F451298

General Info

Members Datasets Scaffolds Average Seq Length
475 276 950 117

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100050986|Ga0070689_1000509863
Length 132
Sequence MSRRLGAGLARRGSEAPVRQLHLRVAPPRDALDRFEAAWNRVAEGGRQVELRVLTLRDLPLLVATLSPARWALLRDLGGAGPTSIYGLAKRLGRDYKNVHTDVTQLARLGLIERRGDGVAVAWRIVRAELSL

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
137 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
138 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
184 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
185 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
255 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0.84
Rhizosphere 98.74
Stem 0
Stem Tuber 0
Unclassified 9.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100050986 3300005340 Bacteria 3197
2 Ga0065715_10610795 3300005293 Bacteria 701
3 Ga0070683_100191085 3300005329 Bacteria 1944
4 Ga0070690_101288534 3300005330 Unclassified 585
5 Ga0068869_100001790 3300005334 Bacteria 12887
6 Ga0070680_100009580 3300005336 Bacteria 7444
7 Ga0070682_100067321 3300005337 Bacteria 2281
8 Ga0068868_100015142 3300005338 Bacteria 5698
9 Ga0068868_101176093 3300005338 Bacteria 708
10 Ga0070689_100000354 3300005340 Bacteria 26944
11 Ga0070689_100179743 3300005340 Bacteria 1718
12 Ga0070689_100207302 3300005340 Bacteria 1603
13 Ga0070689_101577004 3300005340 Bacteria 596
14 Ga0070691_10001025 3300005341 Bacteria 11482
15 Ga0070691_10362200 3300005341 Bacteria 808
16 Ga0070691_10532147 3300005341 Bacteria 684
17 Ga0070687_100000710 3300005343 Bacteria 11087
18 Ga0070687_100044548 3300005343 Bacteria 2260
19 Ga0070687_101290335 3300005343 Bacteria 542
20 Ga0070692_10216317 3300005345 Bacteria 1130
21 Ga0070692_10279581 3300005345 Bacteria 1011
22 Ga0070675_100798998 3300005354 Bacteria 862
23 Ga0070674_100276893 3300005356 Bacteria 1328
24 Ga0070673_100304511 3300005364 Bacteria 1404
25 Ga0070688_100166888 3300005365 Bacteria 1516
26 Ga0070703_10006186 3300005406 Bacteria 3350
27 Ga0070710_10553129 3300005437 Bacteria 795
28 Ga0070701_10000907 3300005438 Bacteria 10713
29 Ga0070701_10439694 3300005438 Bacteria 835
30 Ga0070705_100000902 3300005440 Bacteria 16577
31 Ga0070705_100018068 3300005440 Bacteria 3690
32 Ga0070700_100015380 3300005441 Bacteria 4337
33 Ga0070700_100756537 3300005441 Bacteria 778
34 Ga0070700_101223150 3300005441 Bacteria 628
35 Ga0070694_100001920 3300005444 Bacteria 12300
36 Ga0070694_100097732 3300005444 Bacteria 2072
37 Ga0070694_100099062 3300005444 Bacteria 2059
38 Ga0070694_100115709 3300005444 Bacteria 1917
39 Ga0070708_100176550 3300005445 Bacteria 1996
40 Ga0070681_10109171 3300005458 Bacteria 2707
41 Ga0070681_10676740 3300005458 Bacteria 947
42 Ga0068867_100000656 3300005459 Bacteria 22876
43 Ga0070685_11037130 3300005466 Bacteria 617
44 Ga0070706_100032346 3300005467 Bacteria 4825
45 Ga0070707_101153497 3300005468 Unclassified 741
46 Ga0070699_100008087 3300005518 Bacteria 9130
47 Ga0070699_100022732 3300005518 Bacteria 5405
