F451205

General Info

Members Datasets Scaffolds Average Seq Length
474 403 949 226

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10467798|Ga0307411_104677981
Length 271
Sequence MPENSDFVTSSPVTCHLCHIVTLLMSLLSPFTIRSPKGATQLMYTLYIANKNYSSWSLRPWVLMRELGIAFEEAMRPFAAGSNWQSFRSFSPSGKVPCLVDGDLAVWDSLAITEYLAERHSTVWPADPSIRAWARSAAAEMHSGFGALRDRCSMSCGTRVRLHEISPALQRDVARIDELWNEGLNRFGGPFLAGKSFCAVDAFFAPVAFRVQTYALALSPPASDYCARLLNLPSMRSWYQDALAETWRELDHEEEVKRTGVVEDDLRAKAD

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
102 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
126 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
129 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
130 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
134 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
182 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
183 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
184 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
185 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
186 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
187 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
188 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
189 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
190 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
191 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
192 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
193 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
194 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
195 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
196 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
197 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
198 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
199 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
200 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
201 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
202 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
203 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
204 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
205 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
206 2643221582 Rhizobium sp. Root651 Isolate Unclassified
207 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
208 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
209 2643221693 Rhizobium sp. Root491 Isolate Unclassified
210 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
211 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
212 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
213 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
214 2738543024 Aminobacter sp. AP02 Isolate Unclassified
215 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
216 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
217 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
218 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
219 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
220 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
221 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
222 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
223 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
224 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
225 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
226 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
227 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
228 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
229 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
230 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
231 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
232 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
233 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
234 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
235 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
236 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
237 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
238 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
239 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
240 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
241 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
242 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
243 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
244 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
245 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
246 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
247 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
248 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
249 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
250 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
251 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
252 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
253 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
254 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
255 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
256 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
257 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
258 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
259 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
260 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
261 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
262 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
263 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
264 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
265 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
266 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
267 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
268 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
269 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
270 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
271 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
272 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
273 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
274 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
275 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
276 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
277 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
278 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
279 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
280 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
281 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
282 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
283 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
284 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
285 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
286 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
287 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
288 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
289 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
290 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
291 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
292 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
293 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
294 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
295 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
296 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
297 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
298 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
299 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
300 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
301 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
302 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
303 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
304 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
305 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
306 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
307 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
308 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
309 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
310 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
311 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
312 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
313 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
314 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
315 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
316 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
317 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
318 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
319 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
320 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
321 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
322 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
323 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
324 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
325 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
326 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
327 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
328 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
329 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
330 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
331 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
332 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
333 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
334 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
335 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
336 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
337 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
338 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
339 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
340 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
341 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
342 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
343 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
344 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
345 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
346 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
347 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
348 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
349 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
350 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
351 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
352 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
353 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
354 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
355 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
356 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
357 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
358 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
359 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
360 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
361 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
362 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
363 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
364 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
365 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
366 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
367 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
368 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
369 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
370 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
371 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
372 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
373 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
374 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
375 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
376 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
377 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
378 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
379 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
380 3004167301 Mesorhizobium loti 582 Isolate Unclassified
381 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
382 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
383 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
384 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
385 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
386 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
387 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
388 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
389 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
390 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
391 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
392 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
393 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
394 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
395 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
396 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
397 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
398 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
399 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
400 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
401 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
402 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
403 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.06
Metatranscriptomes 0
Isolates 44.94

