F451215

General Info

Members Datasets Scaffolds Average Seq Length
474 290 399 254

Family's Representative Sequence

Representative Sequence 3300039110|Ga0400487_30806|Ga0400487_30806_1013_1831
Length 272
Sequence MMEINWNCSALWEEDEMNTEKLVLGGKTFNSRLFTGTGKFADKALISKMLAASKSEMITVALRRVDAQAGAENILEYIPDSVTLLPNTSGARSADEAVRIARIARAAGCGDFIKIEVITDQKYLMPDNWETLKATEILAAEGFVVLPYVMPDLTLAKRLEGAGAAAVMPLGSPIGSNQGLKTRHMIDLLIECCRVPVVVDAGIGRPSHAADAMEMGADAVLVNTAIATAQDPETMGKAFAMAVEAGRMAFEAKLAQTRETAAASSPLTGFLR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
5 2547132181 Kosakonia sacchari SP1 Isolate Stem
6 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
7 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
8 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
9 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
10 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
11 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
12 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
13 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
14 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
15 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
16 2738541278 Niastella sp. CF465 Isolate Unclassified
17 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
18 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
19 2738541302 Pedobacter sp. CF074 Isolate Unclassified
20 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
21 2738543023 Pedobacter sp. OK628 Isolate Unclassified
22 2739367651 Pedobacter sp. OK291 Isolate Unclassified
23 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
24 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
25 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
26 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
27 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
28 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
29 2818991437 Pedobacter terrae 518 Isolate Unclassified
30 2818991444 Filimonas endophytica 3197 Isolate Unclassified
31 2821118458 Enterobacter asburiae 609 Isolate Unclassified
32 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
33 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
34 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
35 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
36 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
37 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
38 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
39 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
40 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
41 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
42 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
43 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
44 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
45 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
46 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
47 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
48 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
49 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
50 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
51 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
52 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
53 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
54 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
55 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
56 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
57 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
58 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
59 2937539931 Pantoea sp. LS15 Isolate Unclassified
60 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
61 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
62 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
63 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
64 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
65 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
66 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
67 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
68 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
69 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
70 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
71 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
72 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
73 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
74 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
75 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
76 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
77 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
85 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
119 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
120 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
121 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
122 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
142 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
144 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
151 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
152 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
153 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
154 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
172 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
180 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
181 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
182 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
183 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
184 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
185 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
186 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
189 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
190 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
191 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
192 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
195 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
196 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
197 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
198 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
258 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
259 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
260 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
261 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
262 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
263 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
264 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
270 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
271 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
272 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
273 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
274 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
277 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