48 Ga0070699_100298934 3300005518 Bacteria 1444
49 Ga0070699_102227877 3300005518 Unclassified 500
50 Ga0070684_100728932 3300005535 Bacteria 925
51 Ga0070684_100932422 3300005535 Bacteria 814
52 Ga0070697_100005347 3300005536 Bacteria 9873
53 Ga0070697_100021112 3300005536 Bacteria 5157
54 Ga0070697_100577440 3300005536 Bacteria 987
55 Ga0070697_100889286 3300005536 Bacteria 790
56 Ga0068853_101071231 3300005539 Bacteria 777
57 Ga0070686_100000107 3300005544 Bacteria 57801
58 Ga0070686_100241382 3300005544 Bacteria 1316
59 Ga0070695_100001550 3300005545 Bacteria 12825
60 Ga0070695_100047842 3300005545 Bacteria 2733
61 Ga0070695_100050036 3300005545 Bacteria 2677
62 Ga0070695_100145042 3300005545 Bacteria 1651
63 Ga0070695_100189347 3300005545 Bacteria 1463
64 Ga0070696_100002104 3300005546 Bacteria 13090
65 Ga0070696_100025195 3300005546 Bacteria 4043
66 Ga0070696_100052874 3300005546 Bacteria 2826
67 Ga0070693_100000606 3300005547 Bacteria 15861
68 Ga0070693_101326684 3300005547 Bacteria 557
69 Ga0070704_100000347 3300005549 Bacteria 21003
70 Ga0070704_100409528 3300005549 Bacteria 1159
71 Ga0068855_100004392 3300005563 Bacteria 17233
72 Ga0068855_100373055 3300005563 Bacteria 1568
73 Ga0070664_100704044 3300005564 Bacteria 941
74 Ga0068854_100037770 3300005578 Bacteria 3391
75 Ga0068854_100258513 3300005578 Bacteria 1393
76 Ga0068856_100019751 3300005614 Bacteria 6538
77 Ga0068856_100093411 3300005614 Bacteria 2994
78 Ga0068856_100115404 3300005614 Bacteria 2685
79 Ga0070702_100000219 3300005615 Bacteria 19216
80 Ga0070702_100100019 3300005615 Bacteria 1777
81 Ga0070702_100497998 3300005615 Unclassified 894
82 Ga0070702_100528924 3300005615 Unclassified 871
83 Ga0068852_100141209 3300005616 Bacteria 2229
84 Ga0068859_100004135 3300005617 Bacteria 14814
85 Ga0068859_100277592 3300005617 Bacteria 1768
86 Ga0068864_100359865 3300005618 Bacteria 1375
87 Ga0068864_101146724 3300005618 Unclassified 775
88 Ga0068866_10000328 3300005718 Bacteria 22471
89 Ga0068861_100032569 3300005719 Bacteria 3838
90 Ga0068870_10157723 3300005840 Bacteria 1343
91 Ga0068863_100131990 3300005841 Bacteria 2385
92 Ga0068863_100858432 3300005841 Bacteria 907
93 Ga0068858_100000324 3300005842 Bacteria 50505
94 Ga0068858_100236612 3300005842 Bacteria 1732
95 Ga0068860_100000836 3300005843 Bacteria 34455
96 Ga0068860_101012935 3300005843 Bacteria 849
97 Ga0068862_100025993 3300005844 Bacteria 4919
98 Ga0068862_100932720 3300005844 Bacteria 855
99 Ga0068862_100995430 3300005844 Unclassified 829
100 Ga0081539_10000188 3300005985 Bacteria 143987
101 Ga0070715_10021589 3300006163 Bacteria 2499
102 Ga0070712_100718625 3300006175 Bacteria 853
103 Ga0075362_10147041 3300006177 Bacteria 1129
104 Ga0097621_100004271 3300006237 Bacteria 9924
105 Ga0097621_100029516 3300006237 Bacteria 4332
106 Ga0097621_100700006 3300006237 Bacteria 933
107 Ga0068871_100012982 3300006358 Bacteria 6169
108 Ga0068871_100042805 3300006358 Bacteria 3637
109 Ga0075428_100035134 3300006844 Bacteria 5525
110 Ga0075428_101011566 3300006844 Bacteria 880