Biome Distribution

Category Percentage (%)
Aerial Root 1.05
Bulb 0
Endosphere 13.5
Nodule 35.44
Rhizoplane 4.22
Rhizosphere 33.12
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10467798 3300032005 Bacteria 1059
2 JGI24737J22298_10041378 3300001990 Bacteria 1413
3 JGI24735J21928_10083841 3300002067 Bacteria 913
4 JGI24735J21928_10083904 3300002067 Bacteria 913
5 JGI25156J39149_1003605 3300002705 Bacteria 4997
6 JGI25157J39369_1001043 3300002741 Bacteria 12662
7 JGI25152J39213_1003323 3300002773 Bacteria 5543
8 JGI25153J46596_10002193 3300003215 Bacteria 11399
9 JGI25153J46596_10002942 3300003215 Bacteria 9639
10 rootH2_10022097 3300003320 Bacteria 12793
11 rootH1_10014040 3300003323 Bacteria 37606
12 rootH1_10038740 3300003316 Bacteria 12495
13 rootH1_10038740 3300003323 Bacteria 4304
14 Ga0055533_1005568 3300003756 Bacteria 2002
15 Ga0055526_1009965 3300003771 Bacteria 4490
16 Ga0055531_10014712 3300003794 Bacteria 3505
17 Ga0058692_1000967 3300003856 Bacteria 11297
18 Ga0070682_100201500 3300005337 Bacteria 1404
19 Ga0070691_10118940 3300005341 Bacteria 1328
20 Ga0070661_100165762 3300005344 Bacteria 1676
21 Ga0070675_100064888 3300005354 Bacteria 3018
22 Ga0070673_100264313 3300005364 Bacteria 1504
23 Ga0070709_10213729 3300005434 Bacteria 1372
24 Ga0070713_100023874 3300005436 Bacteria 4753
25 Ga0070713_100577680 3300005436 Bacteria 1066
26 Ga0070700_100013807 3300005441 Bacteria 4544
27 Ga0070700_100306388 3300005441 Bacteria 1161
28 Ga0070678_100088669 3300005456 Bacteria 2366
29 Ga0070662_100197090 3300005457 Bacteria 1596
30 Ga0068867_100040308 3300005459 Bacteria 3407
31 Ga0070706_100545237 3300005467 Bacteria 1079
32 Ga0070679_100341776 3300005530 Bacteria 1445
33 Ga0070665_100015667 3300005548 Bacteria 7614
34 Ga0070665_100141128 3300005548 Bacteria 2412
35 Ga0068855_100255525 3300005563 Bacteria 1953
36 Ga0070664_100192353 3300005564 Bacteria 1818
37 Ga0068854_100599391 3300005578 Bacteria 940
38 Ga0068861_100002737 3300005719 Bacteria 11545
39 Ga0068861_100148396 3300005719 Bacteria 1921
40 Ga0068870_10218094 3300005840 Bacteria 1166
41 Ga0068862_100100799 3300005844 Bacteria 2525
42 Ga0075368_10160238 3300006042 Bacteria 942
43 Ga0075363_100054454 3300006048 Bacteria 2140
44 Ga0075363_100128481 3300006048 Bacteria 1420
45 Ga0075363_100140625 3300006048 Bacteria 1359
46 Ga0075364_10405933 3300006051 Bacteria 930
47 Ga0075362_10011666 3300006177 Bacteria 3467
48 Ga0075362_10038582 3300006177 Bacteria 2098
49 Ga0075362_10061231 3300006177 Bacteria 1703
50 Ga0075367_10209818 3300006178 Bacteria 1218
51 Ga0075367_10249871 3300006178 Bacteria 1112
52 Ga0075369_10127834 3300006186 Bacteria 1153
53 Ga0075366_10030675 3300006195 Bacteria 3162
54 Ga0075366_10074878 3300006195 Bacteria 2019
55 Ga0075370_10011841 3300006353 Bacteria 4593
56 Ga0075370_10401684 3300006353 Bacteria 822
57 Ga0075430_100234845 3300006846 Bacteria 1520
58 Ga0075434_100049078 3300006871 Bacteria 4190
59 Ga0075436_100009482 3300006914 Bacteria 6655
60 Ga0099826_10000079 3300006948 Bacteria 50419
61 Ga0099794_10002520 3300007265 Bacteria 6768
62 Ga0111539_10317068 3300009094 Bacteria 1814
63 Ga0111539_10373501 3300009094 Bacteria 1660
64 Ga0105243_10120269 3300009148 Bacteria 2213
65 Ga0105237_10117765 3300009545 Bacteria 2650
66 Ga0105238_10535923 3300009551 Bacteria 1174
67 Ga0105249_10892188 3300009553 Bacteria 956
68 Ga0105239_10048188 3300010375 Bacteria 4672
69 Ga0157373_10111269 3300013100 Bacteria 1925
70 Ga0157371_10000425 3300013102 Bacteria 51804
71 Ga0157371_10041522 3300013102 Bacteria 3281
72 Ga0157371_10300678 3300013102 Bacteria 1162
73 Ga0157370_10003706 3300013104 Bacteria 17854
74 Ga0157369_10242457 3300013105 Bacteria 1882
75 Ga0163162_11394140 3300013306 Bacteria 797
76 Ga0157375_10022141 3300013308 Bacteria 5846
77 Ga0157380_10054428 3300014326 Bacteria 3175
78 Ga0157376_10159062 3300014969 Bacteria 2046
79 Ga0183368_1002 3300015687 Bacteria 1865598
80 Ga0209674_100014 3300025226 Bacteria 704989
81 Ga0209258_101071 3300025242 Bacteria 11874
82 Ga0207425_1000200 3300025245 Bacteria 47894
83 Ga0209646_1004887 3300025246 Bacteria 2399
84 Ga0209026_1000215 3300025250 Bacteria 80382
85 Ga0209759_1000591 3300025256 Bacteria 35218
86 Ga0209129_1000113 3300025258 Bacteria 145178
87 Ga0209233_1000087 3300025261 Bacteria 325225
88 Ga0209233_1033049 3300025261 Bacteria 1190
89 Ga0209673_1015329 3300025273 Bacteria 2919
90 Ga0209025_1000744 3300025294 Bacteria 54885
91 Ga0209564_1000186 3300025295 Bacteria 147120
92 Ga0209758_1000172 3300025297 Bacteria 147763
93 Ga0209758_1001115 3300025297 Bacteria 34570
94 Ga0209256_1032846 3300025299 Bacteria 1404
