F451226

General Info

Members Datasets Scaffolds Average Seq Length
474 261 454 451

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0018031|Ga0453684_0018031_3492_4880
Length 462
Sequence MDCGGEWAMSRKYFGTDGVRGRVGSGPITPDFVLRLGYAAGTTLVSREQLPAGEHPTVLIGKDTRISGYMLEAALEAGFAAAGVNVMLCGPMPTPAIAYLTRALRLQAGVVISASHNPFDDNGIKFFSAQGTKLPDAVELEIEARLEQPMGCMMSAKLGKAQRIDDAAGRYIEFCKASFPFDLDLRGMRIVVDCAHGACYHVAPAVFHELGAEVVSIGVAPNGLNINDNVGATAPAALCRAVLDHRADLGIALDGDGDRLLMVDAAGHTYDGDELIYIIARHRLRQGPVSGVVGTQMSNLGFEHALSRLGIAFARAKVGDRYVLELLQEKGWLLGGENSGHILCLDRHSTGDGIVSALQVLAALRGTNETLAAACADLALYPQRLINVEMPAGFDWKACVSIAESVKSVESTLSGRGRVLLRPSGTEPLLRVMVEGPEEKEVVDLAENIASVVRGAFESRSP

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2547132512 Azospira oryzae 6a3 Isolate Unclassified
5 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
6 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
7 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
8 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
9 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
10 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
11 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
12 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
13 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
14 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
15 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
16 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
163 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
171 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
172 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
173 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
192 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
196 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
200 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
201 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
227 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
259 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
260 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
261 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0.21
Isolates 4.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.42
Bulb 0
Endosphere 4.22
Nodule 0.42
Rhizoplane 1.27
Rhizosphere 88.19
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000136 3300002738 Bacteria 57760
2 rootL2_10007958 3300003322 Bacteria 6182
3 Ga0055535_1000031 3300003761 Bacteria 195195
4 Ga0055529_1000075 3300003763 Bacteria 156291
5 Ga0055529_1000098 3300003763 Bacteria 131900
6 Ga0055526_1011307 3300003771 Bacteria 4039
7 Ga0055541_1000186 3300003841 Bacteria 28517
8 Ga0058692_1003371 3300003856 Bacteria 4945
9 Ga0058692_1003597 3300003856 Bacteria 4760
10 Ga0070676_10000344 3300005328 Bacteria 21271
11 Ga0070676_10064599 3300005328 Bacteria 2183
12 Ga0070670_100012051 3300005331 Bacteria 7397
13 Ga0070670_100019593 3300005331 Bacteria 5807
14 Ga0070670_100066726 3300005331 Bacteria 3088
15 Ga0070677_10001138 3300005333 Bacteria 8563
16 Ga0068869_100002284 3300005334 Bacteria 11533
17 Ga0068869_100012438 3300005334 Bacteria 5624
18 Ga0070666_10011470 3300005335 Bacteria 5562
19 Ga0070666_10015780 3300005335 Bacteria 4824
20 Ga0070666_10056272 3300005335 Bacteria 2656
21 Ga0068868_100010845 3300005338 Bacteria 6611
22 Ga0070661_100003316 3300005344 Bacteria 11119
23 Ga0070668_100000570 3300005347 Bacteria 24700
24 Ga0070668_100002309 3300005347 Bacteria 14048
25 Ga0070668_100006258 3300005347 Bacteria 8815
26 Ga0070668_100018576 3300005347 Bacteria 5220
27 Ga0070668_100026426 3300005347 Bacteria 4405
28 Ga0070669_100004925 3300005353 Bacteria 9644
29 Ga0070669_100027822 3300005353 Bacteria 4070
30 Ga0070675_100003674 3300005354 Bacteria 11664
31 Ga0070675_100005818 3300005354 Bacteria 9443
32 Ga0070675_100010050 3300005354 Bacteria 7377
33 Ga0070675_100030707 3300005354 Bacteria 4339
34 Ga0070671_100000964 3300005355 Bacteria 21070
35 Ga0070671_100004526 3300005355 Bacteria 11013
36 Ga0070671_100040293 3300005355 Bacteria 3879
37 Ga0070674_100036259 3300005356 Bacteria 3309
38 Ga0070673_100009982 3300005364 Bacteria 6403
39 Ga0070673_100016890 3300005364 Bacteria 5175
40 Ga0070659_100021189 3300005366 Bacteria 4945
41 Ga0070667_100000717 3300005367 Bacteria 31904
42 Ga0070667_100000861 3300005367 Bacteria 28255
43 Ga0070667_100010401 3300005367 Bacteria 7678
44 Ga0070667_100045126 3300005367 Bacteria 3705
45 Ga0070667_100051603 3300005367 Bacteria 3468
46 Ga0070667_100051660 3300005367 Bacteria 3466
47 Ga0070714_100028869 3300005435 Bacteria 4606
48 Ga0070663_100008579 3300005455 Bacteria 6295
49 Ga0070678_100000973 3300005456 Bacteria 14789
50 Ga0070678_100003163 3300005456 Bacteria 9117
51 Ga0070678_100005164 3300005456 Bacteria 7502
52 Ga0070678_100006281 3300005456 Bacteria 6959
53 Ga0070681_10003789 3300005458 Bacteria 14201
54 Ga0070681_10066628 3300005458 Bacteria 3570
55 Ga0068867_100000742 3300005459 Bacteria 21874
56 Ga0068867_100002382 3300005459 Bacteria 13218
57 Ga0068867_100044801 3300005459 Bacteria 3242
58 Ga0068867_100054142 3300005459 Bacteria 2964
59 Ga0068867_100060621 3300005459 Bacteria 2807
60 Ga0070706_100255112 3300005467 Bacteria 1637
61 Ga0070707_100127348 3300005468 Bacteria 2474
62 Ga0070698_100013809 3300005471 Bacteria 8544
63 Ga0070699_100100036 3300005518 Bacteria 2541
64 Ga0070679_100000447 3300005530 Bacteria 34977
65 Ga0070679_100047641 3300005530 Bacteria 4270
66 Ga0070684_100018034 3300005535 Bacteria 5805
67 Ga0068853_100006683 3300005539 Bacteria 9183
68 Ga0068853_100026920 3300005539 Bacteria 4832
69 Ga0068853_100114785 3300005539 Bacteria 2396
70 Ga0070672_100000196 3300005543 Bacteria 33585
71 Ga0070672_100002140 3300005543 Bacteria 12464
72 Ga0070672_100064406 3300005543 Bacteria 2896
73 Ga0070672_100098759 3300005543 Bacteria 2365
74 Ga0070665_100002446 3300005548 Bacteria 20474
75 Ga0070665_100010979 3300005548 Bacteria 9158
76 Ga0070665_100017986 3300005548 Bacteria 7096
77 Ga0070665_100091566 3300005548 Bacteria 3046
78 Ga0068855_100018065 3300005563 Bacteria 8475
79 Ga0070664_100009604 3300005564 Bacteria 7846
80 Ga0070664_100012841 3300005564 Bacteria 6813
81 Ga0068857_100004361 3300005577 Bacteria 11951
82 Ga0068857_100011475 3300005577 Bacteria 7708
83 Ga0068854_100107690 3300005578 Bacteria 2098
84 Ga0068854_100109319 3300005578 Bacteria 2083
85 Ga0068856_100078635 3300005614 Bacteria 3270
86 Ga0068852_100000363 3300005616 Bacteria 30619
87 Ga0068852_100001673 3300005616 Bacteria 15104
88 Ga0068859_100006173 3300005617 Bacteria 12177
89 Ga0068859_100011881 3300005617 Bacteria 8748
90 Ga0068864_100004761 3300005618 Bacteria 11119
91 Ga0068864_100017951 3300005618 Bacteria 5903
92 Ga0068864_100036958 3300005618 Bacteria 4164
93 Ga0068864_100091126 3300005618 Bacteria 2688
94 Ga0068861_100005080 3300005719 Bacteria 8876
95 Ga0068861_100036210 3300005719 Bacteria 3661
96 Ga0068861_100160860 3300005719 Bacteria 1852
97 Ga0068851_10079271 3300005834 Bacteria 1712
98 Ga0068870_10005130 3300005840 Bacteria 5698
99 Ga0068870_10010083 3300005840 Bacteria 4322
100 Ga0068863_100006418 3300005841 Bacteria 11533
101 Ga0068863_100016916 3300005841 Bacteria 6993
102 Ga0068863_100048496 3300005841 Bacteria 4027
103 Ga0068858_100005605 3300005842 Bacteria 12278
104 Ga0068858_100006950 3300005842 Bacteria 10996
105 Ga0068858_100100066 3300005842 Bacteria 2703
106 Ga0068860_100018852 3300005843 Bacteria 6704
107 Ga0068860_100032426 3300005843 Bacteria 5019