111 Ga0075430_100098829 3300006846 Bacteria 2438
112 Ga0075430_100598232 3300006846 Unclassified 910
113 Ga0075430_101117479 3300006846 Unclassified 649
114 Ga0075433_10000496 3300006852 Bacteria 25626
115 Ga0075433_10065177 3300006852 Bacteria 3195
116 Ga0075433_10967463 3300006852 Bacteria 742
117 Ga0075434_100007441 3300006871 Bacteria 10129
118 Ga0075434_100022419 3300006871 Bacteria 6151
119 Ga0075434_100152138 3300006871 Bacteria 2334
120 Ga0075434_100540066 3300006871 Bacteria 1186
121 Ga0075429_100000121 3300006880 Bacteria 45679
122 Ga0075429_100500343 3300006880 Bacteria 1065
123 Ga0068865_100001679 3300006881 Bacteria 12960
124 Ga0075436_100004877 3300006914 Bacteria 9222
125 Ga0075436_100007640 3300006914 Bacteria 7386
126 Ga0075436_100019372 3300006914 Bacteria 4663
127 Ga0075436_100019533 3300006914 Bacteria 4643
128 Ga0075436_100270189 3300006914 Bacteria 1214
129 Ga0097620_100004135 3300006931 Bacteria 14814
130 Ga0097620_100277597 3300006931 Bacteria 1768
131 Ga0075435_100000808 3300007076 Bacteria 19486
132 Ga0075435_100035448 3300007076 Bacteria 3960
133 Ga0075435_101027696 3300007076 Bacteria 720
134 Ga0099794_10228060 3300007265 Bacteria 958
135 Ga0105250_10294990 3300009092 Bacteria 700
136 Ga0111539_10011015 3300009094 Bacteria 11383
137 Ga0111539_10021238 3300009094 Bacteria 7993
138 Ga0111539_10129258 3300009094 Bacteria 2958
139 Ga0105245_10006327 3300009098 Bacteria 10418
140 Ga0105245_10888703 3300009098 Bacteria 932
141 Ga0114129_10000140 3300009147 Bacteria 75593
142 Ga0114129_10057107 3300009147 Bacteria 5464
143 Ga0114129_10203742 3300009147 Bacteria 2678
144 Ga0114129_11452947 3300009147 Unclassified 844
145 Ga0105243_10001708 3300009148 Bacteria 18921
146 Ga0105241_10584155 3300009174 Bacteria 1007
147 Ga0105242_10000703 3300009176 Bacteria 26168
148 Ga0105242_10227952 3300009176 Bacteria 1668
149 Ga0105248_10083010 3300009177 Bacteria 3604
150 Ga0105248_10893060 3300009177 Unclassified 1003
151 Ga0105237_11706497 3300009545 Bacteria 637
152 Ga0105249_10003012 3300009553 Bacteria 14533
153 Ga0105249_12644386 3300009553 Bacteria 574
154 Ga0099796_10220008 3300010159 Bacteria 778
155 Ga0105239_10049925 3300010375 Bacteria 4588
156 Ga0105239_11682078 3300010375 Unclassified 734
157 Ga0105246_10075054 3300011119 Bacteria 2393
158 Ga0157371_10235480 3300013102 Bacteria 1316
159 Ga0157374_10357511 3300013296 Bacteria 1452
160 Ga0157378_10052844 3300013297 Bacteria 3615
161 Ga0163162_10722978 3300013306 Bacteria 1116
162 Ga0157375_10465820 3300013308 Bacteria 1429
163 Ga0157380_11319996 3300014326 Bacteria 769
164 Ga0157377_10375928 3300014745 Bacteria 960
165 Ga0157376_10013539 3300014969 Bacteria 6091
166 Ga0157376_10154862 3300014969 Bacteria 2071
167 Ga0157376_13002049 3300014969 Unclassified 511
168 Ga0213871_10090604 3300021441 Unclassified 886
169 Ga0207653_10018040 3300025885 Bacteria 2223
170 Ga0207642_10001059 3300025899 Bacteria 8533
171 Ga0207688_10368256 3300025901 Bacteria 887
172 Ga0207685_10213814 3300025905 Bacteria 913