281 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
282 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
283 8018221730 Enterobacter sp. CM29 Isolate Unclassified
284 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
285 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
286 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
287 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
288 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
289 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
290 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.18
Metatranscriptomes 0
Isolates 15.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.17
Nodule 3.16
Rhizoplane 2.53
Rhizosphere 60.55
Stem 0.21
Stem Tuber 0
Unclassified 26.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3099879 2162886007 Bacteria 2193
2 JGI24740J21852_10061747 3300001979 Bacteria 1031
3 JGI24739J22299_10018326 3300001989 Bacteria 2517
4 JGI24735J21928_10000002 3300002067 Bacteria 624895
5 JGI25162J39368_1000020 3300002737 Bacteria 254723
6 rootL2_10006695 3300003322 Bacteria 2635
7 rootL2_10057073 3300003322 Bacteria 10052
8 rootL2_10121786 3300003322 Bacteria 2737
9 rootL2_10128141 3300003322 Bacteria 3001
10 rootL2_10131021 3300003322 Bacteria 1182
11 rootL2_10191393 3300003322 Bacteria 5183
12 rootH1_10003203 3300003323 Bacteria 20511
13 rootH1_10056467 3300003323 Bacteria 5070
14 rootH1_10129571 3300003323 Bacteria 2292
15 rootH1_10158737 3300003323 Bacteria 2836
16 rootH1_10178364 3300003323 Bacteria 1757
17 rootH1_10352505 3300003323 Bacteria 1230
18 Ga0055536_1003004 3300003781 Bacteria 9236
19 Ga0055530_10001365 3300003791 Bacteria 18080
20 Ga0058692_1002726 3300003856 Bacteria 5809
21 Ga0065165_1000446 3300005262 Bacteria 64848
22 Ga0065165_1003609 3300005262 Bacteria 10624
23 Ga0065714_10064526 3300005288 Bacteria 41726
24 Ga0065714_10066200 3300005288 Bacteria 7319
25 Ga0065714_10066669 3300005288 Bacteria 6491
26 Ga0065714_10068604 3300005288 Bacteria 4637
27 Ga0065714_10094373 3300005288 Bacteria 1731
28 Ga0065714_10107707 3300005288 Bacteria 1527
29 Ga0065714_10188054 3300005288 Bacteria 938
30 Ga0065704_10002626 3300005289 Bacteria 9035
31 Ga0065715_10119111 3300005293 Bacteria 2295
32 Ga0065715_10159747 3300005293 Bacteria 1641
33 Ga0070682_100091398 3300005337 Bacteria 1992
34 Ga0070659_100021454 3300005366 Bacteria 4920
35 Ga0070708_100718979 3300005445 Unclassified 940
36 Ga0070663_100027116 3300005455 Bacteria 3886
37 Ga0070698_100194900 3300005471 Bacteria 1963
38 Ga0070684_100312006 3300005535 Bacteria 1444
39 Ga0068853_100333369 3300005539 Bacteria 1408
40 Ga0070665_100013079 3300005548 Bacteria 8356
41 Ga0068855_100058315 3300005563 Bacteria 4522
42 Ga0068857_100028015 3300005577 Bacteria 4969
43 Ga0068857_100217062 3300005577 Bacteria 1746
44 Ga0068856_100019976 3300005614 Bacteria 6503
45 Ga0068856_100876997 3300005614 Bacteria 916
46 Ga0068864_100501662 3300005618 Bacteria 1168
47 Ga0075364_10001322 3300006051 Bacteria 13325
48 Ga0075366_10005793 3300006195 Bacteria 6713
49 Ga0075366_10008307 3300006195 Bacteria 5767
50 Ga0099824_1001587 3300006942 Bacteria 32197
51 Ga0079104_1000326 3300006946 Bacteria 58524
52 Ga0079104_1001129 3300006946 Bacteria 19449
53 Ga0079104_1003652 3300006946 Bacteria 7011
54 Ga0079104_1004268 3300006946 Bacteria 6208
55 Ga0079104_1004692 3300006946 Bacteria 5725
56 Ga0099826_10025275 3300006948 Bacteria 4404
57 Ga0105251_10006220 3300009011 Bacteria 7657
58 Ga0105244_10005711 3300009036 Bacteria 8213
59 Ga0105244_10027807 3300009036 Bacteria 3043
60 Ga0105250_10005142 3300009092 Bacteria 5909
61 Ga0105250_10006692 3300009092 Bacteria 5010
62 Ga0105250_10031622 3300009092 Bacteria 2124
63 Ga0105250_10063372 3300009092 Bacteria 1488
64 Ga0105240_10156778 3300009093 Bacteria 2707
65 Ga0105240_11008718 3300009093 Bacteria 890
66 Ga0114129_10016739 3300009147 Bacteria 10443
67 Ga0105241_10034558 3300009174 Bacteria 3798
68 Ga0105237_10002353 3300009545 Bacteria 23506
69 Ga0105237_10004012 3300009545 Bacteria 17212
70 Ga0105237_10039432 3300009545 Bacteria 4769
71 Ga0105237_10696945 3300009545 Bacteria 1022
72 Ga0105239_10001749 3300010375 Bacteria 28619
73 Ga0105239_10002179 3300010375 Bacteria 25167
74 Ga0105239_10007430 3300010375 Bacteria 12571
75 Ga0105239_10127350 3300010375 Bacteria 2831
76 Ga0105239_10143128 3300010375 Bacteria 2665
77 Ga0105246_10035219 3300011119 Bacteria 3344
78 Ga0157373_10000026 3300013100 Bacteria 139930
79 Ga0157373_10000328 3300013100 Bacteria 38459
80 Ga0157373_10033036 3300013100 Bacteria 3724
81 Ga0157373_10034661 3300013100 Bacteria 3626
82 Ga0157371_10000025 3300013102 Bacteria 279746
83 Ga0157371_10003214 3300013102 Bacteria 15001
84 Ga0157371_10007812 3300013102 Bacteria 8591
85 Ga0157371_10027619 3300013102 Bacteria 4115
86 Ga0157371_10125566 3300013102 Bacteria 1825
87 Ga0157370_10005503 3300013104 Bacteria 14200
88 Ga0157370_10009942 3300013104 Bacteria 10067
89 Ga0157370_10077980 3300013104 Bacteria 3120
90 Ga0157370_10104230 3300013104 Bacteria 2655
91 Ga0157370_10452128 3300013104 Bacteria 1181
92 Ga0157370_10502165 3300013104 Bacteria 1114
93 Ga0157369_10000039 3300013105 Bacteria 188947
94 Ga0157369_10029252 3300013105 Bacteria 6089
95 Ga0157369_10086335 3300013105 Bacteria 3351
96 Ga0157369_10723857 3300013105 Bacteria 1024
97 Ga0163162_10000102 3300013306 Bacteria 76836
98 Ga0163162_10000564 3300013306 Bacteria 34206
99 Ga0157372_10000001 3300013307 Bacteria 791349
100 Ga0157372_10001831 3300013307 Bacteria 23034
101 Ga0157372_10043610 3300013307 Bacteria 4966
102 Ga0157372_10110464 3300013307 Bacteria 3149
103 Ga0157375_10007846 3300013308 Bacteria 9340
104 Ga0157375_10152168 3300013308 Bacteria 2450
105 Ga0157375_11217671 3300013308 Bacteria 883
106 Ga0182008_10000117 3300014497 Bacteria 60070
107 Ga0182008_10151859 3300014497 Bacteria 1162
108 Ga0182006_1000076 3300015261 Bacteria 127435
109 Ga0182006_1063589 3300015261 Bacteria 1386
110 Ga0182006_1063870 3300015261 Bacteria 1382
111 Ga0182007_10000059 3300015262 Bacteria 88462
112 Ga0183366_1010 3300015679 Bacteria 29263
113 Ga0183370_1010 3300015680 Bacteria 29263
114 Ga0183373_1002 3300015682 Bacteria 990153
115 Ga0183369_1025 3300015685 Bacteria 29263
116 Ga0183368_1013 3300015687 Bacteria 29263
117 Ga0163161_10000203 3300017792 Bacteria 54429
118 Ga0163161_10000226 3300017792 Bacteria 51649
119 Ga0163161_10000251 3300017792 Bacteria 47691
120 Ga0163161_10052378 3300017792 Bacteria 2958
121 Ga0163161_10360218 3300017792 Bacteria 1158
122 Ga0213874_10033488 3300021377 Bacteria 1498
123 Ga0209437_100085 3300025233 Bacteria 254790
124 Ga0209233_1010474 3300025261 Bacteria 2776
125 Ga0209676_1000022 3300025292 Bacteria 605659
126 Ga0209676_1000334 3300025292 Bacteria 90392
127 Ga0209050_1000020 3300025298 Bacteria 605671
128 Ga0207696_1008378 3300025711 Bacteria 3964
129 Ga0207696_1032110 3300025711 Bacteria 1583
130 Ga0207655_1001298 3300025728 Bacteria 23639
131 Ga0207655_1001837 3300025728 Bacteria 18364