108 Ga0068860_100039880 3300005843 Bacteria 4490
109 Ga0068862_100005780 3300005844 Bacteria 10316
110 Ga0068862_100044507 3300005844 Bacteria 3786
111 Ga0097621_100007492 3300006237 Bacteria 7813
112 Ga0097621_100023422 3300006237 Bacteria 4809
113 Ga0068871_100000813 3300006358 Bacteria 20955
114 Ga0068871_100028592 3300006358 Bacteria 4372
115 Ga0068871_100038785 3300006358 Bacteria 3807
116 Ga0075434_100024510 3300006871 Bacteria 5897
117 Ga0068865_100080204 3300006881 Bacteria 2340
118 Ga0075436_100055968 3300006914 Bacteria 2724
119 Ga0097620_100006173 3300006931 Bacteria 12177
120 Ga0097620_100011880 3300006931 Bacteria 8748
121 Ga0099826_10000029 3300006948 Bacteria 128855
122 Ga0075435_100007105 3300007076 Bacteria 7952
123 Ga0105244_10003073 3300009036 Bacteria 12215
124 Ga0105244_10012270 3300009036 Bacteria 5073
125 Ga0105240_10000218 3300009093 Bacteria 115562
126 Ga0105240_10012726 3300009093 Bacteria 11595
127 Ga0105240_10013674 3300009093 Bacteria 11130
128 Ga0105241_10015007 3300009174 Bacteria 5674
129 Ga0105248_10030098 3300009177 Bacteria 6059
130 Ga0105237_10016954 3300009545 Bacteria 7558
131 Ga0105238_10001225 3300009551 Bacteria 25786
132 Ga0105238_10013872 3300009551 Bacteria 8147
133 Ga0099796_10002419 3300010159 Bacteria 4084
134 Ga0105239_10000153 3300010375 Bacteria 99169
135 Ga0105239_10017161 3300010375 Bacteria 8002
136 Ga0157373_10008610 3300013100 Bacteria 7575
137 Ga0157373_10013131 3300013100 Bacteria 6080
138 Ga0157371_10006444 3300013102 Bacteria 9684
139 Ga0157371_10059456 3300013102 Bacteria 2709
140 Ga0157370_10043868 3300013104 Bacteria 4301
141 Ga0157369_10003656 3300013105 Bacteria 18254
142 Ga0157369_10028310 3300013105 Bacteria 6203
143 Ga0157374_10001084 3300013296 Bacteria 23542
144 Ga0157374_10010746 3300013296 Bacteria 7890
145 Ga0157378_10013998 3300013297 Bacteria 7021
146 Ga0163162_10010727 3300013306 Bacteria 8913
147 Ga0163162_10044080 3300013306 Bacteria 4467
148 Ga0157372_10018306 3300013307 Bacteria 7529
149 Ga0157372_10030689 3300013307 Bacteria 5881
150 Ga0157372_10041880 3300013307 Bacteria 5064
151 Ga0157375_10005460 3300013308 Bacteria 11055
152 Ga0157375_10030878 3300013308 Bacteria 5057
153 Ga0182008_10036525 3300014497 Bacteria 2459
154 Ga0157379_10000629 3300014968 Bacteria 28451
155 Ga0157379_10012879 3300014968 Bacteria 7315
156 Ga0157379_10085525 3300014968 Bacteria 2827
157 Ga0157376_10007184 3300014969 Bacteria 7918
158 Ga0157376_10009543 3300014969 Bacteria 7055
159 Ga0157376_10015555 3300014969 Bacteria 5752
160 Ga0157376_10021165 3300014969 Bacteria 5048
161 Ga0182006_1029794 3300015261 Bacteria 2209
162 Ga0163161_10069636 3300017792 Bacteria 2572
163 Ga0213872_10000109 3300021361 Bacteria 76712
164 Ga0209784_101777 3300025224 Bacteria 2540
165 Ga0209566_100330 3300025225 Bacteria 42404
166 Ga0209674_100160 3300025226 Bacteria 88210
167 Ga0209672_100096 3300025228 Bacteria 112947
168 Ga0209147_100002 3300025229 Bacteria 2158988
169 Ga0209258_100002 3300025242 Bacteria 2158988
170 Ga0209646_1000019 3300025246 Bacteria 475248
171 Ga0209677_102030 3300025253 Bacteria 8028
172 Ga0209148_1000118 3300025254 Bacteria 188330
173 Ga0209148_1004612 3300025254 Bacteria 3345
174 Ga0209759_1006113 3300025256 Bacteria 4098
175 Ga0209565_1007010 3300025263 Bacteria 3088
176 Ga0209455_1000009 3300025272 Bacteria 1042273
177 Ga0209675_1003353 3300025291 Bacteria 7668
178 Ga0209564_1006430 3300025295 Bacteria 6338
179 Ga0209256_1002106 3300025299 Bacteria 17330
180 Ga0207656_10051260 3300025321 Bacteria 1784
181 Ga0207655_1000024 3300025728 Bacteria 459774
182 Ga0207682_10003378 3300025893 Bacteria 6947
183 Ga0207688_10010652 3300025901 Bacteria 5001
184 Ga0207680_10016009 3300025903 Bacteria 3928
185 Ga0207680_10050449 3300025903 Bacteria 2483
186 Ga0207680_10070243 3300025903 Bacteria 2167
187 Ga0207645_10000286 3300025907 Bacteria 42134
188 Ga0207645_10008712 3300025907 Bacteria 7063
189 Ga0207645_10012879 3300025907 Bacteria 5660
190 Ga0207643_10018271 3300025908 Bacteria 3840
191 Ga0207643_10022556 3300025908 Bacteria 3466
192 Ga0207705_10158651 3300025909 Bacteria 1698
193 Ga0207684_10128493 3300025910 Bacteria 2175
194 Ga0207707_10077827 3300025912 Bacteria 2895
195 Ga0207707_10147928 3300025912 Bacteria 2054
196 Ga0207695_10000395 3300025913 Bacteria 98285
197 Ga0207695_10049762 3300025913 Bacteria 4414
198 Ga0207695_10067787 3300025913 Bacteria 3659
199 Ga0207671_10004266 3300025914 Bacteria 13757
200 Ga0207663_10061442 3300025916 Bacteria 2384
201 Ga0207649_10025018 3300025920 Bacteria 3476
202 Ga0207649_10045081 3300025920 Bacteria 2702
203 Ga0207649_10068377 3300025920 Bacteria 2258
204 Ga0207652_10015241 3300025921 Bacteria 6238
205 Ga0207652_10048863 3300025921 Bacteria 3618
206 Ga0207652_10091597 3300025921 Bacteria 2673
207 Ga0207681_10005838 3300025923 Bacteria 7548
208 Ga0207681_10119714 3300025923 Bacteria 1929
209 Ga0207650_10003178 3300025925 Bacteria 11313
210 Ga0207650_10043527 3300025925 Bacteria 3296
211 Ga0207650_10047876 3300025925 Bacteria 3152
212 Ga0207650_10048406 3300025925 Bacteria 3135
213 Ga0207650_10061182 3300025925 Bacteria 2811
214 Ga0207650_10062943 3300025925 Bacteria 2772
215 Ga0207659_10001666 3300025926 Bacteria 13194
216 Ga0207659_10009386 3300025926 Bacteria 6110
217 Ga0207659_10014186 3300025926 Bacteria 5130
218 Ga0207644_10006985 3300025931 Bacteria 7349
219 Ga0207644_10079276 3300025931 Bacteria 2422
220 Ga0207690_10014932 3300025932 Bacteria 4702
221 Ga0207670_10047503 3300025936 Bacteria 2860
222 Ga0207669_10005308 3300025937 Bacteria 5767
223 Ga0207669_10019236 3300025937 Bacteria 3551
224 Ga0207704_10061731 3300025938 Bacteria 2327
225 Ga0207665_10103602 3300025939 Bacteria 1990
226 Ga0207691_10000790 3300025940 Bacteria 31466
227 Ga0207691_10002154 3300025940 Bacteria 19269
228 Ga0207711_10010545 3300025941 Bacteria 7679
229 Ga0207689_10002835 3300025942 Bacteria 15995
230 Ga0207661_10056457 3300025944 Bacteria 3152
231 Ga0207679_10035377 3300025945 Bacteria 3533
232 Ga0207679_10075043 3300025945 Bacteria 2564
233 Ga0207679_10107142 3300025945 Bacteria 2198
234 Ga0207679_10119098 3300025945 Bacteria 2098
235 Ga0207667_10049933 3300025949 Bacteria 4415
236 Ga0207651_10005544 3300025960 Bacteria 6497
237 Ga0207651_10073416 3300025960 Bacteria 2432
238 Ga0207651_10123106 3300025960 Bacteria 1971
239 Ga0207668_10002134 3300025972 Bacteria 11544
240 Ga0207668_10008305 3300025972 Bacteria 6185
241 Ga0207658_10002115 3300025986 Bacteria 14779
242 Ga0207658_10010905 3300025986 Bacteria 6185
243 Ga0207658_10027448 3300025986 Bacteria 4000
244 Ga0207658_10031724 3300025986 Bacteria 3755
245 Ga0207677_10007274 3300026023 Bacteria 6108
246 Ga0207677_10020015 3300026023 Bacteria 4055
247 Ga0207677_10023496 3300026023 Bacteria 3811
248 Ga0207677_10138659 3300026023 Bacteria 1859
249 Ga0207703_10001578 3300026035 Bacteria 20652
250 Ga0207703_10021936 3300026035 Bacteria 5001
251 Ga0207639_10002947 3300026041 Bacteria 11445
252 Ga0207639_10043492 3300026041 Bacteria 3372
253 Ga0207639_10248861 3300026041 Bacteria 1549
254 Ga0207702_10032661 3300026078 Bacteria 4343
255 Ga0207641_10003597 3300026088 Bacteria 13687
256 Ga0207641_10009700 3300026088 Bacteria 7932
257 Ga0207641_10059280 3300026088 Bacteria 3259
258 Ga0207641_10127279 3300026088 Bacteria 2282
259 Ga0207648_10001056 3300026089 Bacteria 30829
260 Ga0207648_10006507 3300026089 Bacteria 11600
261 Ga0207648_10020738 3300026089 Bacteria 5916
262 Ga0207648_10044823 3300026089 Bacteria 3881
