595_006542
878 Ga0500595_038612
879 Ga0500608_000064
880 Ga0500608_004110
881 Ga0500614_001094
882 Ga0500618_000120
883 Ga0500642_0015570
884 Ga0500658_0002627
885 Ga0500559_0000023
886 Ga0500559_0000212
887 Ga0500559_0005922
888 Ga0500559_0006264
889 Ga0500564_000948
890 Ga0500573_0001166
891 Ga0500577_0000894
892 Ga0500622_0013547
893 Ga0500622_0023480
894 Ga0500622_0030395
895 Ga0500622_0129235
896 Ga0500638_011919
897 Ga0500639_145087
898 Ga0500636_0012577
899 Ga0500637_0247331
900 Ga0500637_0250041
901 Ga0500625_012115
902 Ga0500645_001302
903 Ga0500645_003499
904 Ga0500645_005459
905 Ga0500645_010765
906 Ga0500609_001642
907 Ga0587083_0043789
908 Ga0587098_009277
909 Ga0587062_020085
910 Ga0587111_0039505
911 2644086828
912 2511122969
913 2585148152
914 2585153954
915 2585194947
916 2587919049
917 2643747258
918 2643779854
919 2643884057
920 2643924507
921 2643929959
922 2643998313
923 2644227540
924 2644236942
925 2644341782
926 2644353328
927 2644368069
928 2644507544
929 2644549832
930 2644551338
931 2739791597
932 2792461823
933 2819536036
934 2819644429
935 2843745814
936 2849562273
937 2849577194
938 2851156863
939 2857508534
940 2884961329
941 2898330377
942 2928531746
943 2928973081
944 2941489239
945 2946790109
946 2977242859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

4

283

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fbn-assembly1.cif.gz_A improving the secretion of designed protein assemblies through negative design of cryptic transmembrane domains 0.7783 151 252
5etw-assembly1.cif.gz_B crystal structure of the indoleamine 2,3-dioxygenagse 1 (ido1) complexed with nlg919 analogue 0.7194 147 213
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.7034 88 265
6hwh-assembly1.cif.gz_X structure of a functional obligate respiratory supercomplex from mycobacterium smegmatis 0.6943 1 65
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.6893 87 267
ID Description Score Start End Superfamily
af_Q6Z3H7_30_255_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.8546 147 215 1.20.1410.10
af_Q96S38_234_311_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8546 151 256 1.20.58.80
af_Q96S38_234_311_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8238 151 256 1.20.58.80
af_P28776_134_405_1.20.58.480 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8161 147 194 1.20.58.480
af_E9PT90_129_223_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.7602 141 254 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A813Y7T5-F1-model_v4 Cytochrome c oxidase subunit 3 0.8782 134 252 GO:0004129
GO:0005739
GO:0005975
GO:0016020
GO:0016853
GO:0022904
GO:0097367
GO:1901135
AF-A0A534Q201-F1-model_v4 Cytochrome c oxidase subunit 3 family protein 0.8729 147 265 GO:0004129
GO:0005886
GO:0019646
AF-A0A4Q3T5T5-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) 0.8674 161 268 GO:0004129
GO:0005886
GO:0019646
AF-A0A2N3MXE8-F1-model_v4 Cytochrome c oxidase subunit 3 0.8659 139 251 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A6B9N342-F1-model_v4 Cytochrome c oxidase subunit 3 0.8612 135 249 GO:0004129
GO:0005739
GO:0006123
GO:0016020

Map