132 Ga0207655_1005010 3300025728 Bacteria 9169
133 Ga0207713_1001473 3300025735 Bacteria 18653
134 Ga0207713_1003778 3300025735 Bacteria 10154
135 Ga0207647_10060577 3300025904 Bacteria 2313
136 Ga0207695_10101811 3300025913 Bacteria 2866
137 Ga0207695_10295388 3300025913 Bacteria 1512
138 Ga0207671_10001206 3300025914 Bacteria 30711
139 Ga0207671_10002238 3300025914 Bacteria 20952
140 Ga0207664_10002292 3300025929 Bacteria 12628
141 Ga0207690_10012886 3300025932 Bacteria 5010
142 Ga0207667_10033258 3300025949 Bacteria 5546
143 Ga0207667_10400575 3300025949 Bacteria 1397
144 Ga0207678_10044497 3300026067 Bacteria 3840
145 Ga0207702_10037298 3300026078 Bacteria 4068
146 Ga0207674_10240800 3300026116 Bacteria 1756
147 Ga0207674_10944146 3300026116 Bacteria 831
148 Ga0209281_1000069 3300027111 Bacteria 279747
149 Ga0209281_1000581 3300027111 Bacteria 43027
150 Ga0209281_1000803 3300027111 Bacteria 28991
151 Ga0209281_1001133 3300027111 Bacteria 18956
152 Ga0209281_1002433 3300027111 Bacteria 7485
153 Ga0209281_1002890 3300027111 Bacteria 6222
154 Ga0209371_1000680 3300027312 Bacteria 29361
155 Ga0209371_1000814 3300027312 Bacteria 25707
156 Ga0209371_1003549 3300027312 Bacteria 7483
157 Ga0209489_108697 3300027361 Bacteria 13518
158 Ga0209282_1028044 3300027666 Bacteria 3492
159 Ga0268266_10005403 3300028379 Bacteria 11924
160 Ga0265334_10013434 3300028573 Bacteria 3428
161 Ga0265336_10029658 3300028666 Bacteria 1706
162 Ga0307515_10000144 3300028794 Bacteria 170910
163 Ga0307515_10111244 3300028794 Bacteria 3198
164 Ga0265338_10001492 3300028800 Bacteria 37897
165 Ga0268256_1000584 3300030500 Bacteria 29264
166 Ga0268256_1001177 3300030500 Bacteria 16854
167 Ga0268256_1004085 3300030500 Bacteria 6241
168 Ga0316176_1014596 3300030732 Bacteria 15075
169 Ga0316179_1048846 3300030734 Bacteria 1357
170 Ga0316183_1016718 3300030742 Bacteria 50913
171 Ga0316181_1091070 3300030744 Bacteria 11978
172 Ga0307513_10214613 3300031456 Bacteria 1752
173 Ga0307513_10586380 3300031456 Bacteria 825
174 Ga0307509_10121690 3300031507 Bacteria 2586
175 Ga0307408_100002096 3300031548 Bacteria 14355
176 Ga0307408_100002586 3300031548 Bacteria 12616
177 Ga0316575_10082794 3300031665 Bacteria 1295
178 Ga0316579_10199286 3300031691 Bacteria 968
179 Ga0307405_10000066 3300031731 Bacteria 48667
180 Ga0307405_10350040 3300031731 Bacteria 1139
181 Ga0316577_10055038 3300031733 Bacteria 2220
182 Ga0307413_10000308 3300031824 Bacteria 15170
183 Ga0307413_10069144 3300031824 Bacteria 2215
184 Ga0307410_10000087 3300031852 Bacteria 30911
185 Ga0307406_10000053 3300031901 Bacteria 63933
186 Ga0307407_10000011 3300031903 Bacteria 174454
187 Ga0307407_10002178 3300031903 Bacteria 7548
188 Ga0307412_10253311 3300031911 Bacteria 1368
189 Ga0307409_100009003 3300031995 Bacteria 6105
190 Ga0307416_100000005 3300032002 Bacteria 477728
191 Ga0307416_100002787 3300032002 Bacteria 10148
192 Ga0307414_10000314 3300032004 Bacteria 27951
193 Ga0307414_10002784 3300032004 Bacteria 9214
194 Ga0307414_10002910 3300032004 Bacteria 9051
195 Ga0307414_10113566 3300032004 Bacteria 2068
196 Ga0307414_10155816 3300032004 Unclassified 1808
197 Ga0307414_10204597 3300032004 Bacteria 1608
198 Ga0307414_10340490 3300032004 Bacteria 1284
199 Ga0307411_10000002 3300032005 Bacteria 534807
200 Ga0307411_10077896 3300032005 Bacteria 2271
201 Ga0307411_10431780 3300032005 Bacteria 1097
202 Ga0316583_10076264 3300032133 Bacteria 1172
203 Ga0307507_10000345 3300033179 Bacteria 94462
204 Ga0307507_10001092 3300033179 Bacteria 60190
205 Ga0307510_10097660 3300033180 Bacteria 2746
206 Ga0316584_0194856 3300036712 Bacteria 1497
207 Ga0316584_0237899 3300036712 Bacteria 1333
208 Ga0373925_0245525 3300037068 Bacteria 1435
209 Ga0395899_0000011 3300037312 Bacteria 521331
210 Ga0395899_0000342 3300037312 Bacteria 57838
211 Ga0395905_0000350 3300037471 Bacteria 65548
212 Ga0395901_0303533 3300038443 Unclassified 1655
213 Ga0400484_19061 3300038725 Bacteria 1940
214 Ga0400484_42723 3300038725 Bacteria 3633
215 Ga0400490_24874 3300038726 Bacteria 1096
216 Ga0400490_40404 3300038726 Bacteria 7759
217 Ga0400490_46364 3300038726 Bacteria 2824
218 Ga0400490_58386 3300038726 Bacteria 55578
219 Ga0400485_02753 3300038735 Bacteria 18661
220 Ga0400488_13774 3300038741 Bacteria 2464
221 Ga0400488_34316 3300038741 Bacteria 2061
222 Ga0400488_45117 3300038741 Bacteria 13162
223 Ga0400488_58961 3300038741 Bacteria 2357
224 Ga0400488_58977 3300038741 Bacteria 3868
225 Ga0400486_03581 3300038742 Bacteria 68142
226 Ga0400486_10563 3300038742 Bacteria 14057
227 Ga0400486_24868 3300038742 Bacteria 20008
228 Ga0400483_160307 3300039062 Bacteria 1855
229 Ga0400483_248203 3300039062 Bacteria 51057
230 Ga0400483_270583 3300039062 Bacteria 25035
231 Ga0400489_48068 3300039093 Bacteria 18162
232 Ga0400489_87056 3300039093 Bacteria 68318
233 Ga0400487_30806 3300039110 Bacteria 2003
234 Ga0400487_41259 3300039110 Bacteria 4072
235 Ga0436363_0600823 3300039450 Bacteria 4040
236 Ga0439438_004284 3300041405 Bacteria 5530
237 Ga0439438_015044 3300041405 Bacteria 2286
238 Ga0439438_028515 3300041405 Bacteria 1501
239 Ga0439447_002648 3300041407 Bacteria 6485
240 Ga0439466_0000494 3300041411 Bacteria 14932
241 Ga0451795_0150112 3300041456 Bacteria 2511
242 Ga0439431_0003183 3300041997 Bacteria 3610
243 Ga0439449_0081291 3300042007 Bacteria 1195
244 Ga0439452_000444 3300042010 Bacteria 23385
245 Ga0439452_001200 3300042010 Bacteria 11132
246 Ga0439457_003094 3300042014 Bacteria 4600
247 Ga0439457_035351 3300042014 Unclassified 1111
248 Ga0439462_0026150 3300042015 Bacteria 1538
249 Ga0450900_010919 3300042136 Bacteria 1171
250 Ga0450902_004393 3300042137 Bacteria 2097
251 Ga0451577_0948254 3300042876 Bacteria 774
252 Ga0466969_0000052 3300044656 Bacteria 60425
253 Ga0466969_0059248 3300044656 Bacteria 1862
254 Ga0466972_0000008 3300044658 Bacteria 264518
255 Ga0466981_0000054 3300044669 Bacteria 29349
256 Ga0453683_0500641 3300044673 Bacteria 788
257 Ga0466966_0000591 3300044684 Bacteria 23091
258 Ga0466966_0007981 3300044684 Bacteria 7015
259 Ga0453684_0056280 3300044712 Bacteria 5103
260 Ga0466968_0010038 3300044735 Bacteria 3659
261 Ga0466970_0194841 3300044765 Bacteria 1127
262 Ga0466957_0000758 3300044842 Bacteria 16424
263 Ga0466957_0003818 3300044842 Bacteria 8329
264 Ga0466959_0000084 3300045049 Bacteria 59368
265 Ga0451576_0379698 3300045051 Bacteria 1481
266 Ga0495627_017986 3300046453 Bacteria 2393
267 Ga0495591_000543 3300046458 Bacteria 28965
268 Ga0495638_0216583 3300046460 Bacteria 1073
269 Ga0495650_0000025 3300046471 Bacteria 486001
270 Ga0495650_0040208 3300046471 Bacteria 2011
271 Ga0495585_0000328 3300046492 Bacteria 46534
272 Ga0495585_0001318 3300046492 Bacteria 19742
273 Ga0495583_0212035 3300046506 Bacteria 784
274 Ga0495606_0024830 3300046507 Bacteria 4308
275 Ga0495610_0000049 3300046512 Bacteria 149009
276 Ga0495610_0001274 3300046512 Bacteria 22574
277 Ga0495610_0007958 3300046512 Bacteria 6955
278 Ga0495610_0196190 3300046512 Bacteria 830