263 Ga0207648_10046626 3300026089 Bacteria 3800
264 Ga0207648_10123483 3300026089 Bacteria 2277
265 Ga0207676_10002857 3300026095 Bacteria 12301
266 Ga0207676_10009132 3300026095 Bacteria 7060
267 Ga0207676_10108495 3300026095 Bacteria 2317
268 Ga0207674_10000489 3300026116 Bacteria 52346
269 Ga0207674_10008240 3300026116 Bacteria 12072
270 Ga0207675_100000979 3300026118 Bacteria 28349
271 Ga0207675_100025269 3300026118 Bacteria 5528
272 Ga0207675_100032957 3300026118 Bacteria 4827
273 Ga0207683_10001094 3300026121 Bacteria 24674
274 Ga0207683_10002147 3300026121 Bacteria 17329
275 Ga0207683_10011300 3300026121 Bacteria 7614
276 Ga0207683_10083111 3300026121 Bacteria 2845
277 Ga0207698_10056503 3300026142 Bacteria 3031
278 Ga0209371_1000346 3300027312 Bacteria 50802
279 Ga0209371_1000649 3300027312 Bacteria 30391
280 Ga0209969_1002072 3300027360 Bacteria 2766
281 Ga0209969_1002405 3300027360 Bacteria 2587
282 Ga0209995_1001508 3300027471 Bacteria 3598
283 Ga0209970_1007260 3300027614 Bacteria 1817
284 Ga0209282_1000045 3300027666 Bacteria 118401
285 Ga0209971_1012801 3300027682 Bacteria 1988
286 Ga0209974_10006144 3300027876 Bacteria 4208
287 Ga0268266_10003394 3300028379 Bacteria 15946
288 Ga0268266_10013351 3300028379 Bacteria 7077
289 Ga0268266_10013592 3300028379 Bacteria 7012
290 Ga0268266_10029775 3300028379 Bacteria 4639
291 Ga0268265_10006027 3300028380 Bacteria 8247
292 Ga0268265_10175498 3300028380 Bacteria 1836
293 Ga0268265_10200085 3300028380 Bacteria 1732
294 Ga0268264_10001039 3300028381 Bacteria 27889
295 Ga0268264_10008709 3300028381 Bacteria 8428
296 Ga0265336_10002078 3300028666 Bacteria 8522
297 Ga0265336_10007590 3300028666 Bacteria 3855
298 Ga0265324_10000006 3300029957 Bacteria 267048
299 Ga0268256_1000293 3300030500 Bacteria 50802
300 Ga0268256_1002565 3300030500 Bacteria 9093
301 Ga0316183_1173592 3300030742 Bacteria 3104
302 Ga0316181_1154331 3300030744 Bacteria 1449
303 Ga0265330_10000573 3300031235 Bacteria 23934
304 Ga0265332_10000013 3300031238 Bacteria 250095
305 Ga0265328_10026123 3300031239 Bacteria 2197
306 Ga0265325_10000110 3300031241 Bacteria 56687
307 Ga0265325_10000262 3300031241 Bacteria 37299
308 Ga0265331_10000262 3300031250 Bacteria 60603
309 Ga0265331_10015040 3300031250 Bacteria 4100
310 Ga0265331_10018759 3300031250 Bacteria 3579
311 Ga0265327_10000472 3300031251 Bacteria 71196
312 Ga0265327_10001299 3300031251 Bacteria 32719
313 Ga0265327_10006585 3300031251 Bacteria 9235
314 Ga0265327_10028200 3300031251 Bacteria 3216
315 Ga0265327_10044980 3300031251 Bacteria 2349
316 Ga0265316_10047068 3300031344 Bacteria 3414
317 Ga0265316_10051710 3300031344 Bacteria 3226
318 Ga0265316_10064712 3300031344 Bacteria 2832
319 Ga0265316_10127408 3300031344 Bacteria 1919
320 Ga0265316_10200171 3300031344 Bacteria 1481
321 Ga0307408_100096435 3300031548 Bacteria 2244
322 Ga0316575_10032297 3300031665 Bacteria 2050
323 Ga0316579_10016851 3300031691 Bacteria 3198
324 Ga0316579_10021086 3300031691 Bacteria 2898
325 Ga0265314_10022374 3300031711 Bacteria 4842
326 Ga0265314_10025095 3300031711 Bacteria 4504
327 Ga0316576_10020795 3300031727 Bacteria 4527
328 Ga0316576_10043412 3300031727 Bacteria 3244
329 Ga0316576_10059235 3300031727 Bacteria 2803
330 Ga0316576_10063715 3300031727 Bacteria 2706
331 Ga0316576_10089246 3300031727 Bacteria 2296
332 Ga0316576_10095999 3300031727 Bacteria 2212
333 Ga0316578_10003787 3300031728 Bacteria 7001
334 Ga0316578_10034177 3300031728 Bacteria 2918
335 Ga0316577_10005720 3300031733 Bacteria 6529
336 Ga0316577_10012839 3300031733 Bacteria 4570
337 Ga0316577_10098139 3300031733 Bacteria 1641
338 Ga0307413_10099946 3300031824 Bacteria 1914
339 Ga0307416_100195979 3300032002 Bacteria 1911
340 Ga0307414_10053890 3300032004 Bacteria 2808
341 Ga0307415_100148471 3300032126 Bacteria 1801
342 Ga0316585_10002783 3300032137 Bacteria 4751
343 Ga0316593_10000144 3300032168 Bacteria 10105
344 Ga0373936_0036335 3300035113 Bacteria 1964
345 Ga0316574_0014936 3300035398 Bacteria 4499
346 Ga0316574_0019087 3300035398 Bacteria 4041
347 Ga0316574_0044255 3300035398 Unclassified 2754
348 Ga0316574_0088146 3300035398 Bacteria 1976
349 Ga0316582_0013563 3300036647 Bacteria 4592
350 Ga0316582_0019351 3300036647 Bacteria 3983
351 Ga0316582_0024690 3300036647 Bacteria 3600
352 Ga0316584_0001131 3300036712 Bacteria 15666
353 Ga0316584_0011355 3300036712 Bacteria 6256
354 Ga0316584_0021443 3300036712 Bacteria 4695
355 Ga0316584_0050461 3300036712 Bacteria 3110
356 Ga0316584_0059185 3300036712 Bacteria 2869
357 Ga0316584_0143556 3300036712 Bacteria 1779
358 Ga0373925_0033548 3300037068 Bacteria 3782
359 Ga0395900_0250091 3300037418 Bacteria 1774
360 Ga0316581_0023162 3300037588 Bacteria 1835
361 Ga0400490_24859 3300038726 Bacteria 4345
362 Ga0400483_045791 3300039062 Bacteria 3482
363 Ga0436365_1244758 3300039437 Bacteria 10107
364 Ga0436361_0150902 3300039447 Bacteria 16204
365 Ga0436362_0115475 3300039453 Bacteria 1923
366 Ga0439438_000003 3300041405 Bacteria 464587
367 Ga0439438_035381 3300041405 Bacteria 1312
368 Ga0451577_0000080 3300042876 Bacteria 218034
369 Ga0451577_0002410 3300042876 Bacteria 22320
370 Ga0451577_0024355 3300042876 Bacteria 5507
371 Ga0451577_0048006 3300042876 Bacteria 3815
372 Ga0451577_0148123 3300042876 Bacteria 2111
373 Ga0453683_0000049 3300044673 Bacteria 206697
374 Ga0453684_0000005 3300044712 Bacteria 1431632
375 Ga0453684_0000163 3300044712 Bacteria 296196
376 Ga0453684_0000237 3300044712 Bacteria 236999
377 Ga0453684_0000286 3300044712 Bacteria 218034
378 Ga0453684_0000386 3300044712 Bacteria 180948
379 Ga0453684_0001261 3300044712 Bacteria 76086
380 Ga0453684_0003300 3300044712 Bacteria 36795
381 Ga0453684_0004902 3300044712 Bacteria 27396
382 Ga0453684_0006085 3300044712 Bacteria 23282
383 Ga0453684_0008627 3300044712 Bacteria 18154
384 Ga0453684_0018031 3300044712 Bacteria 10868
385 Ga0453684_0157588 3300044712 Bacteria 2690
386 Ga0453684_0297705 3300044712 Bacteria 1835
387 Ga0451576_0000102 3300045051 Bacteria 218034
388 Ga0451576_0000738 3300045051 Bacteria 65424
389 Ga0451576_0001961 3300045051 Bacteria 32770
390 Ga0451576_0017391 3300045051 Bacteria 7905
391 Ga0451576_0027274 3300045051 Bacteria 6136
392 Ga0451576_0049894 3300045051 Bacteria 4391
393 Ga0451576_0054073 3300045051 Bacteria 4204
394 Ga0451576_0121257 3300045051 Bacteria 2722
395 Ga0451576_0141529 3300045051 Bacteria 2508
396 Ga0495617_049891 3300046452 Bacteria 1392
397 Ga0495650_0078227 3300046471 Bacteria 1281
398 Ga0495605_0011260 3300046474 Bacteria 4993
399 Ga0495607_0135415 3300046501 Bacteria 1276
400 Ga0495610_0006802 3300046512 Bacteria 7759
401 Ga0495616_0003858 3300046513 Bacteria 9553
402 Ga0495644_0068278 3300046523 Bacteria 1335
403 Ga0495648_0134385 3300046524 Bacteria 1310
404 Ga0495654_0093724 3300046530 Bacteria 1390
405 Ga0495609_0018575 3300046538 Bacteria 3220
406 Ga0495621_0045678 3300046539 Bacteria 1552
407 Ga0495645_0047607 3300046543 Bacteria 3124
408 Ga0495668_0050074 3300046616 Bacteria 2315
409 Ga0495671_0012992 3300046692 Bacteria 4529
410 Ga0495649_0128514 3300046694 Bacteria 1337
411 Ga0495636_0004309 3300047318 Bacteria 5585
412 Ga0495679_048046 3300047446 Bacteria 1292
413 Ga0495626_0088650 3300048091 Bacteria 1363
414 Ga0496101_0024118 3300048904 Bacteria 4208
415 Ga0496108_0022890 3300048911 Bacteria 5141
416 Ga0496108_0098695 3300048911 Bacteria 2488
417 Ga0496108_0199406 3300048911 Bacteria 1736
418 Ga0496110_0001035 3300048913 Bacteria 19563