95 Ga0209257_1000476 3300025304 Bacteria 72955
96 Ga0209257_1017764 3300025304 Bacteria 2782
97 Ga0207647_10008076 3300025904 Bacteria 7564
98 Ga0207647_10018007 3300025904 Bacteria 4789
99 Ga0207699_10193716 3300025906 Bacteria 1373
100 Ga0207643_10286230 3300025908 Bacteria 1023
101 Ga0207684_10072690 3300025910 Bacteria 2921
102 Ga0207671_10136399 3300025914 Bacteria 1887
103 Ga0207649_10130515 3300025920 Bacteria 1706
104 Ga0207700_10120503 3300025928 Bacteria 2126
105 Ga0207700_10533327 3300025928 Bacteria 1041
106 Ga0207669_10399185 3300025937 Bacteria 1077
107 Ga0207704_10807252 3300025938 Bacteria 784
108 Ga0207665_10062386 3300025939 Bacteria 2529
109 Ga0207691_10051831 3300025940 Bacteria 3750
110 Ga0207691_10052474 3300025940 Bacteria 3724
111 Ga0207679_10211267 3300025945 Bacteria 1627
112 Ga0207667_10081887 3300025949 Bacteria 3344
113 Ga0207651_10455471 3300025960 Bacteria 1098
114 Ga0207640_10736186 3300025981 Bacteria 849
115 Ga0207708_10053472 3300026075 Bacteria 3077
116 Ga0207708_10064030 3300026075 Bacteria 2809
117 Ga0207648_10055316 3300026089 Bacteria 3464
118 Ga0207675_100004190 3300026118 Bacteria 13955
119 Ga0207675_100015541 3300026118 Bacteria 7100
120 Ga0209371_1000021 3300027312 Bacteria 555864
121 Ga0209371_1001149 3300027312 Bacteria 19392
122 Ga0209588_1045097 3300027671 Bacteria 1426
123 Ga0209974_10064860 3300027876 Bacteria 1240
124 Ga0268266_10009153 3300028379 Bacteria 8739
125 Ga0268266_10064382 3300028379 Bacteria 3167
126 Ga0268265_10368590 3300028380 Bacteria 1317
127 Ga0265334_10000986 3300028573 Bacteria 14104
128 Ga0265338_10007685 3300028800 Bacteria 13285
129 Ga0265338_10070411 3300028800 Bacteria 2999
130 Ga0265338_10083305 3300028800 Bacteria 2675
131 Ga0268256_1000020 3300030500 Bacteria 557873
132 Ga0268256_1000786 3300030500 Bacteria 22885
133 Ga0316182_1067084 3300030745 Bacteria 1385
134 Ga0265330_10004360 3300031235 Bacteria 7193
135 Ga0265332_10003174 3300031238 Bacteria 8001
136 Ga0265320_10010245 3300031240 Bacteria 5593
137 Ga0265329_10017406 3300031242 Bacteria 2473
138 Ga0265340_10008934 3300031247 Bacteria 5399
139 Ga0265340_10010348 3300031247 Bacteria 4990
140 Ga0265340_10029521 3300031247 Bacteria 2753
141 Ga0265340_10044871 3300031247 Bacteria 2162
142 Ga0265340_10082769 3300031247 Bacteria 1509
143 Ga0265339_10118309 3300031249 Bacteria 1364
144 Ga0265331_10009724 3300031250 Bacteria 5373
145 Ga0307513_10058538 3300031456 Bacteria 4094
146 Ga0265313_10008940 3300031595 Bacteria 6576
147 Ga0265313_10059805 3300031595 Bacteria 1790
148 Ga0265314_10022086 3300031711 Bacteria 4878
149 Ga0265342_10012843 3300031712 Bacteria 5652
150 Ga0307409_100001814 3300031995 Bacteria 10830
151 Ga0307416_100558700 3300032002 Bacteria 1219
152 Ga0307411_10134164 3300032005 Bacteria 1814
153 Ga0307415_100820055 3300032126 Bacteria 851
154 Ga0373936_0000008 3300035113 Bacteria 268505
155 Ga0373936_0062396 3300035113 Bacteria 1524
156 Ga0373936_0087789 3300035113 Bacteria 1301
157 Ga0373955_0027651 3300035172 Bacteria 2935
158 Ga0373933_0244367 3300035724 Bacteria 1155
159 Ga0373925_0894904 3300037068 Bacteria 732
160 Ga0395900_0000078 3300037418 Bacteria 179292
161 Ga0395900_0015478 3300037418 Bacteria 7776
162 Ga0395900_0276669 3300037418 Bacteria 1672
163 Ga0395898_0084624 3300037466 Bacteria 3057
164 Ga0395905_0277023 3300037471 Bacteria 1563
165 Ga0395901_0341499 3300038443 Bacteria 1547
166 Ga0439438_024622 3300041405 Bacteria 1647
167 Ga0451789_0190427 3300041443 Bacteria 1058
168 Ga0451791_0544016 3300041451 Bacteria 3321
169 Ga0451797_0561412 3300041453 Bacteria 1366
170 Ga0451798_0422633 3300041458 Bacteria 3067
171 Ga0451798_1136882 3300041458 Bacteria 1587
172 Ga0451802_0896255 3300041460 Bacteria 3621
173 Ga0451807_1071693 3300041486 Bacteria 2029
174 Ga0451853_1720672 3300041512 Bacteria 1318
175 Ga0450900_020546 3300042136 Bacteria 918
176 Ga0439458_0047561 3300042157 Bacteria 1053
177 Ga0451577_0000133 3300042876 Bacteria 166977
178 Ga0466972_0000191 3300044658 Bacteria 47087
179 Ga0466972_0160984 3300044658 Bacteria 1054
180 Ga0453684_0000180 3300044712 Bacteria 279345
181 Ga0453684_0000384 3300044712 Bacteria 181189
182 Ga0451576_0140572 3300045051 Bacteria 2518
183 Ga0451576_0141953 3300045051 Bacteria 2504
184 Ga0495638_0013373 3300046460 Bacteria 5590
185 Ga0495598_0142421 3300046537 Bacteria 830
186 Ga0495656_0000001 3300046615 Bacteria 410042
187 Ga0495668_0358113 3300046616 Bacteria 801
188 Ga0495625_0041138 3300046660 Bacteria 3365
189 Ga0495659_0001615 3300046664 Bacteria 7575
190 Ga0495661_0090402 3300046665 Bacteria 1743
191 Ga0495658_0269186 3300046683 Bacteria 1074
192 Ga0496100_0336119 3300048903 Bacteria 1138