279 Ga0495616_0001397 3300046513 Bacteria 16818
280 Ga0495616_0010052 3300046513 Bacteria 5492
281 Ga0495637_0012783 3300046520 Bacteria 4006
282 Ga0495637_0093256 3300046520 Bacteria 1185
283 Ga0495643_0000743 3300046522 Bacteria 36997
284 Ga0495648_0002214 3300046524 Bacteria 18206
285 Ga0495663_0080986 3300046525 Bacteria 1046
286 Ga0495654_0050554 3300046530 Bacteria 2031
287 Ga0495654_0061023 3300046530 Bacteria 1811
288 Ga0495609_0003247 3300046538 Bacteria 9408
289 Ga0495609_0041533 3300046538 Bacteria 2067
290 Ga0495633_0000046 3300046558 Bacteria 167647
291 Ga0495633_0000144 3300046558 Bacteria 94711
292 Ga0495633_0006179 3300046558 Bacteria 7157
293 Ga0495668_0000050 3300046616 Bacteria 214716
294 Ga0495625_0000063 3300046660 Bacteria 176435
295 Ga0495625_0000820 3300046660 Bacteria 42873
296 Ga0495625_0002535 3300046660 Bacteria 19643
297 Ga0495625_0008889 3300046660 Bacteria 8497
298 Ga0495625_0028875 3300046660 Bacteria 4153
299 Ga0495625_0067665 3300046660 Bacteria 2513
300 Ga0495625_0212691 3300046660 Bacteria 1270
301 Ga0495661_0006876 3300046665 Bacteria 7956
302 Ga0495661_0055250 3300046665 Bacteria 2380
303 Ga0495671_0099441 3300046692 Bacteria 1422
304 Ga0495649_0000006 3300046694 Bacteria 542188
305 Ga0495649_0008384 3300046694 Bacteria 6219
306 Ga0495687_000763 3300047443 Bacteria 34801
307 Ga0495679_003535 3300047446 Bacteria 7470
308 Ga0495673_0000827 3300047469 Bacteria 28983
309 Ga0495673_0008394 3300047469 Bacteria 5822
310 Ga0495686_0000718 3300047472 Bacteria 44415
311 Ga0495686_0000884 3300047472 Bacteria 38050
312 Ga0495614_0007314 3300048089 Bacteria 4918
313 Ga0496100_0038888 3300048903 Bacteria 3017
314 Ga0496100_0465267 3300048903 Bacteria 971
315 Ga0496101_0037933 3300048904 Bacteria 3420
316 Ga0496102_0419148 3300048905 Bacteria 1258
317 Ga0496104_0683391 3300048907 Bacteria 934
318 Ga0496110_0474203 3300048913 Bacteria 1140
319 Ga0496112_0378157 3300048915 Bacteria 1357
320 Ga0496116_0000002 3300048919 Bacteria 920291
321 Ga0496116_0008163 3300048919 Bacteria 9136
322 Ga0496117_0007967 3300048920 Bacteria 10175
323 Ga0496117_0023448 3300048920 Bacteria 4917
324 Ga0496117_0067259 3300048920 Bacteria 2426
325 Ga0496117_0175559 3300048920 Bacteria 1238
326 Ga0496118_0088901 3300048921 Bacteria 2134
327 Ga0496118_0153167 3300048921 Bacteria 1439
328 Ga0496118_0166794 3300048921 Bacteria 1352
329 Ga0496118_0214076 3300048921 Bacteria 1128
330 Ga0496119_0084246 3300048922 Bacteria 1823
331 Ga0496119_0115671 3300048922 Bacteria 1481
332 Ga0496119_0246556 3300048922 Bacteria 902
333 Ga0496120_0011164 3300048923 Bacteria 6200
334 Ga0496120_0014272 3300048923 Bacteria 5301
335 Ga0496120_0037186 3300048923 Bacteria 2891
336 Ga0496121_0004503 3300048924 Bacteria 18670
337 Ga0496121_0008041 3300048924 Bacteria 12572
338 Ga0496121_0016340 3300048924 Bacteria 7669
339 Ga0496121_0019663 3300048924 Bacteria 6740
340 Ga0496121_0073243 3300048924 Bacteria 2746
341 Ga0496121_0200127 3300048924 Bacteria 1424
342 Ga0496122_0004188 3300048925 Bacteria 18138
343 Ga0496122_0018024 3300048925 Bacteria 6547
344 Ga0496122_0038999 3300048925 Bacteria 3795
345 Ga0496122_0176770 3300048925 Bacteria 1278
346 Ga0496123_0002946 3300048926 Bacteria 19879
347 Ga0496123_0014440 3300048926 Bacteria 6548
348 Ga0496123_0038298 3300048926 Bacteria 3372
349 Ga0496124_0017472 3300048927 Bacteria 6758
350 Ga0496124_0178462 3300048927 Bacteria 1637
351 Ga0496124_0293958 3300048927 Bacteria 1177
352 Ga0496125_0000007 3300048928 Bacteria 715355
353 Ga0496125_0002828 3300048928 Bacteria 21876
354 Ga0496125_0009223 3300048928 Bacteria 10192
355 Ga0496125_0011398 3300048928 Bacteria 8895
356 Ga0496125_0024107 3300048928 Bacteria 5602
357 Ga0496125_0051976 3300048928 Bacteria 3373
358 Ga0496126_0009584 3300048929 Bacteria 10270
359 Ga0496126_0049442 3300048929 Bacteria 3839
360 Ga0496126_0054569 3300048929 Bacteria 3618
361 Ga0496126_0316826 3300048929 Bacteria 1283
362 Ga0496126_0330670 3300048929 Bacteria 1250
363 Ga0501034_0131827 3300049571 Bacteria 2482
364 Ga0501047_0123951 3300049581 Bacteria 2464
365 Ga0501047_0147818 3300049581 Bacteria 2226
366 Ga0501048_0111306 3300049582 Bacteria 1933
367 Ga0501223_002319 3300049663 Bacteria 4249
368 Ga0501224_013367 3300049664 Bacteria 1212
369 Ga0501238_000234 3300049671 Bacteria 7847
370 Ga0501243_027142 3300049675 Bacteria 965
371 Ga0501249_003452 3300049679 Bacteria 3174
372 Ga0501249_006937 3300049679 Bacteria 2334
373 Ga0501249_032313 3300049679 Bacteria 1170
374 Ga0501225_0003188 3300049705 Bacteria 5012
375 Ga0501266_000001 3300049763 Bacteria 562004
376 Ga0501280_002790 3300049776 Bacteria 2825
377 Ga0501044_0025700 3300049823 Bacteria 6242
378 nmdc:mga00v17_7476_c1 3300050491 Bacteria 5832
379 nmdc:mga0k408_14731_c1 3300050493 Bacteria 4314
380 nmdc:mga0k408_381_c2 3300050493 Bacteria 5790
381 nmdc:mga05p37_15161_c1 3300050507 Bacteria 9254
382 Ga0500578_0001526 3300053086 Bacteria 22846
383 Ga0500583_0000081 3300053092 Bacteria 55682
384 Ga0500583_0009956 3300053092 Bacteria 3501
385 Ga0500641_0000247 3300053096 Bacteria 20148
386 Ga0500641_0000300 3300053096 Bacteria 18512
387 Ga0500594_0012815 3300053118 Bacteria 1984
388 Ga0500614_051322 3300053123 Bacteria 1084
389 Ga0500652_085055 3300053131 Bacteria 1318
390 Ga0500658_0000001 3300053134 Bacteria 592738
391 Ga0500559_0090499 3300053136 Bacteria 1400
392 Ga0500573_0089309 3300053140 Bacteria 1743
393 Ga0500616_0176639 3300053153 Bacteria 965
394 Ga0500622_0000113 3300053156 Bacteria 83196
395 Ga0500622_0000162 3300053156 Bacteria 70682
396 Ga0500622_0045877 3300053156 Bacteria 2261
397 Ga0500624_000436 3300053157 Bacteria 12629
398 Ga0500636_0141218 3300053177 Bacteria 1333
399 Ga0500661_032028 3300055283 Bacteria 928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053153 Ga0500616_0176639 Ga0500616_0176639_153_920 219
2 3300002737 JGI25162J39368_1000020 JGI25162J39368_1000020110 220
3 3300010375 Ga0105239_10001749 Ga0105239_1000174919 220
4 3300017792 Ga0163161_10052378 Ga0163161_100523784 220
5 3300025233 Ga0209437_100085 Ga0209437_100085100 220
6 3300009545 Ga0105237_10002353 Ga0105237_1000235310 221
7 3300025914 Ga0207671_10001206 Ga0207671_1000120610 221
8 3300005262 Ga0065165_1003609 Ga0065165_10036091 223
9 3300009545 Ga0105237_10004012 Ga0105237_100040125 224
10 3300025914 Ga0207671_10002238 Ga0207671_1000223816 224
11 3300042876 Ga0451577_0948254 Ga0451577_0948254_45_719 224
12 3300044673 Ga0453683_0500641 Ga0453683_0500641_33_758 224
13 3300003322 rootL2_10057073 rootL2_100570733 228
14 3300003323 rootH1_10158737 rootH1_101587371 228
15 3300005577 Ga0068857_100217062 Ga0068857_1002170622 228
16 3300005618 Ga0068864_100501662 Ga0068864_1005016622 228
17 3300025929 Ga0207664_10002292 Ga0207664_100022926 228
18 3300026116 Ga0207674_10240800 Ga0207674_102408001 228
19 3300028573 Ga0265334_10013434 Ga0265334_100134344 228
20 3300046694 Ga0495649_0008384 Ga0495649_0008384_34_756 228
21 3300013102 Ga0157371_10007812 Ga0157371_100078123 229
22 3300013105 Ga0157369_10086335 Ga0157369_100863354 229