419 Ga0496111_0065225 3300048914 Bacteria 2643
420 Ga0496116_0015436 3300048919 Bacteria 6037
421 Ga0496119_0040087 3300048922 Bacteria 3001
422 Ga0496120_0000068 3300048923 Bacteria 166108
423 Ga0496121_0069622 3300048924 Bacteria 2838
424 Ga0496122_0048548 3300048925 Bacteria 3261
425 Ga0496122_0176137 3300048925 Bacteria 1281
426 Ga0496123_0034054 3300048926 Bacteria 3655
427 Ga0496124_0046805 3300048927 Bacteria 3703
428 Ga0496124_0277850 3300048927 Bacteria 1222
429 Ga0496126_0065235 3300048929 Bacteria 3259
430 Ga0501031_0007637 3300049568 Bacteria 7038
431 Ga0501031_0035381 3300049568 Bacteria 3258
432 Ga0501034_0004957 3300049571 Bacteria 14654
433 Ga0501034_0139521 3300049571 Bacteria 2404
434 Ga0501037_0064202 3300049573 Bacteria 2676
435 Ga0501038_0005079 3300049574 Bacteria 12231
436 Ga0501039_0070017 3300049575 Bacteria 2725
437 Ga0501043_0009405 3300049579 Bacteria 7672
438 Ga0501046_0042090 3300049580 Bacteria 3642
439 Ga0501047_0012445 3300049581 Bacteria 8055
440 Ga0501070_0065405 3300049586 Bacteria 3010
441 Ga0501072_0025669 3300049588 Bacteria 4590
442 Ga0501073_0002603 3300049589 Bacteria 13504
443 Ga0501073_0065883 3300049589 Bacteria 2525
444 Ga0501076_0129327 3300049592 Bacteria 2048
445 Ga0501080_0019924 3300049742 Bacteria 6210
446 Ga0501080_0033171 3300049742 Bacteria 4819
447 Ga0501080_0107311 3300049742 Bacteria 2588
448 Ga0501080_0143560 3300049742 Bacteria 2207
449 Ga0501035_0006007 3300049822 Bacteria 11436
450 nmdc:mga08x19_5900_c1 3300050514 Bacteria 7244
451 Ga0500625_012248 3300053729 Bacteria 3918
452 Ga0501084_0042831 3300054114 Bacteria 3787
453 Ga0501082_0028613 3300060353 Bacteria 4800
454 Ga0501082_0085077 3300060353 Bacteria 2728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0064202 Ga0501037_0064202_1524_2657 364
2 3300035398 Ga0316574_0014936 Ga0316574_0014936_62_1234 384
3 3300046471 Ga0495650_0078227 Ga0495650_0078227_28_1200 386
4 3300046501 Ga0495607_0135415 Ga0495607_0135415_18_1190 386
5 3300048925 Ga0496122_0176137 Ga0496122_0176137_28_1200 386
6 3300048927 Ga0496124_0277850 Ga0496124_0277850_25_1194 386
7 3300048911 Ga0496108_0199406 Ga0496108_0199406_517_1722 397
8 3300042876 Ga0451577_0002410 Ga0451577_0002410_15925_17280 407
9 3300044712 Ga0453684_0000005 Ga0453684_0000005_1055695_1057050 407
10 3300041405 Ga0439438_035381 Ga0439438_035381_49_1287 408
11 3300047446 Ga0495679_048046 Ga0495679_048046_15_1253 408
12 iso_pu_bacteria 2919063839 2919067515 413
13 3300046452 Ga0495617_049891 Ga0495617_049891_48_1313 417
14 3300046523 Ga0495644_0068278 Ga0495644_0068278_14_1279 417
15 3300046524 Ga0495648_0134385 Ga0495648_0134385_24_1289 417
16 3300046530 Ga0495654_0093724 Ga0495654_0093724_39_1304 417
17 3300046694 Ga0495649_0128514 Ga0495649_0128514_17_1282 417
18 3300048091 Ga0495626_0088650 Ga0495626_0088650_63_1328 417
19 3300048911 Ga0496108_0098695 Ga0496108_0098695_1164_2441 417
20 3300031727 Ga0316576_10020795 Ga0316576_100207954 418
21 3300031733 Ga0316577_10098139 Ga0316577_100981392 418
22 3300036712 Ga0316584_0011355 Ga0316584_0011355_3203_4552 418
23 3300038726 Ga0400490_24859 Ga0400490_24859_3038_4321 418
24 3300031251 Ga0265327_10001299 Ga0265327_1000129910 419
25 3300044712 Ga0453684_0001261 Ga0453684_0001261_69532_70887 421
26 3300031235 Ga0265330_10000573 Ga0265330_1000057310 426
27 3300031250 Ga0265331_10000262 Ga0265331_1000026234 426
28 3300031251 Ga0265327_10006585 Ga0265327_100065855 426
29 3300031711 Ga0265314_10025095 Ga0265314_100250953 426
30 3300044712 Ga0453684_0157588 Ga0453684_0157588_580_1899 430
31 3300049568 Ga0501031_0007637 Ga0501031_0007637_1725_3056 432
32 3300045051 Ga0451576_0049894 Ga0451576_0049894_1219_2577 434
33 3300045051 Ga0451576_0141529 Ga0451576_0141529_1103_2461 436
34 iso_pu_bacteria 2887630918 2887631669 436
35 3300003322 rootL2_10007958 rootL2_100079583 437
36 iso_pu_bacteria 2510065053 2510285409 437
37 iso_pu_bacteria 2510065055 2510295949 437
38 iso_pu_bacteria 2510065058 2510313578 437
39 iso_pu_bacteria 2690315857 2691329677 437
40 iso_pu_bacteria 2773857672 2774132424 437
41 iso_pu_bacteria 2917832318 2917833973 437
42 iso_pu_bacteria 2919125081 2919129986 437
43 iso_pu_bacteria 2923525760 2923527445 437
44 iso_pu_bacteria 2974298342 2974302838 437
45 iso_pu_bacteria 2984499530 2984499577 437
46 iso_pu_bacteria 2984504281 2984506018 437
47 iso_pu_bacteria 8011350971 8011352985 437
48 iso_pu_bacteria 8016728285 8016732014 437
49 3300013306 Ga0163162_10044080 Ga0163162_100440803 438
50 iso_pu_bacteria 2791354903 2791925282 438
51 iso_pu_bacteria 2939602548 2939605912 438
52 3300039437 Ga0436365_1244758 Ga0436365_1244758_6041_7393 439
53 iso_pu_bacteria 2547132512 2548846969 439
54 3300005471 Ga0070698_100013809 Ga0070698_1000138094 440
55 3300031727 Ga0316576_10095999 Ga0316576_100959992 440
56 3300032002 Ga0307416_100195979 Ga0307416_1001959792 440
57 3300044712 Ga0453684_0008627 Ga0453684_0008627_9017_10348 440
58 3300003856 Ga0058692_1003371 Ga0058692_10033714 441
59 3300003856 Ga0058692_1003597 Ga0058692_10035973 441
60 3300005328 Ga0070676_10064599 Ga0070676_100645992 441
61 3300005331 Ga0070670_100019593 Ga0070670_1000195934 441
62 3300005354 Ga0070675_100010050 Ga0070675_1000100505 441
63 3300005355 Ga0070671_100000964 Ga0070671_10000096418 441
64 3300005356 Ga0070674_100036259 Ga0070674_1000362592 441
65 3300005456 Ga0070678_100000973 Ga0070678_10000097311 441
66 3300005543 Ga0070672_100000196 Ga0070672_1000001969 441
67 3300005616 Ga0068852_100000363 Ga0068852_10000036331 441
68 3300005618 Ga0068864_100091126 Ga0068864_1000911262 441
69 3300006237 Ga0097621_100007492 Ga0097621_1000074927 441
70 3300009036 Ga0105244_10012270 Ga0105244_100122703 441
71 3300009093 Ga0105240_10000218 Ga0105240_1000021840 441
72 3300010375 Ga0105239_10017161 Ga0105239_100171616 441
73 3300013100 Ga0157373_10008610 Ga0157373_100086101 441
74 3300013102 Ga0157371_10006444 Ga0157371_100064448 441
75 3300013102 Ga0157371_10059456 Ga0157371_100594561 441
76 3300013105 Ga0157369_10003656 Ga0157369_100036567 441
77 3300013296 Ga0157374_10001084 Ga0157374_1000108417 441
78 3300013307 Ga0157372_10018306 Ga0157372_100183061 441
79 3300013307 Ga0157372_10041880 Ga0157372_100418804 441
80 3300014969 Ga0157376_10015555 Ga0157376_100155554 441
81 3300025728 Ga0207655_1000024 Ga0207655_1000024251 441
82 3300025913 Ga0207695_10000395 Ga0207695_1000039562 441
83 3300025920 Ga0207649_10045081 Ga0207649_100450813 441
84 3300025925 Ga0207650_10048406 Ga0207650_100484063 441
85 3300025926 Ga0207659_10001666 Ga0207659_1000166610 441
86 3300025931 Ga0207644_10006985 Ga0207644_100069859 441
87 3300025937 Ga0207669_10019236 Ga0207669_100192363 441
88 3300025944 Ga0207661_10056457 Ga0207661_100564572 441
89 3300025945 Ga0207679_10035377 Ga0207679_100353773 441
90 3300025960 Ga0207651_10005544 Ga0207651_100055444 441
91 3300026023 Ga0207677_10138659 Ga0207677_101386591 441
92 3300026121 Ga0207683_10083111 Ga0207683_100831112 441
93 3300026142 Ga0207698_10056503 Ga0207698_100565033 441
94 3300027312 Ga0209371_1000346 Ga0209371_100034612 441
95 3300027312 Ga0209371_1000649 Ga0209371_100064915 441
96 3300027360 Ga0209969_1002405 Ga0209969_10024052 441
97 3300027614 Ga0209970_1007260 Ga0209970_10072602 441
98 3300030500 Ga0268256_1000293 Ga0268256_100029312 441
99 3300030500 Ga0268256_1002565 Ga0268256_10025653 441
100 3300030742 Ga0316183_1173592 Ga0316183_11735923 441
101 3300030744 Ga0316181_1154331 Ga0316181_11543311 441