193 Ga0496104_0049982 3300048907 Bacteria 3944
194 Ga0496104_0155146 3300048907 Bacteria 2197
195 Ga0496105_0006306 3300048908 Bacteria 9112
196 Ga0496105_0619203 3300048908 Bacteria 838
197 Ga0496113_0072398 3300048916 Bacteria 2623
198 Ga0496114_0019737 3300048917 Bacteria 5463
199 Ga0496115_0000124 3300048918 Bacteria 70162
200 Ga0496115_0044434 3300048918 Bacteria 3543
201 Ga0496116_0000275 3300048919 Bacteria 89714
202 Ga0496116_0143604 3300048919 Bacteria 1338
203 Ga0496117_0000002 3300048920 Bacteria 2483758
204 Ga0496117_0255797 3300048920 Bacteria 952
205 Ga0496118_0001483 3300048921 Bacteria 35130
206 Ga0496118_0024089 3300048921 Bacteria 5265
207 Ga0496118_0077412 3300048921 Bacteria 2359
208 Ga0496119_0029333 3300048922 Bacteria 3733
209 Ga0496119_0117241 3300048922 Bacteria 1468
210 Ga0496120_0001101 3300048923 Bacteria 35265
211 Ga0496120_0020728 3300048923 Bacteria 4170
212 Ga0496122_0000001 3300048925 Bacteria 1827766
213 Ga0496122_0061560 3300048925 Bacteria 2754
214 Ga0496122_0179039 3300048925 Bacteria 1267
215 Ga0496123_0000001 3300048926 Bacteria 1831497
216 Ga0496124_0001394 3300048927 Bacteria 36257
217 Ga0496124_0024502 3300048927 Bacteria 5483
218 Ga0496124_0272058 3300048927 Bacteria 1240
219 Ga0496125_0046191 3300048928 Bacteria 3656
220 Ga0496125_0064877 3300048928 Bacteria 2898
221 Ga0496126_0005863 3300048929 Bacteria 13857
222 Ga0501042_0178493 3300049578 Bacteria 1532
223 Ga0501047_0444370 3300049581 Bacteria 1126
224 Ga0501069_0041761 3300049585 Bacteria 2536
225 Ga0501070_0015443 3300049586 Bacteria 6424
226 Ga0501070_0288951 3300049586 Bacteria 1336
227 Ga0501080_0073151 3300049742 Bacteria 3189
228 Ga0501083_0356748 3300049744 Bacteria 951
229 Ga0501044_0168338 3300049823 Bacteria 2164
230 nmdc:mga03683_11462_c1 3300050489 Bacteria 3211
231 nmdc:mga03683_130735_c1 3300050489 Unclassified 1123
232 nmdc:mga03683_44546_c1 3300050489 Bacteria 1834
233 nmdc:mga03n38_66043_c1 3300050490 Bacteria 1661
234 nmdc:mga00v17_139624_c1 3300050491 Bacteria 1553
235 nmdc:mga00v17_78727_c1 3300050491 Bacteria 2054
236 nmdc:mga0yw44_1802_c1 3300050492 Bacteria 8754
237 nmdc:mga0yw44_377059_c1 3300050492 Bacteria 957
238 nmdc:mga0yw44_78179_c1 3300050492 Bacteria 2069
239 nmdc:mga0k408_117985_c1 3300050493 Bacteria 1571
240 nmdc:mga0k408_25014_c1 3300050493 Bacteria 2879
241 nmdc:mga0k408_41367_c2 3300050493 Bacteria 1879
242 nmdc:mga06z11_121856_c1 3300050494 Bacteria 1456
243 nmdc:mga06z11_473720_c1 3300050494 Bacteria 758
244 nmdc:mga07m45_12301_c1 3300050496 Bacteria 4520
245 nmdc:mga0qj67_259088_c1 3300050509 Bacteria 1411
246 nmdc:mga0n895_104402_c1 3300050512 Bacteria 2846
247 nmdc:mga0rr50_194903_c1 3300050513 Bacteria 1662
248 nmdc:mga08x19_243323_c1 3300050514 Bacteria 1241
249 nmdc:mga0sz30_101178_c1 3300050516 Bacteria 1259
250 nmdc:mga0sz30_1891_c1 3300050516 Bacteria 7467
251 nmdc:mga0sz30_96407_c1 3300050516 Bacteria 1290
252 Ga0500610_0200195 3300053079 Bacteria 963
253 Ga0500635_0092595 3300053080 Bacteria 1102
254 Ga0500572_043006 3300053111 Bacteria 1319
255 Ga0500561_0000101 3300053137 Bacteria 16492
256 Ga0500604_0026534 3300053151 Bacteria 1671
257 Ga0500620_003526 3300053155 Bacteria 3356
258 Ga0500620_008151 3300053155 Bacteria 2629
259 Ga0500636_0001546 3300053177 Bacteria 12543
260 Ga0500637_0074230 3300053178 Bacteria 1959
261 Ga0500584_053926 3300053726 Bacteria 1809
262 Ga0500611_011349 3300053727 Bacteria 1471
263 2503203342 2503198000 Bacteria 6884444
264 2509141508 2508501127 Bacteria 7037543
265 2509370073 2509276018 Bacteria 6910194
266 2510319028 2510065059 Bacteria 6847884
267 2513608421 2513237090 Bacteria 7096802
268 2514419158 2513237305 Bacteria 7293571
269 2537874675 2537561587 Bacteria 5425293
270 2554247490 2554235003 Bacteria 5877155
271 2559294621 2558860242 Bacteria 5568029
272 2587732764 2585428058 Bacteria 6853932
273 2599602246 2599185210 Bacteria 5624189
274 2599940372 2599185301 Bacteria 6161860
275 2601608388 2600255279 Bacteria 5605316
276 2601745162 2600255308 Bacteria 5611129
277 2643919124 2643221582 Bacteria 5804683
278 2643985381 2643221595 Bacteria 6565519
279 2644152077 2643221627 Bacteria 6761570
280 2644518394 2643221693 Bacteria 5513853
281 2687577322 2687453129 Bacteria 4387428
282 2688600178 2687453392 Bacteria 6880454
283 2707100565 2706794495 Bacteria 4536932
284 2723577454 2721755686 Bacteria 7343952
285 2739306481 2738543024 Bacteria 5603683
286 2792749161 2791355123 Bacteria 8049106
287 2808985603 2808606387 Bacteria 5697198
288 2819555725 2818991439 Bacteria 6907412
289 2841741164 2841734538 Bacteria 6784580
290 2841859646 2841859092 Bacteria 5436171
291 2842516431 2842515876 Bacteria 5436280