23 3300046506 Ga0495583_0212035 Ga0495583_0212035_13_705 229
24 3300046512 Ga0495610_0196190 Ga0495610_0196190_82_774 229
25 3300046520 Ga0495637_0093256 Ga0495637_0093256_35_727 229
26 3300048921 Ga0496118_0214076 Ga0496118_0214076_26_715 229
27 3300053123 Ga0500614_051322 Ga0500614_051322_369_1061 229
28 3300005445 Ga0070708_100718979 Ga0070708_1007189791 230
29 3300031456 Ga0307513_10586380 Ga0307513_105863801 231
30 3300048922 Ga0496119_0246556 Ga0496119_0246556_17_712 231
31 3300038725 Ga0400484_42723 Ga0400484_42723_355_1125 233
32 3300003322 rootL2_10121786 rootL2_101217864 234
33 3300005288 Ga0065714_10064526 Ga0065714_100645267 234
34 3300009036 Ga0105244_10027807 Ga0105244_100278072 234
35 3300006946 Ga0079104_1001129 Ga0079104_10011297 236
36 3300027111 Ga0209281_1001133 Ga0209281_10011337 236
37 3300013100 Ga0157373_10033036 Ga0157373_100330362 240
38 3300048923 Ga0496120_0014272 Ga0496120_0014272_3604_4377 240
39 3300038741 Ga0400488_13774 Ga0400488_13774_853_1641 241
40 3300038726 Ga0400490_40404 Ga0400490_40404_508_1278 243
41 3300013102 Ga0157371_10003214 Ga0157371_100032142 245
42 3300013307 Ga0157372_10000001 Ga0157372_10000001255 245
43 3300037312 Ga0395899_0000342 Ga0395899_0000342_1538_2305 245
44 3300038443 Ga0395901_0303533 Ga0395901_0303533_410_1177 245
45 3300044712 Ga0453684_0056280 Ga0453684_0056280_596_1336 245
46 3300031903 Ga0307407_10000011 Ga0307407_1000001151 246
47 3300031995 Ga0307409_100009003 Ga0307409_1000090035 246
48 3300048929 Ga0496126_0049442 Ga0496126_0049442_291_1043 246
49 3300049571 Ga0501034_0131827 Ga0501034_0131827_980_1753 246
50 3300048905 Ga0496102_0419148 Ga0496102_0419148_422_1192 249
51 3300048920 Ga0496117_0023448 Ga0496117_0023448_1596_2366 249
52 3300048921 Ga0496118_0088901 Ga0496118_0088901_1282_2052 249
53 3300048924 Ga0496121_0008041 Ga0496121_0008041_4181_4951 249
54 3300048925 Ga0496122_0176770 Ga0496122_0176770_426_1196 249
55 iso_pu_bacteria 2738543023 2739303341 249
56 iso_pu_bacteria 2852627209 2852628358 249
57 iso_pu_bacteria 2919186247 2919186585 249
58 iso_pu_bacteria 2939664404 2939666145 249
59 iso_pu_bacteria 2519899754 2520881012 250
60 iso_pu_bacteria 2599185184 2599478799 250
61 iso_pu_bacteria 2818991444 2819586314 250
62 iso_pu_bacteria 2857627736 2857631785 250
63 iso_pu_bacteria 2928078545 2928080143 250
64 iso_pu_bacteria 2928147474 2928149685 250
65 iso_pu_bacteria 2932082852 2932083510 250
66 3300041456 Ga0451795_0150112 Ga0451795_0150112_638_1411 251
67 3300048903 Ga0496100_0465267 Ga0496100_0465267_194_961 251
68 3300048913 Ga0496110_0474203 Ga0496110_0474203_208_975 251
69 3300048915 Ga0496112_0378157 Ga0496112_0378157_123_890 251
70 iso_pu_bacteria 2522125168 2522548499 251
71 iso_pu_bacteria 2602042066 2603697970 251
72 iso_pu_bacteria 2858438669 2858439256 251
73 iso_pu_bacteria 2881955468 2881956558 251
74 iso_pu_bacteria 2919437846 2919440841 251
75 iso_pu_bacteria 2919692658 2919693980 251
76 iso_pu_bacteria 8018221730 8018223533 251
77 iso_pu_bacteria 8055092621 8055097433 251
78 3300031665 Ga0316575_10082794 Ga0316575_100827941 252
79 3300031733 Ga0316577_10055038 Ga0316577_100550383 252
80 3300036712 Ga0316584_0237899 Ga0316584_0237899_491_1261 252
81 3300038726 Ga0400490_24874 Ga0400490_24874_55_867 252
82 3300038735 Ga0400485_02753 Ga0400485_02753_15618_16388 252
83 3300038741 Ga0400488_58961 Ga0400488_58961_1197_1967 252
84 3300038741 Ga0400488_58977 Ga0400488_58977_478_1248 252
85 3300038742 Ga0400486_03581 Ga0400486_03581_60755_61525 252
86 3300039062 Ga0400483_160307 Ga0400483_160307_916_1689 252
87 3300039093 Ga0400489_87056 Ga0400489_87056_60763_61578 252
88 3300039110 Ga0400487_30806 Ga0400487_30806_1013_1831 252
89 iso_pu_bacteria 2547132181 2547698808 252
90 iso_pu_bacteria 2582581873 2585425126 252
91 iso_pu_bacteria 2585427687 2586209537 252
92 iso_pu_bacteria 2602042047 2603641927 252
93 iso_pu_bacteria 2602042067 2603702289 252
94 iso_pu_bacteria 2738541278 2738729919 252
95 iso_pu_bacteria 2738541302 2738852599 252
96 iso_pu_bacteria 2739367651 2739591281 252
97 iso_pu_bacteria 2791355275 2793407294 252
98 iso_pu_bacteria 2818991437 2819549717 252
99 iso_pu_bacteria 2821118458 2821122121 252
100 iso_pu_bacteria 2842722452 2842727496 252
101 iso_pu_bacteria 2842903701 2842904999 252
102 iso_pu_bacteria 2842909656 2842913894 252
103 iso_pu_bacteria 2849281842 2849283416 252
104 iso_pu_bacteria 2890804823 2890804850 252
105 iso_pu_bacteria 2896109856 2896113121 252
106 iso_pu_bacteria 2896344016 2896346476 252
107 iso_pu_bacteria 2923634449 2923637495 252
108 iso_pu_bacteria 2929154850 2929159678 252
109 iso_pu_bacteria 2937539931 2937542021 252
110 iso_pu_bacteria 2939568625 2939572986 252
111 iso_pu_bacteria 2939573065 2939577817 252
112 iso_pu_bacteria 2939607340 2939611867 252
113 iso_pu_bacteria 2939642701 2939646964 252
114 iso_pu_bacteria 2945997725 2945998193 252
115 iso_pu_bacteria 2954016120 2954020641 252
116 iso_pu_bacteria 8054849141 8054852258 252
117 iso_pu_bacteria 8055097453 8055097643 252
118 3300003322 rootL2_10191393 rootL2_101913934 253
119 3300005614 Ga0068856_100876997 Ga0068856_1008769971 253
120 3300010375 Ga0105239_10143128 Ga0105239_101431284 253
121 3300014497 Ga0182008_10151859 Ga0182008_101518592 253
122 3300030732 Ga0316176_1014596 Ga0316176_10145967 253
123 3300030742 Ga0316183_1016718 Ga0316183_101671848 253
124 3300030744 Ga0316181_1091070 Ga0316181_10910708 253
125 3300031691 Ga0316579_10199286 Ga0316579_101992862 253
126 3300031731 Ga0307405_10350040 Ga0307405_103500402 253
127 3300031911 Ga0307412_10253311 Ga0307412_102533112 253
128 3300032004 Ga0307414_10155816 Ga0307414_101558163 253
129 3300037471 Ga0395905_0000350 Ga0395905_0000350_42590_43351 253
130 3300038725 Ga0400484_19061 Ga0400484_19061_671_1444 253
131 3300038726 Ga0400490_46364 Ga0400490_46364_1565_2338 253
132 3300038726 Ga0400490_58386 Ga0400490_58386_46840_47613 253
133 3300038741 Ga0400488_34316 Ga0400488_34316_1087_1929 253
134 3300038741 Ga0400488_45117 Ga0400488_45117_11671_12444 253
135 3300038742 Ga0400486_10563 Ga0400486_10563_9596_10369 253
136 3300038742 Ga0400486_24868 Ga0400486_24868_16142_16915 253
137 3300039062 Ga0400483_248203 Ga0400483_248203_23281_24060 253
138 3300039062 Ga0400483_270583 Ga0400483_270583_8450_9220 253
139 3300039093 Ga0400489_48068 Ga0400489_48068_16532_17305 253
140 3300039110 Ga0400487_41259 Ga0400487_41259_3032_3805 253
141 3300045051 Ga0451576_0379698 Ga0451576_0379698_662_1432 253
142 3300049663 Ga0501223_002319 Ga0501223_002319_2908_3669 253
143 3300053136 Ga0500559_0090499 Ga0500559_0090499_405_1172 253
144 3300055283 Ga0500661_032028 Ga0500661_032028_38_799 253
145 3300001979 JGI24740J21852_10061747 JGI24740J21852_100617471 254
146 3300001989 JGI24739J22299_10018326 JGI24739J22299_100183263 254
147 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002143 254
148 3300003322 rootL2_10131021 rootL2_101310211 254
149 3300003323 rootH1_10056467 rootH1_100564674 254
150 3300003323 rootH1_10352505 rootH1_103525052 254