102 3300031665 Ga0316575_10032297 Ga0316575_100322971 441
103 3300031691 Ga0316579_10016851 Ga0316579_100168511 441
104 3300031691 Ga0316579_10021086 Ga0316579_100210861 441
105 3300031727 Ga0316576_10043412 Ga0316576_100434123 441
106 3300031727 Ga0316576_10059235 Ga0316576_100592353 441
107 3300031727 Ga0316576_10063715 Ga0316576_100637153 441
108 3300031727 Ga0316576_10089246 Ga0316576_100892462 441
109 3300031728 Ga0316578_10003787 Ga0316578_100037879 441
110 3300031728 Ga0316578_10034177 Ga0316578_100341773 441
111 3300031733 Ga0316577_10005720 Ga0316577_100057209 441
112 3300031733 Ga0316577_10012839 Ga0316577_100128393 441
113 3300032137 Ga0316585_10002783 Ga0316585_100027834 441
114 3300032168 Ga0316593_10000144 Ga0316593_1000014410 441
115 3300035398 Ga0316574_0019087 Ga0316574_0019087_2424_3779 441
116 3300035398 Ga0316574_0044255 Ga0316574_0044255_633_1973 441
117 3300035398 Ga0316574_0088146 Ga0316574_0088146_298_1653 441
118 3300036647 Ga0316582_0013563 Ga0316582_0013563_1079_2425 441
119 3300036647 Ga0316582_0019351 Ga0316582_0019351_645_2006 441
120 3300036647 Ga0316582_0024690 Ga0316582_0024690_1839_3194 441
121 3300036712 Ga0316584_0001131 Ga0316584_0001131_9108_10469 441
122 3300036712 Ga0316584_0021443 Ga0316584_0021443_618_1964 441
123 3300036712 Ga0316584_0050461 Ga0316584_0050461_1447_2802 441
124 3300036712 Ga0316584_0059185 Ga0316584_0059185_1310_2665 441
125 3300037418 Ga0395900_0250091 Ga0395900_0250091_250_1623 441
126 3300037588 Ga0316581_0023162 Ga0316581_0023162_338_1693 441
127 3300039062 Ga0400483_045791 Ga0400483_045791_1596_2939 441
128 3300039453 Ga0436362_0115475 Ga0436362_0115475_401_1765 441
129 3300041405 Ga0439438_000003 Ga0439438_000003_367035_368369 441
130 3300046616 Ga0495668_0050074 Ga0495668_0050074_19_1398 441
131 3300048913 Ga0496110_0001035 Ga0496110_0001035_1816_3165 441
132 3300048914 Ga0496111_0065225 Ga0496111_0065225_950_2299 441
133 3300048919 Ga0496116_0015436 Ga0496116_0015436_2287_3621 441
134 3300048922 Ga0496119_0040087 Ga0496119_0040087_409_1743 441
135 3300048923 Ga0496120_0000068 Ga0496120_0000068_43722_45056 441
136 3300048927 Ga0496124_0046805 Ga0496124_0046805_1632_2966 441
137 3300049571 Ga0501034_0004957 Ga0501034_0004957_8034_9401 441
138 3300049574 Ga0501038_0005079 Ga0501038_0005079_2675_4042 441
139 3300049575 Ga0501039_0070017 Ga0501039_0070017_1298_2665 441
140 3300049579 Ga0501043_0009405 Ga0501043_0009405_188_1555 441
141 3300049580 Ga0501046_0042090 Ga0501046_0042090_60_1427 441
142 3300049581 Ga0501047_0012445 Ga0501047_0012445_2802_4169 441
143 3300049589 Ga0501073_0002603 Ga0501073_0002603_2965_4332 441
144 3300049742 Ga0501080_0019924 Ga0501080_0019924_465_1832 441
145 3300049822 Ga0501035_0006007 Ga0501035_0006007_109_1476 441
146 3300054114 Ga0501084_0042831 Ga0501084_0042831_2188_3555 441
147 3300060353 Ga0501082_0028613 Ga0501082_0028613_3386_4753 441
148 iso_pu_bacteria 8002392321 8002393222 441
149 iso_pu_bacteria 8048746797 8048749049 441
150 3300009545 Ga0105237_10016954 Ga0105237_100169541 442
151 3300009551 Ga0105238_10013872 Ga0105238_100138723 442
152 3300010375 Ga0105239_10000153 Ga0105239_1000015354 442
153 3300025914 Ga0207671_10004266 Ga0207671_1000426611 442
154 3300027360 Ga0209969_1002072 Ga0209969_10020722 442
155 3300027471 Ga0209995_1001508 Ga0209995_10015085 442
156 3300027682 Ga0209971_1012801 Ga0209971_10128012 442
157 3300027876 Ga0209974_10006144 Ga0209974_100061442 442
158 3300031241 Ga0265325_10000262 Ga0265325_1000026211 442
159 3300006914 Ga0075436_100055968 Ga0075436_1000559682 443
160 3300010159 Ga0099796_10002419 Ga0099796_100024193 443
161 3300031238 Ga0265332_10000013 Ga0265332_1000001312 443
162 3300031250 Ga0265331_10015040 Ga0265331_100150403 443
163 3300031251 Ga0265327_10028200 Ga0265327_100282002 443
164 3300031344 Ga0265316_10047068 Ga0265316_100470682 443
165 3300031344 Ga0265316_10051710 Ga0265316_100517102 443
166 3300031344 Ga0265316_10127408 Ga0265316_101274082 443
167 3300031344 Ga0265316_10200171 Ga0265316_102001712 443
168 3300035113 Ga0373936_0036335 Ga0373936_0036335_13_1368 443
169 3300036712 Ga0316584_0143556 Ga0316584_0143556_308_1687 443
170 3300042876 Ga0451577_0024355 Ga0451577_0024355_993_2363 443
171 3300042876 Ga0451577_0048006 Ga0451577_0048006_408_1760 443
172 3300042876 Ga0451577_0148123 Ga0451577_0148123_459_1823 443
173 3300044712 Ga0453684_0003300 Ga0453684_0003300_6110_7462 443
174 3300044712 Ga0453684_0004902 Ga0453684_0004902_24776_26131 443
175 3300044712 Ga0453684_0006085 Ga0453684_0006085_21156_22520 443
176 3300044712 Ga0453684_0018031 Ga0453684_0018031_3492_4880 443
177 3300045051 Ga0451576_0000738 Ga0451576_0000738_39072_40427 443
178 3300045051 Ga0451576_0001961 Ga0451576_0001961_19359_20717 443
179 3300045051 Ga0451576_0027274 Ga0451576_0027274_2248_3606 443
180 3300045051 Ga0451576_0054073 Ga0451576_0054073_877_2232 443
181 3300045051 Ga0451576_0121257 Ga0451576_0121257_735_2090 443
182 3300047318 Ga0495636_0004309 Ga0495636_0004309_3131_4480 443
183 3300050514 nmdc:mga08x19_5900_c1 nmdc:mga08x19_5900_c1_372_1721 443
184 3300053729 Ga0500625_012248 Ga0500625_012248_2365_3723 443
185 3300005331 Ga0070670_100012051 Ga0070670_1000120515 444
186 3300005331 Ga0070670_100066726 Ga0070670_1000667262 444
187 3300005333 Ga0070677_10001138 Ga0070677_100011383 444
188 3300005334 Ga0068869_100002284 Ga0068869_1000022848 444
189 3300005335 Ga0070666_10015780 Ga0070666_100157803 444
190 3300005335 Ga0070666_10056272 Ga0070666_100562721 444
191 3300005344 Ga0070661_100003316 Ga0070661_1000033162 444
192 3300005347 Ga0070668_100000570 Ga0070668_1000005706 444
193 3300005347 Ga0070668_100006258 Ga0070668_1000062589 444
194 3300005347 Ga0070668_100018576 Ga0070668_1000185765 444
195 3300005347 Ga0070668_100026426 Ga0070668_1000264263 444
196 3300005353 Ga0070669_100004925 Ga0070669_1000049256 444
197 3300005353 Ga0070669_100027822 Ga0070669_1000278224 444
198 3300005354 Ga0070675_100005818 Ga0070675_1000058185 444
199 3300005354 Ga0070675_100030707 Ga0070675_1000307073 444
200 3300005355 Ga0070671_100004526 Ga0070671_1000045263 444
201 3300005364 Ga0070673_100009982 Ga0070673_1000099822 444
202 3300005367 Ga0070667_100000861 Ga0070667_10000086119 444
203 3300005367 Ga0070667_100010401 Ga0070667_1000104014 444
204 3300005367 Ga0070667_100045126 Ga0070667_1000451264 444
205 3300005367 Ga0070667_100051603 Ga0070667_1000516032 444
206 3300005367 Ga0070667_100051660 Ga0070667_1000516602 444
207 3300005455 Ga0070663_100008579 Ga0070663_1000085794 444
208 3300005456 Ga0070678_100003163 Ga0070678_1000031637 444
209 3300005456 Ga0070678_100005164 Ga0070678_1000051644 444
210 3300005458 Ga0070681_10003789 Ga0070681_100037898 444
211 3300005459 Ga0068867_100000742 Ga0068867_1000007424 444
212 3300005459 Ga0068867_100044801 Ga0068867_1000448013 444
213 3300005459 Ga0068867_100054142 Ga0068867_1000541422 444
214 3300005459 Ga0068867_100060621 Ga0068867_1000606212 444
215 3300005467 Ga0070706_100255112 Ga0070706_1002551121 444
216 3300005468 Ga0070707_100127348 Ga0070707_1001273482 444
217 3300005518 Ga0070699_100100036 Ga0070699_1001000362 444
218 3300005530 Ga0070679_100000447 Ga0070679_10000044719 444
219 3300005539 Ga0068853_100006683 Ga0068853_1000066832 444
220 3300005539 Ga0068853_100026920 Ga0068853_1000269202 444
221 3300005543 Ga0070672_100064406 Ga0070672_1000644062 444
222 3300005543 Ga0070672_100098759 Ga0070672_1000987592 444
223 3300005548 Ga0070665_100002446 Ga0070665_10000244616 444