173 Ga0207685_10367736 3300025905 Unclassified 729
174 Ga0207643_10133767 3300025908 Bacteria 1477
175 Ga0207684_10074098 3300025910 Bacteria 2892
176 Ga0207654_11222759 3300025911 Bacteria 548
177 Ga0207707_10083467 3300025912 Bacteria 2790
178 Ga0207707_10631688 3300025912 Bacteria 904
179 Ga0207693_10510386 3300025915 Bacteria 938
180 Ga0207660_10020295 3300025917 Bacteria 4456
181 Ga0207662_10000993 3300025918 Bacteria 13238
182 Ga0207662_10020347 3300025918 Bacteria 3786
183 Ga0207662_11000531 3300025918 Unclassified 593
184 Ga0207646_10396651 3300025922 Bacteria 1246
185 Ga0207646_11565605 3300025922 Unclassified 569
186 Ga0207687_10204975 3300025927 Bacteria 1544
187 Ga0207700_10428002 3300025928 Bacteria 1164
188 Ga0207686_10007801 3300025934 Bacteria 5770
189 Ga0207686_10332571 3300025934 Bacteria 1138
190 Ga0207709_10001744 3300025935 Bacteria 14631
191 Ga0207709_11097817 3300025935 Bacteria 653
192 Ga0207670_10002341 3300025936 Bacteria 9929
193 Ga0207670_10075047 3300025936 Bacteria 2349
194 Ga0207670_10172017 3300025936 Bacteria 1625
195 Ga0207670_10225645 3300025936 Bacteria 1436
196 Ga0207669_10494705 3300025937 Bacteria 977
197 Ga0207704_10028217 3300025938 Bacteria 3110
198 Ga0207691_11325723 3300025940 Bacteria 594
199 Ga0207711_10068688 3300025941 Bacteria 3070
200 Ga0207689_10002082 3300025942 Bacteria 18876
201 Ga0207661_10215019 3300025944 Bacteria 1696
202 Ga0207667_10118069 3300025949 Bacteria 2734
203 Ga0207667_10823388 3300025949 Bacteria 924
204 Ga0207651_10685168 3300025960 Bacteria 902
205 Ga0207712_10015318 3300025961 Bacteria 4943
206 Ga0207640_10017445 3300025981 Bacteria 4200
207 Ga0207658_12171757 3300025986 Bacteria 504
208 Ga0207677_10063377 3300026023 Bacteria 2569
209 Ga0207677_11747547 3300026023 Bacteria 577
210 Ga0207703_10023007 3300026035 Bacteria 4892
211 Ga0207703_10107973 3300026035 Bacteria 2370
212 Ga0207703_10232947 3300026035 Bacteria 1652
213 Ga0207639_10826144 3300026041 Bacteria 864
214 Ga0207708_10003381 3300026075 Bacteria 11762
215 Ga0207708_10384738 3300026075 Bacteria 1157
216 Ga0207702_10069665 3300026078 Bacteria 3024
217 Ga0207702_10115816 3300026078 Bacteria 2391
218 Ga0207702_10252922 3300026078 Bacteria 1655
219 Ga0207641_10059939 3300026088 Bacteria 3243
220 Ga0207641_10704053 3300026088 Unclassified 995
221 Ga0207648_10000171 3300026089 Bacteria 67246
222 Ga0207675_100000321 3300026118 Bacteria 45579
223 Ga0209967_1001457 3300027364 Bacteria 3033
224 Ga0209981_1006155 3300027378 Bacteria 1603
225 Ga0210000_1000915 3300027462 Bacteria 4112
226 Ga0209971_1057190 3300027682 Bacteria 943
227 Ga0209966_1006295 3300027695 Bacteria 2057
228 Ga0209966_1088827 3300027695 Unclassified 690
229 Ga0209974_10037149 3300027876 Bacteria 1617
230 Ga0207428_10000544 3300027907 Bacteria 44950
231 Ga0207428_10101856 3300027907 Bacteria 2218
232 Ga0207428_10221371 3300027907 Bacteria 1418
233 Ga0268265_10013266 3300028380 Bacteria 5599
234 Ga0268265_10918834 3300028380 Bacteria 860