151 3300005288 Ga0065714_10066200 Ga0065714_100662008 254
152 3300005288 Ga0065714_10066669 Ga0065714_100666693 254
153 3300005288 Ga0065714_10068604 Ga0065714_100686041 254
154 3300005288 Ga0065714_10188054 Ga0065714_101880541 254
155 3300005293 Ga0065715_10119111 Ga0065715_101191112 254
156 3300005293 Ga0065715_10159747 Ga0065715_101597472 254
157 3300005337 Ga0070682_100091398 Ga0070682_1000913982 254
158 3300005455 Ga0070663_100027116 Ga0070663_1000271163 254
159 3300005535 Ga0070684_100312006 Ga0070684_1003120062 254
160 3300005539 Ga0068853_100333369 Ga0068853_1003333692 254
161 3300006195 Ga0075366_10005793 Ga0075366_100057935 254
162 3300006195 Ga0075366_10008307 Ga0075366_100083072 254
163 3300006942 Ga0099824_1001587 Ga0099824_100158729 254
164 3300006946 Ga0079104_1000326 Ga0079104_100032637 254
165 3300006948 Ga0099826_10025275 Ga0099826_100252753 254
166 3300009092 Ga0105250_10031622 Ga0105250_100316223 254
167 3300009147 Ga0114129_10016739 Ga0114129_100167392 254
168 3300010375 Ga0105239_10007430 Ga0105239_100074303 254
169 3300010375 Ga0105239_10127350 Ga0105239_101273503 254
170 3300013100 Ga0157373_10000026 Ga0157373_1000002671 254
171 3300013100 Ga0157373_10000328 Ga0157373_1000032836 254
172 3300013102 Ga0157371_10125566 Ga0157371_101255662 254
173 3300013104 Ga0157370_10005503 Ga0157370_100055037 254
174 3300013104 Ga0157370_10009942 Ga0157370_100099424 254
175 3300013104 Ga0157370_10104230 Ga0157370_101042303 254
176 3300013105 Ga0157369_10000039 Ga0157369_10000039110 254
177 3300013105 Ga0157369_10029252 Ga0157369_100292523 254
178 3300013306 Ga0163162_10000102 Ga0163162_1000010228 254
179 3300013306 Ga0163162_10000564 Ga0163162_1000056421 254
180 3300013307 Ga0157372_10001831 Ga0157372_1000183119 254
181 3300013307 Ga0157372_10043610 Ga0157372_100436102 254
182 3300013307 Ga0157372_10110464 Ga0157372_101104644 254
183 3300013308 Ga0157375_10007846 Ga0157375_100078465 254
184 3300013308 Ga0157375_10152168 Ga0157375_101521684 254
185 3300013308 Ga0157375_11217671 Ga0157375_112176712 254
186 3300015261 Ga0182006_1063589 Ga0182006_10635892 254
187 3300015261 Ga0182006_1063870 Ga0182006_10638702 254
188 3300017792 Ga0163161_10000203 Ga0163161_1000020329 254
189 3300017792 Ga0163161_10000251 Ga0163161_1000025130 254
190 3300017792 Ga0163161_10360218 Ga0163161_103602182 254
191 3300021377 Ga0213874_10033488 Ga0213874_100334882 254
192 3300025261 Ga0209233_1010474 Ga0209233_10104742 254
193 3300025711 Ga0207696_1032110 Ga0207696_10321102 254
194 3300025904 Ga0207647_10060577 Ga0207647_100605774 254
195 3300025949 Ga0207667_10400575 Ga0207667_104005752 254
196 3300026067 Ga0207678_10044497 Ga0207678_100444973 254
197 3300026116 Ga0207674_10944146 Ga0207674_109441461 254
198 3300027111 Ga0209281_1000069 Ga0209281_100006945 254
199 3300027361 Ga0209489_108697 Ga0209489_10869711 254
200 3300027666 Ga0209282_1028044 Ga0209282_10280443 254
201 3300028794 Ga0307515_10000144 Ga0307515_1000014493 254
202 3300028794 Ga0307515_10111244 Ga0307515_101112441 254
203 3300030734 Ga0316179_1048846 Ga0316179_10488462 254
204 3300031548 Ga0307408_100002096 Ga0307408_1000020965 254
205 3300031548 Ga0307408_100002586 Ga0307408_1000025864 254
206 3300031824 Ga0307413_10000308 Ga0307413_100003088 254
207 3300031824 Ga0307413_10069144 Ga0307413_100691443 254
208 3300031852 Ga0307410_10000087 Ga0307410_1000008716 254
209 3300031901 Ga0307406_10000053 Ga0307406_1000005335 254
210 3300031903 Ga0307407_10002178 Ga0307407_100021787 254
211 3300032002 Ga0307416_100002787 Ga0307416_1000027877 254
212 3300032004 Ga0307414_10000314 Ga0307414_1000031411 254
213 3300032004 Ga0307414_10002784 Ga0307414_100027843 254
214 3300032004 Ga0307414_10113566 Ga0307414_101135662 254
215 3300032004 Ga0307414_10204597 Ga0307414_102045971 254
216 3300032005 Ga0307411_10000002 Ga0307411_10000002246 254
217 3300032005 Ga0307411_10077896 Ga0307411_100778962 254
218 3300032005 Ga0307411_10431780 Ga0307411_104317801 254
219 3300033179 Ga0307507_10000345 Ga0307507_1000034567 254
220 3300033179 Ga0307507_10001092 Ga0307507_1000109215 254
221 3300033180 Ga0307510_10097660 Ga0307510_100976603 254
222 3300036712 Ga0316584_0194856 Ga0316584_0194856_481_1275 254
223 3300037312 Ga0395899_0000011 Ga0395899_0000011_10689_11456 254
224 3300039450 Ga0436363_0600823 Ga0436363_0600823_1250_2044 254
225 3300041407 Ga0439447_002648 Ga0439447_002648_1134_1910 254
226 3300041411 Ga0439466_0000494 Ga0439466_0000494_4219_4995 254
227 3300044656 Ga0466969_0059248 Ga0466969_0059248_878_1645 254
228 3300044684 Ga0466966_0007981 Ga0466966_0007981_5860_6627 254
229 3300044765 Ga0466970_0194841 Ga0466970_0194841_176_976 254
230 3300046471 Ga0495650_0000025 Ga0495650_0000025_456230_456997 254
231 3300046471 Ga0495650_0040208 Ga0495650_0040208_1055_1822 254
232 3300046492 Ga0495585_0000328 Ga0495585_0000328_37094_37861 254
233 3300046492 Ga0495585_0001318 Ga0495585_0001318_11587_12354 254
234 3300046512 Ga0495610_0001274 Ga0495610_0001274_16933_17697 254
235 3300046512 Ga0495610_0007958 Ga0495610_0007958_4548_5315 254
236 3300046513 Ga0495616_0001397 Ga0495616_0001397_10103_10870 254
237 3300046513 Ga0495616_0010052 Ga0495616_0010052_2451_3218 254
238 3300046522 Ga0495643_0000743 Ga0495643_0000743_14910_15680 254
239 3300046524 Ga0495648_0002214 Ga0495648_0002214_2896_3663 254
240 3300046530 Ga0495654_0050554 Ga0495654_0050554_934_1722 254
241 3300046530 Ga0495654_0061023 Ga0495654_0061023_578_1345 254
242 3300046538 Ga0495609_0003247 Ga0495609_0003247_3798_4565 254
243 3300046538 Ga0495609_0041533 Ga0495609_0041533_596_1363 254
244 3300046558 Ga0495633_0000046 Ga0495633_0000046_9038_9805 254
245 3300046558 Ga0495633_0006179 Ga0495633_0006179_4309_5076 254
246 3300046616 Ga0495668_0000050 Ga0495668_0000050_131132_131899 254
247 3300046660 Ga0495625_0000063 Ga0495625_0000063_110605_111372 254
248 3300046660 Ga0495625_0000820 Ga0495625_0000820_38613_39380 254
249 3300046660 Ga0495625_0002535 Ga0495625_0002535_15343_16110 254
250 3300046660 Ga0495625_0008889 Ga0495625_0008889_4650_5417 254
251 3300046660 Ga0495625_0028875 Ga0495625_0028875_888_1655 254
252 3300046660 Ga0495625_0067665 Ga0495625_0067665_275_1066 254
253 3300046665 Ga0495661_0006876 Ga0495661_0006876_3529_4296 254
254 3300046665 Ga0495661_0055250 Ga0495661_0055250_92_859 254
255 3300046692 Ga0495671_0099441 Ga0495671_0099441_121_888 254
256 3300046694 Ga0495649_0000006 Ga0495649_0000006_86071_86838 254
257 3300047443 Ga0495687_000763 Ga0495687_000763_10804_11571 254
258 3300047469 Ga0495673_0008394 Ga0495673_0008394_4932_5699 254
259 3300047472 Ga0495686_0000718 Ga0495686_0000718_5608_6375 254
260 3300048089 Ga0495614_0007314 Ga0495614_0007314_247_1014 254
261 3300048919 Ga0496116_0000002 Ga0496116_0000002_226034_226810 254
262 3300048920 Ga0496117_0067259 Ga0496117_0067259_100_876 254
263 3300048924 Ga0496121_0073243 Ga0496121_0073243_1749_2525 254
264 3300048924 Ga0496121_0200127 Ga0496121_0200127_153_929 254
265 3300048927 Ga0496124_0178462 Ga0496124_0178462_464_1240 254