292 2844015494 2844009547 Bacteria 6728125
293 2847671863 2847670302 Bacteria 6165597
294 2847688090 2847686936 Bacteria 6278406
295 2856318407 2856314179 Bacteria 6477897
296 2856330894 2856328259 Bacteria 6528202
297 2856339167 2856334872 Bacteria 7037011
298 2856360653 2856356410 Bacteria 6297484
299 2856364680 2856364286 Bacteria 6939991
300 2857355038 2857349434 Bacteria 7926032
301 2857370811 2857367948 Bacteria 6965560
302 2857577111 2857576091 Bacteria 5465855
303 2869174433 2869169390 Bacteria 6659796
304 2869235769 2869234852 Bacteria 6654993
305 2869245382 2869242130 Bacteria 6609239
306 2869252908 2869249662 Bacteria 6868783
307 2869257643 2869256925 Bacteria 6981691
308 2869270075 2869264136 Bacteria 6880765
309 2869274369 2869271264 Bacteria 6908218
310 2869289872 2869285874 Bacteria 6901219
311 2871431993 2871429161 Bacteria 6547891
312 2871436570 2871435913 Bacteria 6880295
313 2871447194 2871444079 Bacteria 6423508
314 2871457171 2871451962 Bacteria 7336357
315 2871462418 2871459585 Bacteria 6866887
316 2871478759 2871474448 Bacteria 6806570
317 2871485404 2871481445 Bacteria 6700002
318 2871493980 2871488783 Bacteria 6929816
319 2874102147 2874102143 Bacteria 6342645
320 2874110902 2874109183 Bacteria 6517025
321 2874117487 2874116593 Bacteria 6674494
322 2874127613 2874123672 Bacteria 7238285
323 2874138218 2874131515 Bacteria 6820270
324 2874155615 2874146452 Bacteria 7533118
325 2874162472 2874155637 Bacteria 6724144
326 2874165772 2874162495 Bacteria 6174670
327 2874175402 2874168670 Bacteria 8062617
328 2876370178 2876369609 Bacteria 6807521
329 2876387370 2876386047 Bacteria 6698674
330 2876399429 2876392853 Bacteria 6660880
331 2876399915 2876399893 Bacteria 6927900
332 2876408847 2876406927 Bacteria 6191900
333 2876420959 2876413966 Bacteria 6831344
334 2876427381 2876420981 Bacteria 6687741
335 2878037743 2878035449 Bacteria 6555736
336 2878732237 2878730984 Bacteria 6380721
337 2878748599 2878745973 Bacteria 6867388
338 2878756556 2878753008 Bacteria 6922523
339 2878774990 2878774303 Bacteria 6108671
340 2881153704 2881147464 Bacteria 7779814
341 2881848257 2881845957 Bacteria 6611900
342 2881862424 2881861095 Bacteria 7128710
343 2882916082 2882912400 Bacteria 6801539
344 2885326026 2885318864 Bacteria 6729568
345 2888341357 2888337043 Bacteria 6629336
346 2894511033 2894510363 Bacteria 5121143
347 2899795437 2899792073 Bacteria 4926588
348 2899850228 2899845264 Bacteria 5672268
349 2903502516 2903492973 Bacteria 13473544
350 2903505810 2903492973 Bacteria 13473544
351 2903518163 2903513507 Bacteria 6344008
352 2904665956 2904659560 Bacteria 6685615
353 2906312161 2906308376 Bacteria 6841989
354 2906323899 2906321335 Bacteria 6579571
355 2906331257 2906328253 Bacteria 6585166
356 2906364545 2906363423 Bacteria 6856682
357 2906375612 2906370794 Bacteria 6881062
358 2906394223 2906393657 Bacteria 6790866
359 2906401401 2906401398 Bacteria 6693206
360 2906413000 2906408224 Bacteria 6162342
361 2906418444 2906414383 Bacteria 6580790
362 2906432845 2906427513 Bacteria 6375796
363 2919167921 2919166419 Bacteria 4952238
364 2922156834 2922151315 Bacteria 6902399
365 2922164358 2922158528 Bacteria 6573167
366 2922176920 2922172374 Bacteria 6167644
367 2922182910 2922178524 Bacteria 6025201
368 2924712908 2924710171 Bacteria 6752351
369 2924729208 2924726620 Bacteria 6271473
370 2924735436 2924733363 Bacteria 7574837
371 2924747499 2924741084 Bacteria 6661321
372 2924751357 2924748358 Bacteria 6154725
373 2924764587 2924762789 Bacteria 6561353
374 2924788143 2924784321 Bacteria 7416538
375 2926760701 2926760298 Bacteria 5505990
376 2933012929 2933011516 Bacteria 5439334
377 2933595420 2933594066 Bacteria 5594265
378 2937818015 2937813078 Bacteria 7783518
379 2937829235 2937822353 Bacteria 7290551
380 2937840786 2937836603 Bacteria 6811263
381 2937868545 2937861824 Bacteria 6660327
382 2937875580 2937868953 Bacteria 6639878
383 2937894215 2937891427 Bacteria 6357007
384 2937988026 2937980651 Bacteria 6517427
385 2958071335 2958071322 Bacteria 6815895
386 2958109616 2958108152 Bacteria 6681128
387 2958116945 2958115193 Bacteria 6923548
388 2958127108 2958122699 Bacteria 7280457
389 2958134244 2958130278 Bacteria 6897202
390 2958141405 2958137437 Bacteria 6050276
391 2958158602 2958158011 Bacteria 6058449
392 2958183890 2958179912 Bacteria 6874908
393 2961081856 2961077736 Bacteria 7079850
394 2961121300 2961114664 Bacteria 6680456
395 2961140555 2961136820 Bacteria 6775228
396 2961172846 2961170736 Bacteria 7072258
397 2961188962 2961183825 Bacteria 6688536
398 2965026103 2965025482 Bacteria 6532201
399 2965038587 2965032056 Bacteria 6887443