235 Ga0268265_11424454 3300028380 Bacteria 695
236 Ga0268264_10000745 3300028381 Bacteria 36883
237 Ga0307408_101638996 3300031548 Bacteria 612
238 Ga0316575_10071029 3300031665 Bacteria 1398
239 Ga0316579_10032127 3300031691 Bacteria 2406
240 Ga0316578_10083273 3300031728 Bacteria 1905
241 Ga0307416_100188388 3300032002 Bacteria 1942
242 Ga0307411_10462254 3300032005 Bacteria 1064
243 Ga0316583_10005541 3300032133 Bacteria 4531
244 Ga0373930_0023791 3300034816 Bacteria 1220
245 Ga0373950_0018851 3300034818 Bacteria 1200
246 Ga0373926_0002730 3300035083 Bacteria 5629
247 Ga0373929_0008931 3300035085 Bacteria 1852
248 Ga0373929_0033815 3300035085 Bacteria 1106
249 Ga0373929_0140762 3300035085 Unclassified 640
250 Ga0373934_0003344 3300035086 Bacteria 5877
251 Ga0373940_0011130 3300035088 Bacteria 2130
252 Ga0373944_0003299 3300035089 Bacteria 4155
253 Ga0373949_0002521 3300035090 Bacteria 4666
254 Ga0373952_0012282 3300035092 Bacteria 1682
255 Ga0373923_0116168 3300035111 Bacteria 1192
256 Ga0373932_0017089 3300035112 Bacteria 1858
257 Ga0373939_0266008 3300035114 Bacteria 672
258 Ga0373941_0495387 3300035115 Unclassified 519
259 Ga0373945_0016830 3300035116 Bacteria 2471
260 Ga0373953_0106823 3300035117 Bacteria 1181
261 Ga0373953_0204224 3300035117 Unclassified 855
262 Ga0373953_0499891 3300035117 Bacteria 539
263 Ga0373954_0000001 3300035118 Bacteria 158201
264 Ga0373954_0184972 3300035118 Bacteria 1022
265 Ga0373956_0039456 3300035119 Bacteria 2093
266 Ga0373956_0267852 3300035119 Bacteria 813
267 Ga0373956_0366285 3300035119 Bacteria 687
268 Ga0373957_0024725 3300035120 Bacteria 2159
269 Ga0373957_0550894 3300035120 Unclassified 504
270 Ga0373943_0097393 3300035170 Bacteria 1532
271 Ga0373943_0107759 3300035170 Bacteria 1465
272 Ga0373946_0015100 3300035171 Bacteria 2922
273 Ga0373955_0013563 3300035172 Bacteria 3945
274 Ga0373955_0142567 3300035172 Bacteria 1406
275 Ga0373955_0204507 3300035172 Bacteria 1176
276 Ga0373961_0009693 3300035241 Bacteria 2360
277 Ga0373962_0252629 3300035242 Bacteria 612
278 Ga0316574_0796490 3300035398 Bacteria 575
279 Ga0373924_0009847 3300035410 Bacteria 3513
280 Ga0373924_0050300 3300035410 Bacteria 1726
281 Ga0373931_0000474 3300035691 Bacteria 16364
282 Ga0373931_0020186 3300035691 Bacteria 3331
283 Ga0373931_0077001 3300035691 Bacteria 1833
284 Ga0373931_0599983 3300035691 Bacteria 720
285 Ga0373935_0035605 3300035692 Bacteria 3107
286 Ga0373935_0523545 3300035692 Unclassified 862
287 Ga0373935_1084188 3300035692 Bacteria 596
288 Ga0373927_0013771 3300035695 Bacteria 5367
289 Ga0373927_0271802 3300035695 Bacteria 1114
290 Ga0373933_0002321 3300035724 Bacteria 10800
291 Ga0373933_0005099 3300035724 Bacteria 7165
292 Ga0373933_0166888 3300035724 Bacteria 1400
293 Ga0373933_0662960 3300035724 Bacteria 686
294 Ga0373947_0170075 3300035725 Bacteria 1413
295 Ga0373947_0357527 3300035725 Unclassified 980
296 Ga0373937_0002024 3300036401 Bacteria 16919
297 Ga0373937_0024411 3300036401 Bacteria 5453
298 Ga0373937_0104509 3300036401 Bacteria 2631