224 3300005548 Ga0070665_100017986 Ga0070665_1000179862 444
225 3300005548 Ga0070665_100091566 Ga0070665_1000915662 444
226 3300005577 Ga0068857_100004361 Ga0068857_1000043618 444
227 3300005578 Ga0068854_100107690 Ga0068854_1001076902 444
228 3300005616 Ga0068852_100001673 Ga0068852_1000016737 444
229 3300005617 Ga0068859_100011881 Ga0068859_1000118814 444
230 3300005618 Ga0068864_100004761 Ga0068864_1000047612 444
231 3300005618 Ga0068864_100017951 Ga0068864_1000179512 444
232 3300005719 Ga0068861_100005080 Ga0068861_1000050807 444
233 3300005719 Ga0068861_100036210 Ga0068861_1000362102 444
234 3300005834 Ga0068851_10079271 Ga0068851_100792711 444
235 3300005840 Ga0068870_10005130 Ga0068870_100051301 444
236 3300005840 Ga0068870_10010083 Ga0068870_100100834 444
237 3300005841 Ga0068863_100016916 Ga0068863_1000169165 444
238 3300005841 Ga0068863_100048496 Ga0068863_1000484962 444
239 3300005842 Ga0068858_100005605 Ga0068858_1000056054 444
240 3300005842 Ga0068858_100100066 Ga0068858_1001000662 444
241 3300005843 Ga0068860_100018852 Ga0068860_1000188526 444
242 3300005843 Ga0068860_100032426 Ga0068860_1000324265 444
243 3300005843 Ga0068860_100039880 Ga0068860_1000398802 444
244 3300005844 Ga0068862_100005780 Ga0068862_1000057808 444
245 3300005844 Ga0068862_100044507 Ga0068862_1000445074 444
246 3300006237 Ga0097621_100023422 Ga0097621_1000234223 444
247 3300006358 Ga0068871_100028592 Ga0068871_1000285922 444
248 3300006358 Ga0068871_100038785 Ga0068871_1000387853 444
249 3300006871 Ga0075434_100024510 Ga0075434_1000245104 444
250 3300006881 Ga0068865_100080204 Ga0068865_1000802042 444
251 3300006931 Ga0097620_100011880 Ga0097620_1000118807 444
252 3300007076 Ga0075435_100007105 Ga0075435_1000071055 444
253 3300009036 Ga0105244_10003073 Ga0105244_1000307311 444
254 3300009093 Ga0105240_10013674 Ga0105240_100136747 444
255 3300009177 Ga0105248_10030098 Ga0105248_100300984 444
256 3300013100 Ga0157373_10013131 Ga0157373_100131313 444
257 3300013104 Ga0157370_10043868 Ga0157370_100438682 444
258 3300013297 Ga0157378_10013998 Ga0157378_100139983 444
259 3300013308 Ga0157375_10030878 Ga0157375_100308784 444
260 3300014968 Ga0157379_10000629 Ga0157379_100006294 444
261 3300014968 Ga0157379_10085525 Ga0157379_100855253 444
262 3300014969 Ga0157376_10007184 Ga0157376_100071842 444
263 3300014969 Ga0157376_10021165 Ga0157376_100211652 444
264 3300017792 Ga0163161_10069636 Ga0163161_100696362 444
265 3300025321 Ga0207656_10051260 Ga0207656_100512602 444
266 3300025893 Ga0207682_10003378 Ga0207682_100033783 444
267 3300025901 Ga0207688_10010652 Ga0207688_100106523 444
268 3300025903 Ga0207680_10050449 Ga0207680_100504491 444
269 3300025903 Ga0207680_10070243 Ga0207680_100702432 444
270 3300025907 Ga0207645_10008712 Ga0207645_100087125 444
271 3300025907 Ga0207645_10012879 Ga0207645_100128792 444
272 3300025908 Ga0207643_10018271 Ga0207643_100182714 444
273 3300025908 Ga0207643_10022556 Ga0207643_100225562 444
274 3300025910 Ga0207684_10128493 Ga0207684_101284931 444
275 3300025913 Ga0207695_10067787 Ga0207695_100677871 444
276 3300025916 Ga0207663_10061442 Ga0207663_100614422 444
277 3300025920 Ga0207649_10025018 Ga0207649_100250183 444
278 3300025921 Ga0207652_10015241 Ga0207652_100152413 444
279 3300025923 Ga0207681_10119714 Ga0207681_101197141 444
280 3300025925 Ga0207650_10043527 Ga0207650_100435272 444
281 3300025925 Ga0207650_10061182 Ga0207650_100611822 444
282 3300025925 Ga0207650_10062943 Ga0207650_100629432 444
283 3300025926 Ga0207659_10009386 Ga0207659_100093863 444
284 3300025931 Ga0207644_10079276 Ga0207644_100792762 444
285 3300025936 Ga0207670_10047503 Ga0207670_100475031 444
286 3300025937 Ga0207669_10005308 Ga0207669_100053083 444
287 3300025938 Ga0207704_10061731 Ga0207704_100617312 444
288 3300025939 Ga0207665_10103602 Ga0207665_101036022 444
289 3300025940 Ga0207691_10000790 Ga0207691_1000079018 444
290 3300025942 Ga0207689_10002835 Ga0207689_100028354 444
291 3300025945 Ga0207679_10119098 Ga0207679_101190981 444
292 3300025960 Ga0207651_10073416 Ga0207651_100734162 444
293 3300025960 Ga0207651_10123106 Ga0207651_101231062 444
294 3300025972 Ga0207668_10002134 Ga0207668_100021343 444
295 3300025972 Ga0207668_10008305 Ga0207668_100083053 444
296 3300025986 Ga0207658_10002115 Ga0207658_100021158 444
297 3300025986 Ga0207658_10027448 Ga0207658_100274483 444
298 3300025986 Ga0207658_10031724 Ga0207658_100317242 444
299 3300026023 Ga0207677_10007274 Ga0207677_100072743 444
300 3300026023 Ga0207677_10020015 Ga0207677_100200152 444
301 3300026035 Ga0207703_10001578 Ga0207703_100015784 444
302 3300026035 Ga0207703_10021936 Ga0207703_100219363 444
303 3300026041 Ga0207639_10002947 Ga0207639_100029472 444
304 3300026041 Ga0207639_10043492 Ga0207639_100434922 444
305 3300026078 Ga0207702_10032661 Ga0207702_100326613 444
306 3300026088 Ga0207641_10009700 Ga0207641_100097007 444
307 3300026088 Ga0207641_10059280 Ga0207641_100592803 444
308 3300026088 Ga0207641_10127279 Ga0207641_101272791 444
309 3300026089 Ga0207648_10001056 Ga0207648_100010564 444
310 3300026089 Ga0207648_10020738 Ga0207648_100207384 444
311 3300026089 Ga0207648_10044823 Ga0207648_100448233 444
312 3300026089 Ga0207648_10046626 Ga0207648_100466262 444
313 3300026089 Ga0207648_10123483 Ga0207648_101234832 444
314 3300026095 Ga0207676_10002857 Ga0207676_100028574 444
315 3300026095 Ga0207676_10108495 Ga0207676_101084952 444
316 3300026116 Ga0207674_10008240 Ga0207674_100082404 444
317 3300026118 Ga0207675_100000979 Ga0207675_10000097920 444
318 3300026118 Ga0207675_100025269 Ga0207675_1000252692 444
319 3300026118 Ga0207675_100032957 Ga0207675_1000329575 444
320 3300026121 Ga0207683_10001094 Ga0207683_1000109418 444
321 3300026121 Ga0207683_10011300 Ga0207683_100113003 444
322 3300028379 Ga0268266_10003394 Ga0268266_100033949 444
323 3300028379 Ga0268266_10013592 Ga0268266_100135922 444
324 3300028379 Ga0268266_10029775 Ga0268266_100297752 444
325 3300028380 Ga0268265_10006027 Ga0268265_100060277 444
326 3300028380 Ga0268265_10175498 Ga0268265_101754982 444
327 3300028380 Ga0268265_10200085 Ga0268265_102000852 444
328 3300028381 Ga0268264_10001039 Ga0268264_100010393 444
329 3300028666 Ga0265336_10002078 Ga0265336_100020786 444
330 3300028666 Ga0265336_10007590 Ga0265336_100075903 444
331 3300029957 Ga0265324_10000006 Ga0265324_10000006142 444
332 3300031239 Ga0265328_10026123 Ga0265328_100261232 444
333 3300031241 Ga0265325_10000110 Ga0265325_1000011031 444
334 3300031250 Ga0265331_10018759 Ga0265331_100187593 444
335 3300031251 Ga0265327_10000472 Ga0265327_1000047242 444
336 3300031251 Ga0265327_10044980 Ga0265327_100449803 444
337 3300031344 Ga0265316_10064712 Ga0265316_100647123 444
338 3300031548 Ga0307408_100096435 Ga0307408_1000964352 444
339 3300031711 Ga0265314_10022374 Ga0265314_100223743 444
340 3300031824 Ga0307413_10099946 Ga0307413_100999462 444
341 3300032004 Ga0307414_10053890 Ga0307414_100538902 444
342 3300032126 Ga0307415_100148471 Ga0307415_1001484712 444
343 3300037068 Ga0373925_0033548 Ga0373925_0033548_923_2287 444
344 3300042876 Ga0451577_0000080 Ga0451577_0000080_118543_119895 444
345 3300044673 Ga0453683_0000049 Ga0453683_0000049_118543_119895 444
346 3300044712 Ga0453684_0000163 Ga0453684_0000163_131657_133036 444
347 3300044712 Ga0453684_0000237 Ga0453684_0000237_136584_137936 444
348 3300044712 Ga0453684_0000286 Ga0453684_0000286_98140_99492 444
349 3300044712 Ga0453684_0000386 Ga0453684_0000386_151942_153297 444