400 2965047463 2965040258 Bacteria 6855979
401 2965050215 2965047637 Bacteria 6623551
402 2965066430 2965062239 Bacteria 7412989
403 2965091824 2965089291 Bacteria 6866420
404 2965105407 2965102966 Bacteria 6800987
405 2965117031 2965110997 Bacteria 6693150
406 2967998056 2967996073 Bacteria 6787468
407 2968008708 2968003550 Bacteria 6929263
408 2968092371 2968091066 Bacteria 6052692
409 2968097581 2968097103 Bacteria 6107094
410 2968117452 2968110612 Bacteria 6814636
411 2968131710 2968128360 Bacteria 6270294
412 2968145803 2968138860 Bacteria 6605449
413 2970493500 2970489779 Bacteria 6517260
414 2970505440 2970503327 Bacteria 7099517
415 2970517774 2970510686 Bacteria 7006402
416 2970532544 2970532167 Bacteria 6553173
417 2970554114 2970547951 Bacteria 6931819
418 2970625276 2970619444 Bacteria 6986144
419 2970632357 2970627176 Bacteria 6680862
420 2977825736 2977821940 Bacteria 6906439
421 2977851114 2977843712 Bacteria 6753583
422 2977852935 2977851361 Bacteria 6694324
423 2977859925 2977858184 Bacteria 6215359
424 2977875294 2977872689 Bacteria 7270173
425 2977901242 2977898635 Bacteria 6675551
426 2977912133 2977907340 Bacteria 6577984
427 2977917130 2977915119 Bacteria 6829656
428 2977940788 2977935797 Bacteria 6252826
429 2977955063 2977950692 Bacteria 6893264
430 2977959108 2977957713 Bacteria 6877875
431 2978974372 2978969890 Bacteria 5400756
432 2979094022 2979089926 Bacteria 5670289
433 2979098596 2979095461 Bacteria 5669583
434 2979106049 2979100975 Bacteria 5423623
435 2979766912 2979764755 Bacteria 6610066
436 2979774976 2979772303 Bacteria 6618277
437 2979782272 2979779861 Bacteria 6219781
438 2979796139 2979793036 Bacteria 6808957
439 2979810161 2979808191 Bacteria 7179355
440 2984512164 2984509177 Bacteria 5274802
441 2984521474 2984518228 Bacteria 5277463
442 2984540769 2984537506 Bacteria 5277481
443 2984589712 2984587000 Bacteria 5263363
444 2984603034 2984601300 Bacteria 5455244
445 2987643639 2987636660 Bacteria 8088555
446 2987651832 2987645492 Bacteria 6117018
447 2987667391 2987666974 Bacteria 6509233
448 2987677860 2987673487 Bacteria 6884027
449 2996343192 2996341866 Bacteria 6643098
450 2996392118 2996386984 Bacteria 6978667
451 3000141898 3000135777 Bacteria 6891109
452 3004170953 3004167301 Bacteria 8330599
453 3004198341 3004195979 Bacteria 6776956
454 3004207184 3004203850 Bacteria 7307914
455 3004237740 3004232784 Bacteria 6662140
456 3004241101 3004239961 Bacteria 6892290
457 3004254219 3004248173 Bacteria 6563236
458 3004273514 3004268573 Bacteria 7043476
459 649874654 649633066 Bacteria 6690028
460 650739823 650716007 Bacteria 5573770
461 8002392372 8002392321 Bacteria 4159911
462 8003570876 8003570095 Bacteria 5747666
463 8004305498 8004300914 Bacteria 6132239
464 8004366870 8004361976 Bacteria 6858373
465 8004378144 8004374579 Bacteria 6898112
466 8004391749 8004387939 Bacteria 7049250
467 8004450596 8004445564 Bacteria 6322258
468 8004633605 8004633249 Bacteria 6723080
469 8004641240 8004640170 Bacteria 6723001
470 8004696823 8004695233 Bacteria 6731676
471 8004710827 8004703790 Bacteria 8006957
472 8004717117 8004714634 Bacteria 6776161
473 8004732298 8004727605 Bacteria 6643904
474 8054462487 8054460903 Bacteria 4872905
475 8055622742 8055617313 Bacteria 7548464
476 Ga0307411_10467798
477 JGI24737J22298_10041378
478 JGI24735J21928_10083841
479 JGI24735J21928_10083904
480 JGI25156J39149_1003605
481 JGI25157J39369_1001043
482 JGI25152J39213_1003323
483 JGI25153J46596_10002193
484 JGI25153J46596_10002942
485 rootH2_10022097
486 rootH1_10014040
487 rootH1_10038740
488 Ga0055533_1005568
489 Ga0055526_1009965
490 Ga0055531_10014712
491 Ga0058692_1000967
492 Ga0070682_100201500
493 Ga0070691_10118940
494 Ga0070661_100165762
495 Ga0070675_100064888
496 Ga0070673_100264313
497 Ga0070709_10213729
498 Ga0070713_100023874
499 Ga0070713_100577680
500 Ga0070700_100013807
501 Ga0070700_100306388
502 Ga0070678_100088669
503 Ga0070662_100197090
504 Ga0068867_100040308
505 Ga0070706_100545237
506 Ga0070679_100341776
507 Ga0070665_100015667
508 Ga0070665_100141128
509 Ga0068855_100255525
510 Ga0070664_100192353
511 Ga0068854_100599391
512 Ga0068861_100002737
513 Ga0068861_100148396
514 Ga0068870_10218094
515 Ga0068862_100100799
516 Ga0075368_10160238
517 Ga0075363_100054454
518 Ga0075363_100128481
519 Ga0075363_100140625
520 Ga0075364_10405933
521 Ga0075362_10011666
522 Ga0075362_10038582
523 Ga0075362_10061231
524 Ga0075367_10209818
525 Ga0075367_10249871
526 Ga0075369_10127834
527 Ga0075366_10030675
528 Ga0075366_10074878
529 Ga0075370_10011841
530 Ga0075370_10401684
531 Ga0075430_100234845
532 Ga0075434_100049078
533 Ga0075436_100009482