299 Ga0373937_0527042 3300036401 Bacteria 1122
300 Ga0316582_0004025 3300036647 Bacteria 7346
301 Ga0316584_0274873 3300036712 Bacteria 1225
302 Ga0373925_0036088 3300037068 Bacteria 3649
303 Ga0373925_0651973 3300037068 Unclassified 867
304 Ga0316581_0032114 3300037588 Bacteria 1583
305 Ga0436360_1181460 3300039438 Bacteria 1976
306 Ga0439436_0099134 3300041404 Bacteria 812
307 Ga0439438_091025 3300041405 Bacteria 743
308 Ga0439453_0021828 3300041408 Bacteria 1157
309 Ga0439461_0000947 3300041410 Bacteria 4347
310 Ga0451807_1260896 3300041486 Bacteria 2152
311 Ga0439441_001825 3300042001 Bacteria 2890
312 Ga0439443_011957 3300042003 Bacteria 1279
313 Ga0439456_138391 3300042013 Unclassified 564
314 Ga0439446_0108465 3300042156 Unclassified 884
315 Ga0439434_0000266 3300042435 Bacteria 14813
316 Ga0439435_0000003 3300042436 Bacteria 29035
317 Ga0439444_0004987 3300042437 Bacteria 1953
318 Ga0439460_0002261 3300042461 Bacteria 4632
319 Ga0450916_059353 3300042530 Unclassified 619
320 Ga0451577_2016617 3300042876 Unclassified 504
321 Ga0466960_0517531 3300044901 Bacteria 701
322 Ga0466960_0893329 3300044901 Bacteria 542
323 Ga0451576_0012118 3300045051 Bacteria 9726
324 Ga0451576_0037187 3300045051 Bacteria 5156
325 Ga0451576_0101679 3300045051 Bacteria 2989
326 Ga0495592_0000274 3300046454 Bacteria 44078
327 Ga0495603_0003125 3300046455 Bacteria 9845
328 Ga0495629_0164917 3300046459 Bacteria 1539
329 Ga0495651_0713272 3300046462 Bacteria 624
330 Ga0495653_0256126 3300046463 Bacteria 1159
331 Ga0495580_0017287 3300046472 Bacteria 5397
332 Ga0495582_0144306 3300046473 Bacteria 1350
333 Ga0495582_0171182 3300046473 Bacteria 1236
334 Ga0495639_0025562 3300046475 Bacteria 2605
335 Ga0495639_0060897 3300046475 Bacteria 1730
336 Ga0495662_0015364 3300046476 Bacteria 3718
337 Ga0495662_0031701 3300046476 Bacteria 2553
338 Ga0495664_0420110 3300046477 Bacteria 802
339 Ga0495608_0013519 3300046511 Bacteria 5661
340 Ga0495608_0477174 3300046511 Unclassified 757
341 Ga0495618_0008843 3300046514 Bacteria 6082
342 Ga0495628_0000155 3300046516 Bacteria 59667
343 Ga0495630_0001341 3300046517 Bacteria 16911
344 Ga0495666_0008802 3300046526 Bacteria 5056
345 Ga0495652_0165973 3300046529 Bacteria 1709
346 Ga0495652_0205117 3300046529 Bacteria 1493
347 Ga0495652_0279301 3300046529 Bacteria 1224
348 Ga0495640_0000470 3300046533 Bacteria 29526
349 Ga0495640_0017100 3300046533 Bacteria 5412
350 Ga0495586_0003028 3300046535 Bacteria 9061
351 Ga0495587_0032560 3300046536 Bacteria 3151
352 Ga0495598_0005928 3300046537 Bacteria 2734
353 Ga0495645_0033726 3300046543 Bacteria 3735
354 Ga0495622_0433134 3300046557 Bacteria 565
355 Ga0495667_0001302 3300046559 Bacteria 16361
356 Ga0495667_0080091 3300046559 Bacteria 2123
357 Ga0495667_0220656 3300046559 Bacteria 1210
358 Ga0495656_0226191 3300046615 Bacteria 937
359 Ga0495634_0003300 3300046642 Bacteria 13011
360 Ga0495635_0010007 3300046663 Bacteria 6631
361 Ga0495635_0019885 3300046663 Bacteria 4679
362 Ga0495635_0076184 3300046663 Bacteria 2299