350 3300044712 Ga0453684_0297705 Ga0453684_0297705_56_1414 444
351 3300045051 Ga0451576_0000102 Ga0451576_0000102_118543_119895 444
352 3300045051 Ga0451576_0017391 Ga0451576_0017391_6509_7888 444
353 3300046543 Ga0495645_0047607 Ga0495645_0047607_829_2196 444
354 3300048904 Ga0496101_0024118 Ga0496101_0024118_1968_3326 444
355 3300049568 Ga0501031_0035381 Ga0501031_0035381_1139_2503 444
356 3300049571 Ga0501034_0139521 Ga0501034_0139521_694_2064 444
357 3300049586 Ga0501070_0065405 Ga0501070_0065405_395_1762 444
358 3300049588 Ga0501072_0025669 Ga0501072_0025669_433_1794 444
359 3300049589 Ga0501073_0065883 Ga0501073_0065883_726_2093 444
360 3300049592 Ga0501076_0129327 Ga0501076_0129327_114_1481 444
361 3300049742 Ga0501080_0033171 Ga0501080_0033171_515_1882 444
362 3300049742 Ga0501080_0107311 Ga0501080_0107311_678_2045 444
363 3300049742 Ga0501080_0143560 Ga0501080_0143560_229_1599 444
364 3300060353 Ga0501082_0085077 Ga0501082_0085077_680_2047 444
365 3300005328 Ga0070676_10000344 Ga0070676_100003445 445
366 3300005334 Ga0068869_100012438 Ga0068869_1000124382 445
367 3300005335 Ga0070666_10011470 Ga0070666_100114702 445
368 3300005338 Ga0068868_100010845 Ga0068868_1000108453 445
369 3300005347 Ga0070668_100002309 Ga0070668_1000023097 445
370 3300005354 Ga0070675_100003674 Ga0070675_1000036743 445
371 3300005355 Ga0070671_100040293 Ga0070671_1000402933 445
372 3300005364 Ga0070673_100016890 Ga0070673_1000168902 445
373 3300005366 Ga0070659_100021189 Ga0070659_1000211893 445
374 3300005367 Ga0070667_100000717 Ga0070667_1000007177 445
375 3300005435 Ga0070714_100028869 Ga0070714_1000288693 445
376 3300005456 Ga0070678_100006281 Ga0070678_1000062813 445
377 3300005458 Ga0070681_10066628 Ga0070681_100666283 445
378 3300005459 Ga0068867_100002382 Ga0068867_1000023827 445
379 3300005530 Ga0070679_100047641 Ga0070679_1000476413 445
380 3300005535 Ga0070684_100018034 Ga0070684_1000180342 445
381 3300005539 Ga0068853_100114785 Ga0068853_1001147851 445
382 3300005543 Ga0070672_100002140 Ga0070672_1000021406 445
383 3300005548 Ga0070665_100010979 Ga0070665_1000109795 445
384 3300005563 Ga0068855_100018065 Ga0068855_1000180655 445
385 3300005564 Ga0070664_100009604 Ga0070664_1000096043 445
386 3300005564 Ga0070664_100012841 Ga0070664_1000128416 445
387 3300005577 Ga0068857_100011475 Ga0068857_1000114755 445
388 3300005578 Ga0068854_100109319 Ga0068854_1001093191 445
389 3300005614 Ga0068856_100078635 Ga0068856_1000786352 445
390 3300005617 Ga0068859_100006173 Ga0068859_1000061737 445
391 3300005618 Ga0068864_100036958 Ga0068864_1000369582 445
392 3300005719 Ga0068861_100160860 Ga0068861_1001608601 445
393 3300005841 Ga0068863_100006418 Ga0068863_1000064184 445
394 3300005842 Ga0068858_100006950 Ga0068858_1000069504 445
395 3300006358 Ga0068871_100000813 Ga0068871_10000081315 445
396 3300006931 Ga0097620_100006173 Ga0097620_1000061737 445
397 3300009093 Ga0105240_10012726 Ga0105240_100127263 445
398 3300009174 Ga0105241_10015007 Ga0105241_100150077 445
399 3300009551 Ga0105238_10001225 Ga0105238_100012253 445
400 3300013105 Ga0157369_10028310 Ga0157369_100283107 445
401 3300013296 Ga0157374_10010746 Ga0157374_100107465 445
402 3300013306 Ga0163162_10010727 Ga0163162_100107274 445
403 3300013307 Ga0157372_10030689 Ga0157372_100306893 445
404 3300013308 Ga0157375_10005460 Ga0157375_100054607 445
405 3300014968 Ga0157379_10012879 Ga0157379_100128795 445
406 3300014969 Ga0157376_10009543 Ga0157376_100095433 445
407 3300021361 Ga0213872_10000109 Ga0213872_100001093 445
408 3300025903 Ga0207680_10016009 Ga0207680_100160092 445
409 3300025907 Ga0207645_10000286 Ga0207645_1000028620 445
410 3300025909 Ga0207705_10158651 Ga0207705_101586512 445
411 3300025912 Ga0207707_10147928 Ga0207707_101479282 445
412 3300025913 Ga0207695_10049762 Ga0207695_100497623 445
413 3300025920 Ga0207649_10068377 Ga0207649_100683773 445
414 3300025921 Ga0207652_10091597 Ga0207652_100915973 445
415 3300025923 Ga0207681_10005838 Ga0207681_100058383 445
416 3300025925 Ga0207650_10003178 Ga0207650_100031785 445
417 3300025925 Ga0207650_10047876 Ga0207650_100478763 445
418 3300025926 Ga0207659_10014186 Ga0207659_100141863 445
419 3300025932 Ga0207690_10014932 Ga0207690_100149323 445
420 3300025940 Ga0207691_10002154 Ga0207691_1000215413 445
421 3300025941 Ga0207711_10010545 Ga0207711_100105454 445
422 3300025945 Ga0207679_10075043 Ga0207679_100750432 445
423 3300025945 Ga0207679_10107142 Ga0207679_101071422 445
424 3300025949 Ga0207667_10049933 Ga0207667_100499333 445
425 3300025986 Ga0207658_10010905 Ga0207658_100109054 445
426 3300026023 Ga0207677_10023496 Ga0207677_100234962 445
427 3300026041 Ga0207639_10248861 Ga0207639_102488611 445
428 3300026088 Ga0207641_10003597 Ga0207641_100035978 445
429 3300026089 Ga0207648_10006507 Ga0207648_100065074 445
430 3300026095 Ga0207676_10009132 Ga0207676_100091324 445
431 3300026116 Ga0207674_10000489 Ga0207674_1000048915 445
432 3300026121 Ga0207683_10002147 Ga0207683_1000214713 445
433 3300028379 Ga0268266_10013351 Ga0268266_100133513 445
434 3300028381 Ga0268264_10008709 Ga0268264_100087093 445
435 3300039447 Ga0436361_0150902 Ga0436361_0150902_10933_12279 445
436 3300046539 Ga0495621_0045678 Ga0495621_0045678_33_1379 445
437 3300048911 Ga0496108_0022890 Ga0496108_0022890_535_1944 445
438 3300048929 Ga0496126_0065235 Ga0496126_0065235_1415_2782 445
439 3300003771 Ga0055526_1011307 Ga0055526_10113072 446
440 3300006948 Ga0099826_10000029 Ga0099826_1000002985 446
441 3300025263 Ga0209565_1007010 Ga0209565_10070102 446
442 3300025291 Ga0209675_1003353 Ga0209675_10033538 446
443 3300025295 Ga0209564_1006430 Ga0209564_10064303 446
444 3300025299 Ga0209256_1002106 Ga0209256_100210613 446
445 3300025912 Ga0207707_10077827 Ga0207707_100778272 446
446 3300025921 Ga0207652_10048863 Ga0207652_100488632 446
447 3300027666 Ga0209282_1000045 Ga0209282_1000045105 446
448 3300046474 Ga0495605_0011260 Ga0495605_0011260_631_1974 446
449 3300046512 Ga0495610_0006802 Ga0495610_0006802_3800_5143 446
450 3300046513 Ga0495616_0003858 Ga0495616_0003858_7600_8952 446
451 3300046538 Ga0495609_0018575 Ga0495609_0018575_1592_2944 446
452 3300046692 Ga0495671_0012992 Ga0495671_0012992_2478_3830 446
453 3300048924 Ga0496121_0069622 Ga0496121_0069622_973_2325 446
454 3300048925 Ga0496122_0048548 Ga0496122_0048548_1565_2917 446
455 3300048926 Ga0496123_0034054 Ga0496123_0034054_1767_3119 446
456 3300002738 JGI25154J39366_1000136 JGI25154J39366_10001369 447
457 3300003761 Ga0055535_1000031 Ga0055535_1000031141 447
458 3300003763 Ga0055529_1000075 Ga0055529_100007595 447
459 3300003763 Ga0055529_1000098 Ga0055529_10000987 447
460 3300003841 Ga0055541_1000186 Ga0055541_10001868 447
461 3300014497 Ga0182008_10036525 Ga0182008_100365252 447
462 3300015261 Ga0182006_1029794 Ga0182006_10297942 447
463 3300025224 Ga0209784_101777 Ga0209784_1017772 447
464 3300025225 Ga0209566_100330 Ga0209566_10033037 447
465 3300025226 Ga0209674_100160 Ga0209674_1001608 447
466 3300025228 Ga0209672_100096 Ga0209672_10009663 447
467 3300025229 Ga0209147_100002 Ga0209147_100002997 447
468 3300025242 Ga0209258_100002 Ga0209258_100002997 447
469 3300025246 Ga0209646_1000019 Ga0209646_1000019214 447
470 3300025253 Ga0209677_102030 Ga0209677_1020304 447
471 3300025254 Ga0209148_1000118 Ga0209148_1000118103 447
472 3300025254 Ga0209148_1004612 Ga0209148_10046122 447
473 3300025256 Ga0209759_1006113 Ga0209759_10061133 447
474 3300025272 Ga0209455_1000009 Ga0209455_1000009878 447