534 Ga0099826_10000079
535 Ga0099794_10002520
536 Ga0111539_10317068
537 Ga0111539_10373501
538 Ga0105243_10120269
539 Ga0105237_10117765
540 Ga0105238_10535923
541 Ga0105249_10892188
542 Ga0105239_10048188
543 Ga0157373_10111269
544 Ga0157371_10000425
545 Ga0157371_10041522
546 Ga0157371_10300678
547 Ga0157370_10003706
548 Ga0157369_10242457
549 Ga0163162_11394140
550 Ga0157375_10022141
551 Ga0157380_10054428
552 Ga0157376_10159062
553 Ga0183368_1002
554 Ga0209674_100014
555 Ga0209258_101071
556 Ga0207425_1000200
557 Ga0209646_1004887
558 Ga0209026_1000215
559 Ga0209759_1000591
560 Ga0209129_1000113
561 Ga0209233_1000087
562 Ga0209233_1033049
563 Ga0209673_1015329
564 Ga0209025_1000744
565 Ga0209564_1000186
566 Ga0209758_1000172
567 Ga0209758_1001115
568 Ga0209256_1032846
569 Ga0209257_1000476
570 Ga0209257_1017764
571 Ga0207647_10008076
572 Ga0207647_10018007
573 Ga0207699_10193716
574 Ga0207643_10286230
575 Ga0207684_10072690
576 Ga0207671_10136399
577 Ga0207649_10130515
578 Ga0207700_10120503
579 Ga0207700_10533327
580 Ga0207669_10399185
581 Ga0207704_10807252
582 Ga0207665_10062386
583 Ga0207691_10051831
584 Ga0207691_10052474
585 Ga0207679_10211267
586 Ga0207667_10081887
587 Ga0207651_10455471
588 Ga0207640_10736186
589 Ga0207708_10053472
590 Ga0207708_10064030
591 Ga0207648_10055316
592 Ga0207675_100004190
593 Ga0207675_100015541
594 Ga0209371_1000021
595 Ga0209371_1001149
596 Ga0209588_1045097
597 Ga0209974_10064860
598 Ga0268266_10009153
599 Ga0268266_10064382
600 Ga0268265_10368590
601 Ga0265334_10000986
602 Ga0265338_10007685
603 Ga0265338_10070411
604 Ga0265338_10083305
605 Ga0268256_1000020
606 Ga0268256_1000786
607 Ga0316182_1067084
608 Ga0265330_10004360
609 Ga0265332_10003174
610 Ga0265320_10010245
611 Ga0265329_10017406
612 Ga0265340_10008934
613 Ga0265340_10010348
614 Ga0265340_10029521
615 Ga0265340_10044871
616 Ga0265340_10082769
617 Ga0265339_10118309
618 Ga0265331_10009724
619 Ga0307513_10058538
620 Ga0265313_10008940
621 Ga0265313_10059805
622 Ga0265314_10022086
623 Ga0265342_10012843
624 Ga0307409_100001814
625 Ga0307416_100558700
626 Ga0307411_10134164
627 Ga0307415_100820055
628 Ga0373936_0000008
629 Ga0373936_0062396
630 Ga0373936_0087789
631 Ga0373955_0027651
632 Ga0373933_0244367
633 Ga0373925_0894904
634 Ga0395900_0000078
635 Ga0395900_0015478
636 Ga0395900_0276669
637 Ga0395898_0084624
638 Ga0395905_0277023
639 Ga0395901_0341499
640 Ga0439438_024622
641 Ga0451789_0190427
642 Ga0451791_0544016
643 Ga0451797_0561412
644 Ga0451798_0422633
645 Ga0451798_1136882
646 Ga0451802_0896255
647 Ga0451807_1071693
648 Ga0451853_1720672
649 Ga0450900_020546
650 Ga0439458_0047561
651 Ga0451577_0000133
652 Ga0466972_0000191
653 Ga0466972_0160984
654 Ga0453684_0000180
655 Ga0453684_0000384
656 Ga0451576_0140572
657 Ga0451576_0141953
658 Ga0495638_0013373
659 Ga0495598_0142421
660 Ga0495656_0000001
661 Ga0495668_0358113
662 Ga0495625_0041138
663 Ga0495659_0001615
664 Ga0495661_0090402
665 Ga0495658_0269186
666 Ga0496100_0336119
667 Ga0496104_0049982
668 Ga0496104_0155146
669 Ga0496105_0006306
670 Ga0496105_0619203
671 Ga0496113_0072398
672 Ga0496114_0019737
673 Ga0496115_0000124
674 Ga0496115_0044434
675 Ga0496116_0000275
676 Ga0496116_0143604
677 Ga0496117_0000002
678 Ga0496117_0255797
679 Ga0496118_0001483
680 Ga0496118_0024089
681 Ga0496118_0077412
682 Ga0496119_0029333
683 Ga0496119_0117241
684 Ga0496120_0001101
685 Ga0496120_0020728
686 Ga0496122_0000001
687 Ga0496122_0061560
688 Ga0496122_0179039
689 Ga0496123_0000001
690 Ga0496124_0001394
691 Ga0496124_0024502
692 Ga0496124_0272058
693 Ga0496125_0046191
694 Ga0496125_0064877
695 Ga0496126_0005863
696 Ga0501042_0178493
697 Ga0501047_0444370
698 Ga0501069_0041761
699 Ga0501070_0015443
700 Ga0501070_0288951
701 Ga0501080_0073151
702 Ga0501083_0356748
703 Ga0501044_0168338
704 nmdc:mga03683_11462_c1
705 nmdc:mga03683_130735_c1
706 nmdc:mga03683_44546_c1
707 nmdc:mga03n38_66043_c1
708 nmdc:mga00v17_139624_c1
709 nmdc:mga00v17_78727_c1
710 nmdc:mga0yw44_1802_c1
711 nmdc:mga0yw44_377059_c1
712 nmdc:mga0yw44_78179_c1
713 nmdc:mga0k408_117985_c1
714 nmdc:mga0k408_25014_c1
715 nmdc:mga0k408_41367_c2
716 nmdc:mga06z11_121856_c1
717 nmdc:mga06z11_473720_c1
718 nmdc:mga07m45_12301_c1
719 nmdc:mga0qj67_259088_c1
720 nmdc:mga0n895_104402_c1
721 nmdc:mga0rr50_194903_c1
722 nmdc:mga08x19_243323_c1
723 nmdc:mga0sz30_101178_c1
724 nmdc:mga0sz30_1891_c1
725 nmdc:mga0sz30_96407_c1
726 Ga0500610_0200195
727 Ga0500635_0092595
728 Ga0500572_043006
729 Ga0500561_0000101
730 Ga0500604_0026534
731 Ga0500620_003526
732 Ga0500620_008151
733 Ga0500636_0001546
734 Ga0500637_0074230
735 Ga0500584_053926
736 Ga0500611_011349