266 3300048928 Ga0496125_0000007 Ga0496125_0000007_226547_227323 254
267 3300048928 Ga0496125_0002828 Ga0496125_0002828_18863_19633 254
268 3300048929 Ga0496126_0316826 Ga0496126_0316826_140_910 254
269 3300049664 Ga0501224_013367 Ga0501224_013367_68_844 254
270 3300049671 Ga0501238_000234 Ga0501238_000234_6155_6931 254
271 3300049675 Ga0501243_027142 Ga0501243_027142_49_825 254
272 3300049679 Ga0501249_003452 Ga0501249_003452_1094_1870 254
273 3300049679 Ga0501249_006937 Ga0501249_006937_1559_2323 254
274 3300049679 Ga0501249_032313 Ga0501249_032313_109_885 254
275 3300049763 Ga0501266_000001 Ga0501266_000001_387277_388053 254
276 3300049776 Ga0501280_002790 Ga0501280_002790_1619_2395 254
277 3300050493 nmdc:mga0k408_14731_c1 nmdc:mga0k408_14731_c1_1043_1810 254
278 3300050493 nmdc:mga0k408_381_c2 nmdc:mga0k408_381_c2_4370_5137 254
279 3300050507 nmdc:mga05p37_15161_c1 nmdc:mga05p37_15161_c1_181_945 254
280 3300053096 Ga0500641_0000247 Ga0500641_0000247_14732_15508 254
281 3300053096 Ga0500641_0000300 Ga0500641_0000300_6850_7638 254
282 3300053118 Ga0500594_0012815 Ga0500594_0012815_69_857 254
283 3300053134 Ga0500658_0000001 Ga0500658_0000001_58420_59208 254
284 3300053156 Ga0500622_0000113 Ga0500622_0000113_44354_45124 254
285 3300053156 Ga0500622_0000162 Ga0500622_0000162_19019_19789 254
286 3300053157 Ga0500624_000436 Ga0500624_000436_7186_7953 254
287 iso_pu_bacteria 2513020052 2513234918 254
288 iso_pu_bacteria 2643221600 2644012546 254
289 iso_pu_bacteria 2643221667 2644371799 254
290 iso_pu_bacteria 2643221716 2644640856 254
291 iso_pu_bacteria 2643221725 2644684307 254
292 iso_pu_bacteria 2738541279 2738734933 254
293 iso_pu_bacteria 2738541285 2738769076 254
294 iso_pu_bacteria 2738543007 2739216515 254
295 iso_pu_bacteria 2739367857 2739999811 254
296 iso_pu_bacteria 2739367858 2740004627 254
297 iso_pu_bacteria 2802428842 2802651801 254
298 iso_pu_bacteria 2816332280 2817414670 254
299 iso_pu_bacteria 2857613821 2857615350 254
300 iso_pu_bacteria 2857618242 2857622843 254
301 iso_pu_bacteria 2881359912 2881364007 254
302 iso_pu_bacteria 2903895155 2903895753 254
303 iso_pu_bacteria 2904419702 2904422548 254
304 iso_pu_bacteria 2904555929 2904558314 254
305 iso_pu_bacteria 2919683626 2919683660 254
306 iso_pu_bacteria 2929150217 2929151813 254
307 iso_pu_bacteria 2958458903 2958462648 254
308 iso_pu_bacteria 2977268062 2977268542 254
309 iso_pu_bacteria 8054307821 8054308968 254
310 iso_pu_bacteria 8055419101 8055419547 254
311 iso_pu_bacteria 8055592153 8055595804 254
312 iso_pu_bacteria 8056440228 8056443215 254
313 3300003322 rootL2_10006695 rootL2_100066953 255
314 3300003322 rootL2_10128141 rootL2_101281412 255
315 3300003323 rootH1_10129571 rootH1_101295713 255
316 3300003323 rootH1_10178364 rootH1_101783642 255
317 3300003781 Ga0055536_1003004 Ga0055536_10030042 255
318 3300005262 Ga0065165_1000446 Ga0065165_100044626 255
319 3300006946 Ga0079104_1004268 Ga0079104_10042685 255
320 3300009011 Ga0105251_10006220 Ga0105251_100062203 255
321 3300009036 Ga0105244_10005711 Ga0105244_100057116 255
322 3300009092 Ga0105250_10005142 Ga0105250_100051423 255
323 3300013102 Ga0157371_10027619 Ga0157371_100276193 255
324 3300013104 Ga0157370_10077980 Ga0157370_100779803 255
325 3300025292 Ga0209676_1000334 Ga0209676_100033430 255
326 3300025728 Ga0207655_1001837 Ga0207655_10018377 255
327 3300025728 Ga0207655_1005010 Ga0207655_10050103 255
328 3300025735 Ga0207713_1001473 Ga0207713_100147310 255
329 3300027111 Ga0209281_1002890 Ga0209281_10028903 255
330 3300028666 Ga0265336_10029658 Ga0265336_100296582 255
331 3300028800 Ga0265338_10001492 Ga0265338_100014929 255
332 3300032004 Ga0307414_10340490 Ga0307414_103404902 255
333 3300032133 Ga0316583_10076264 Ga0316583_100762642 255
334 3300041997 Ga0439431_0003183 Ga0439431_0003183_810_1583 255
335 3300042007 Ga0439449_0081291 Ga0439449_0081291_46_819 255
336 3300042010 Ga0439452_001200 Ga0439452_001200_4933_5700 255
337 3300042014 Ga0439457_035351 Ga0439457_035351_97_864 255
338 3300042015 Ga0439462_0026150 Ga0439462_0026150_269_1036 255
339 3300046558 Ga0495633_0000144 Ga0495633_0000144_92027_92800 255
340 3300047446 Ga0495679_003535 Ga0495679_003535_1807_2574 255
341 3300048920 Ga0496117_0175559 Ga0496117_0175559_163_930 255
342 3300048921 Ga0496118_0166794 Ga0496118_0166794_13_780 255
343 3300048924 Ga0496121_0016340 Ga0496121_0016340_3700_4467 255
344 3300048925 Ga0496122_0018024 Ga0496122_0018024_3202_3969 255
345 3300048925 Ga0496122_0038999 Ga0496122_0038999_2967_3749 255
346 3300048926 Ga0496123_0014440 Ga0496123_0014440_3696_4463 255
347 3300048927 Ga0496124_0293958 Ga0496124_0293958_97_864 255
348 3300048928 Ga0496125_0009223 Ga0496125_0009223_4316_5083 255
349 3300048929 Ga0496126_0330670 Ga0496126_0330670_472_1239 255
350 iso_pu_bacteria 2740891818 2740992041 255
351 2162886007 SwRhRL2b_contig_3099879 SwRhRL2b_0468.00003360 256
352 3300003323 rootH1_10003203 rootH1_100032035 256
353 3300003791 Ga0055530_10001365 Ga0055530_1000136513 256
354 3300003856 Ga0058692_1002726 Ga0058692_10027265 256
355 3300005288 Ga0065714_10094373 Ga0065714_100943732 256
356 3300005288 Ga0065714_10107707 Ga0065714_101077072 256
357 3300005289 Ga0065704_10002626 Ga0065704_100026264 256
358 3300005366 Ga0070659_100021454 Ga0070659_1000214543 256
359 3300005471 Ga0070698_100194900 Ga0070698_1001949002 256
360 3300005548 Ga0070665_100013079 Ga0070665_1000130795 256
361 3300005563 Ga0068855_100058315 Ga0068855_1000583153 256
362 3300005577 Ga0068857_100028015 Ga0068857_1000280155 256
363 3300005614 Ga0068856_100019976 Ga0068856_1000199763 256
364 3300006051 Ga0075364_10001322 Ga0075364_100013226 256
365 3300006946 Ga0079104_1003652 Ga0079104_10036526 256
366 3300006946 Ga0079104_1004692 Ga0079104_10046925 256
367 3300009092 Ga0105250_10006692 Ga0105250_100066925 256
368 3300009092 Ga0105250_10063372 Ga0105250_100633722 256
369 3300009093 Ga0105240_10156778 Ga0105240_101567783 256
370 3300009093 Ga0105240_11008718 Ga0105240_110087181 256
371 3300009174 Ga0105241_10034558 Ga0105241_100345584 256
372 3300009545 Ga0105237_10039432 Ga0105237_100394326 256
373 3300009545 Ga0105237_10696945 Ga0105237_106969451 256
374 3300010375 Ga0105239_10002179 Ga0105239_100021792 256
375 3300011119 Ga0105246_10035219 Ga0105246_100352195 256
376 3300013100 Ga0157373_10034661 Ga0157373_100346612 256
377 3300013102 Ga0157371_10000025 Ga0157371_10000025103 256
378 3300013104 Ga0157370_10452128 Ga0157370_104521282 256
379 3300013104 Ga0157370_10502165 Ga0157370_105021651 256
380 3300013105 Ga0157369_10723857 Ga0157369_107238571 256
381 3300014497 Ga0182008_10000117 Ga0182008_1000011742 256
382 3300015261 Ga0182006_1000076 Ga0182006_100007657 256
383 3300015262 Ga0182007_10000059 Ga0182007_1000005949 256
384 3300015679 Ga0183366_1010 Ga0183366_101014 256
385 3300015680 Ga0183370_1010 Ga0183370_101014 256
386 3300015682 Ga0183373_1002 Ga0183373_1002197 256
387 3300015685 Ga0183369_1025 Ga0183369_102514 256
388 3300015687 Ga0183368_1013 Ga0183368_101314 256