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00408

PGM_PMM_IV

Phosphoglucomutase/phosphomannomutase, C-terminal domain

385

452

0.97

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

11

150

0.97

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

271

381

0.94

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

169

267

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7olh-assembly3.cif.gz_E bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) 0.9591 4 374
7olh-assembly3.cif.gz_E bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) 0.9565 4 374
6gyz-assembly1.cif.gz_B crystal structure of glmm from staphylococcus aureus 0.9503 4 447
3i3w-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9473 4 446
3i3w-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9369 4 446
ID Description Score Start End Superfamily
6gyzB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9806 161 261 3.40.120.10
af_P31120_3_154_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9742 2 158 3.40.120.10
af_P31120_3_154_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9616 2 158 3.40.120.10
3i3wB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9492 4 156 3.40.120.10
af_P31120_370_445_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9417 375 446 3.30.310.50
ID Description Score Start End GO Terms
AF-A0A382VFH7-F1-model_v4 Alpha-D-phosphohexomutase alpha/beta/alpha domain-containing protein 0.9893 103 268 GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A0A519FNB6-F1-model_v4 Phosphoglucosamine mutase (EC 5.4.2.10) 0.9886 1 196 GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A0A3D2XZ97-F1-model_v4 Phosphoglucosamine mutase (EC 5.4.2.10) 0.9884 68 446 GO:0000287
GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-C6SHR8-F1-model_v4 Phosphoglucosamine mutase (EC 5.4.2.-) 0.9872 1 333 GO:0000287
GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A4MZY5-F1-model_v4 deleted 0.9867 50 446

Feature Viewer

pLDDT pTM Quality
93.26 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map