737 2503203342
738 2509141508
739 2509370073
740 2510319028
741 2513608421
742 2514419158
743 2537874675
744 2554247490
745 2559294621
746 2587732764
747 2599602246
748 2599940372
749 2601608388
750 2601745162
751 2643919124
752 2643985381
753 2644152077
754 2644518394
755 2687577322
756 2688600178
757 2707100565
758 2723577454
759 2739306481
760 2792749161
761 2808985603
762 2819555725
763 2841741164
764 2841859646
765 2842516431
766 2844015494
767 2847671863
768 2847688090
769 2856318407
770 2856330894
771 2856339167
772 2856360653
773 2856364680
774 2857355038
775 2857370811
776 2857577111
777 2869174433
778 2869235769
779 2869245382
780 2869252908
781 2869257643
782 2869270075
783 2869274369
784 2869289872
785 2871431993
786 2871436570
787 2871447194
788 2871457171
789 2871462418
790 2871478759
791 2871485404
792 2871493980
793 2874102147
794 2874110902
795 2874117487
796 2874127613
797 2874138218
798 2874155615
799 2874162472
800 2874165772
801 2874175402
802 2876370178
803 2876387370
804 2876399429
805 2876399915
806 2876408847
807 2876420959
808 2876427381
809 2878037743
810 2878732237
811 2878748599
812 2878756556
813 2878774990
814 2881153704
815 2881848257
816 2881862424
817 2882916082
818 2885326026
819 2888341357
820 2894511033
821 2899795437
822 2899850228
823 2903502516
824 2903505810
825 2903518163
826 2904665956
827 2906312161
828 2906323899
829 2906331257
830 2906364545
831 2906375612
832 2906394223
833 2906401401
834 2906413000
835 2906418444
836 2906432845
837 2919167921
838 2922156834
839 2922164358
840 2922176920
841 2922182910
842 2924712908
843 2924729208
844 2924735436
845 2924747499
846 2924751357
847 2924764587
848 2924788143
849 2926760701
850 2933012929
851 2933595420
852 2937818015
853 2937829235
854 2937840786
855 2937868545
856 2937875580
857 2937894215
858 2937988026
859 2958071335
860 2958109616
861 2958116945
862 2958127108
863 2958134244
864 2958141405
865 2958158602
866 2958183890
867 2961081856
868 2961121300
869 2961140555
870 2961172846
871 2961188962
872 2965026103
873 2965038587
874 2965047463
875 2965050215
876 2965066430
877 2965091824
878 2965105407
879 2965117031
880 2967998056
881 2968008708
882 2968092371
883 2968097581
884 2968117452
885 2968131710
886 2968145803
887 2970493500
888 2970505440
889 2970517774
890 2970532544
891 2970554114
892 2970625276
893 2970632357
894 2977825736
895 2977851114
896 2977852935
897 2977859925
898 2977875294
899 2977901242
900 2977912133
901 2977917130
902 2977940788
903 2977955063
904 2977959108
905 2978974372
906 2979094022
907 2979098596
908 2979106049
909 2979766912
910 2979774976
911 2979782272
912 2979796139
913 2979810161
914 2984512164
915 2984521474
916 2984540769
917 2984589712
918 2984603034
919 2987643639
920 2987651832
921 2987667391
922 2987677860
923 2996343192
924 2996392118
925 3000141898
926 3004170953
927 3004198341
928 3004207184
929 3004237740
930 3004241101
931 3004254219
932 3004273514
933 649874654
934 650739823
935 8002392372
936 8003570876
937 8004305498
938 8004366870
939 8004378144
940 8004391749
941 8004450596
942 8004633605
943 8004641240
944 8004696823
945 8004710827
946 8004717117
947 8004732298
948 8054462487
949 8055622742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

49

124

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

53

119

0.86

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

43

118

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8849 2 197
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8834 2 197
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8636 2 197
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8396 1 197
4jbb-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase a6tby7(target efi-507184) from klebsiella pneumoniae mgh 78578, gsh complex 0.8395 1 197
ID Description Score Start End Superfamily
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8936 1 76 3.40.30.10
af_Q9FHX0_75_159_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8683 2 73 3.40.30.10
4mp4A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8649 2 76 3.40.30.10
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8633 12 76 3.40.30.10
3bbyA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8614 1 73 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A8A7AT37-F1-model_v4 deleted 0.9954 1 223
AF-A0A531M5M7-F1-model_v4 Glutathione S-transferase 0.9934 93 223 GO:0016740
AF-A0A1U9MC57-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9891 1 224 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A520IXJ3-F1-model_v4 Glutathione S-transferase 0.9888 61 223 GO:0016740
AF-A0A8A7AT37-F1-model_v4 deleted 0.9866 1 223

Map