389 3300017792 Ga0163161_10000226 Ga0163161_1000022629 256
390 3300025292 Ga0209676_1000022 Ga0209676_1000022204 256
391 3300025298 Ga0209050_1000020 Ga0209050_1000020335 256
392 3300025711 Ga0207696_1008378 Ga0207696_10083782 256
393 3300025728 Ga0207655_1001298 Ga0207655_10012987 256
394 3300025735 Ga0207713_1003778 Ga0207713_10037788 256
395 3300025913 Ga0207695_10101811 Ga0207695_101018112 256
396 3300025913 Ga0207695_10295388 Ga0207695_102953882 256
397 3300025932 Ga0207690_10012886 Ga0207690_100128865 256
398 3300025949 Ga0207667_10033258 Ga0207667_100332582 256
399 3300026078 Ga0207702_10037298 Ga0207702_100372982 256
400 3300027111 Ga0209281_1000581 Ga0209281_100058114 256
401 3300027111 Ga0209281_1000803 Ga0209281_100080314 256
402 3300027111 Ga0209281_1002433 Ga0209281_10024336 256
403 3300027312 Ga0209371_1000680 Ga0209371_100068014 256
404 3300027312 Ga0209371_1000814 Ga0209371_100081414 256
405 3300027312 Ga0209371_1003549 Ga0209371_10035499 256
406 3300028379 Ga0268266_10005403 Ga0268266_100054035 256
407 3300030500 Ga0268256_1000584 Ga0268256_100058414 256
408 3300030500 Ga0268256_1001177 Ga0268256_10011777 256
409 3300030500 Ga0268256_1004085 Ga0268256_10040852 256
410 3300031456 Ga0307513_10214613 Ga0307513_102146132 256
411 3300031507 Ga0307509_10121690 Ga0307509_101216904 256
412 3300031731 Ga0307405_10000066 Ga0307405_100000665 256
413 3300032002 Ga0307416_100000005 Ga0307416_100000005362 256
414 3300032004 Ga0307414_10002910 Ga0307414_100029107 256
415 3300037068 Ga0373925_0245525 Ga0373925_0245525_389_1186 256
416 3300041405 Ga0439438_004284 Ga0439438_004284_2469_3239 256
417 3300041405 Ga0439438_015044 Ga0439438_015044_1463_2233 256
418 3300041405 Ga0439438_028515 Ga0439438_028515_11_781 256
419 3300042010 Ga0439452_000444 Ga0439452_000444_11987_12757 256
420 3300042014 Ga0439457_003094 Ga0439457_003094_3631_4404 256
421 3300042136 Ga0450900_010919 Ga0450900_010919_237_1007 256
422 3300042137 Ga0450902_004393 Ga0450902_004393_1268_2038 256
423 3300044656 Ga0466969_0000052 Ga0466969_0000052_28471_29244 256
424 3300044658 Ga0466972_0000008 Ga0466972_0000008_120531_121304 256
425 3300044669 Ga0466981_0000054 Ga0466981_0000054_16332_17102 256
426 3300044684 Ga0466966_0000591 Ga0466966_0000591_239_1012 256
427 3300044735 Ga0466968_0010038 Ga0466968_0010038_1218_1991 256
428 3300044842 Ga0466957_0000758 Ga0466957_0000758_825_1601 256
429 3300044842 Ga0466957_0003818 Ga0466957_0003818_6349_7122 256
430 3300045049 Ga0466959_0000084 Ga0466959_0000084_42754_43527 256
431 3300046453 Ga0495627_017986 Ga0495627_017986_1055_1825 256
432 3300046458 Ga0495591_000543 Ga0495591_000543_16316_17086 256
433 3300046460 Ga0495638_0216583 Ga0495638_0216583_104_877 256
434 3300046507 Ga0495606_0024830 Ga0495606_0024830_118_888 256
435 3300046512 Ga0495610_0000049 Ga0495610_0000049_36122_36892 256
436 3300046520 Ga0495637_0012783 Ga0495637_0012783_115_885 256
437 3300046525 Ga0495663_0080986 Ga0495663_0080986_108_878 256
438 3300046660 Ga0495625_0212691 Ga0495625_0212691_371_1150 256
439 3300047469 Ga0495673_0000827 Ga0495673_0000827_16279_17049 256
440 3300047472 Ga0495686_0000884 Ga0495686_0000884_25841_26617 256
441 3300048903 Ga0496100_0038888 Ga0496100_0038888_334_1104 256
442 3300048904 Ga0496101_0037933 Ga0496101_0037933_1199_1969 256
443 3300048907 Ga0496104_0683391 Ga0496104_0683391_87_857 256
444 3300048919 Ga0496116_0008163 Ga0496116_0008163_6496_7266 256
445 3300048920 Ga0496117_0007967 Ga0496117_0007967_7523_8293 256
446 3300048921 Ga0496118_0153167 Ga0496118_0153167_26_796 256
447 3300048922 Ga0496119_0084246 Ga0496119_0084246_1040_1810 256
448 3300048922 Ga0496119_0115671 Ga0496119_0115671_479_1249 256
449 3300048923 Ga0496120_0011164 Ga0496120_0011164_1919_2689 256
450 3300048923 Ga0496120_0037186 Ga0496120_0037186_586_1356 256
451 3300048924 Ga0496121_0004503 Ga0496121_0004503_7758_8528 256
452 3300048924 Ga0496121_0019663 Ga0496121_0019663_5350_6120 256
453 3300048925 Ga0496122_0004188 Ga0496122_0004188_5349_6119 256
454 3300048926 Ga0496123_0002946 Ga0496123_0002946_7090_7860 256
455 3300048926 Ga0496123_0038298 Ga0496123_0038298_737_1507 256
456 3300048927 Ga0496124_0017472 Ga0496124_0017472_2607_3377 256
457 3300048928 Ga0496125_0011398 Ga0496125_0011398_4945_5715 256
458 3300048928 Ga0496125_0024107 Ga0496125_0024107_1957_2727 256
459 3300048928 Ga0496125_0051976 Ga0496125_0051976_1110_1880 256
460 3300048929 Ga0496126_0009584 Ga0496126_0009584_4357_5127 256
461 3300048929 Ga0496126_0054569 Ga0496126_0054569_2137_2907 256
462 3300049581 Ga0501047_0123951 Ga0501047_0123951_1451_2260 256
463 3300049581 Ga0501047_0147818 Ga0501047_0147818_153_926 256
464 3300049582 Ga0501048_0111306 Ga0501048_0111306_1123_1896 256
465 3300049705 Ga0501225_0003188 Ga0501225_0003188_511_1287 256
466 3300049823 Ga0501044_0025700 Ga0501044_0025700_1218_1991 256
467 3300050491 nmdc:mga00v17_7476_c1 nmdc:mga00v17_7476_c1_2760_3530 256
468 3300053086 Ga0500578_0001526 Ga0500578_0001526_8773_9555 256
469 3300053092 Ga0500583_0000081 Ga0500583_0000081_40771_41589 256
470 3300053092 Ga0500583_0009956 Ga0500583_0009956_2343_3116 256
471 3300053131 Ga0500652_085055 Ga0500652_085055_165_947 256
472 3300053140 Ga0500573_0089309 Ga0500573_0089309_605_1393 256
473 3300053156 Ga0500622_0045877 Ga0500622_0045877_1348_2121 256
474 3300053177 Ga0500636_0141218 Ga0500636_0141218_480_1268 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05690

ThiG

Thiazole biosynthesis protein ThiG

23

266

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wv2-assembly1.cif.gz_B crystal structure of thiamine biosynthesis protein from pseudomonas aeruginosa 0.9794 3 239
1wv2-assembly1.cif.gz_A crystal structure of thiamine biosynthesis protein from pseudomonas aeruginosa 0.9743 3 239
2htm-assembly3.cif.gz_B crystal structure of ttha0676 from thermus thermophilus hb8 0.972 9 238
5z9y-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis thiazole synthase (thig) complexed with dxp 0.9716 1 244
2htm-assembly1.cif.gz_A crystal structure of ttha0676 from thermus thermophilus hb8 0.9683 9 238
ID Description Score Start End Superfamily
1wv2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9743 3 239 3.20.20.70
1wv2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9576 3 239 3.20.20.70
af_P30139_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9561 1 254 3.20.20.70
af_P30139_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9487 1 254 3.20.20.70
1xm3C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9254 1 247 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6M1HYC2-F1-model_v4 deleted 1 67 214
AF-A0A227J831-F1-model_v4 thiazole synthase (EC 2.8.1.10) 1 89 210 GO:0009229
GO:1990107
AF-A0A379UZN6-F1-model_v4 thiazole synthase (EC 2.8.1.10) 0.9978 137 236 GO:0009229
GO:1990107
AF-A0A418H8D1-F1-model_v4 deleted 0.9974 1 222
AF-A0A378E784-F1-model_v4 deleted 0.9942 1 177

Feature Viewer

pLDDT pTM Quality
90.52 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map