363 Ga0495599_0003173 3300046678 Bacteria 9574
364 Ga0495647_0037753 3300046681 Bacteria 1824
365 Ga0495647_0121944 3300046681 Bacteria 1097
366 Ga0495658_0012227 3300046683 Bacteria 4339
367 Ga0495613_0000960 3300046689 Bacteria 22044
368 Ga0495613_0743928 3300046689 Bacteria 643
369 Ga0495624_0025098 3300046690 Bacteria 3917
370 Ga0495600_0015921 3300046809 Bacteria 4764
371 Ga0495604_0001586 3300047317 Bacteria 18731
372 Ga0495604_0158670 3300047317 Bacteria 1600
373 Ga0495604_0874054 3300047317 Unclassified 563
374 Ga0495636_0000352 3300047318 Bacteria 17535
375 Ga0495674_0175309 3300047319 Bacteria 1787
376 Ga0495674_0788972 3300047319 Bacteria 740
377 Ga0495676_0094476 3300047321 Bacteria 2227
378 Ga0495680_0000202 3300047322 Bacteria 64368
379 Ga0495680_0079858 3300047322 Bacteria 2473
380 Ga0495680_0427565 3300047322 Unclassified 910
381 Ga0495684_1023274 3300047471 Unclassified 523
382 Ga0495593_0236526 3300047673 Bacteria 915
383 Ga0495593_0249881 3300047673 Bacteria 888
384 Ga0496106_0632025 3300048909 Bacteria 856
385 Ga0496112_1512049 3300048915 Unclassified 585
386 Ga0496114_0523027 3300048917 Bacteria 1049
387 Ga0501299_203090 3300049522 Unclassified 527
388 Ga0501031_0103606 3300049568 Bacteria 1857
389 Ga0501031_1041512 3300049568 Unclassified 523
390 Ga0501033_0134818 3300049570 Bacteria 1787
391 Ga0501036_0643062 3300049572 Unclassified 878
392 Ga0501036_0848822 3300049572 Bacteria 751
393 Ga0501036_1675428 3300049572 Unclassified 513
394 Ga0501038_0033404 3300049574 Bacteria 4533
395 Ga0501038_0344208 3300049574 Bacteria 1162
396 Ga0501039_0016663 3300049575 Bacteria 5629
397 Ga0501039_0035648 3300049575 Bacteria 3840
398 Ga0501039_0119010 3300049575 Bacteria 2069
399 Ga0501040_0001554 3300049576 Bacteria 14605
400 Ga0501040_0031718 3300049576 Bacteria 3573
401 Ga0501040_0897749 3300049576 Bacteria 642
402 Ga0501041_0007932 3300049577 Bacteria 6242
403 Ga0501041_0047670 3300049577 Bacteria 2608
404 Ga0501041_1094370 3300049577 Unclassified 514
405 Ga0501042_0071446 3300049578 Bacteria 2483
406 Ga0501042_0578817 3300049578 Bacteria 816
407 Ga0501046_0132752 3300049580 Bacteria 1888
408 Ga0501046_0323493 3300049580 Bacteria 1123
409 Ga0501048_0007565 3300049582 Bacteria 8236
410 Ga0501048_0024128 3300049582 Bacteria 4441
411 Ga0501071_0317387 3300049587 Bacteria 1183
412 Ga0501071_1274409 3300049587 Bacteria 568
413 Ga0501072_0020854 3300049588 Bacteria 5080
414 Ga0501072_0039913 3300049588 Bacteria 3685
415 Ga0501072_0251037 3300049588 Bacteria 1409
416 Ga0501074_0031021 3300049590 Bacteria 3873
417 Ga0501074_0070493 3300049590 Bacteria 2513
418 Ga0501075_0006283 3300049591 Bacteria 8164
419 Ga0501075_0159503 3300049591 Bacteria 1720
420 Ga0501076_0056882 3300049592 Bacteria 3104
421 Ga0501076_0128473 3300049592 Bacteria 2054
422 Ga0501077_0004607 3300049593 Bacteria 8371
423 Ga0501216_087676 3300049660 Unclassified 668
424 Ga0501233_151246 3300049668 Unclassified 648
425 Ga0501079_0004381 3300049741 Bacteria 10458
426 Ga0501080_0100154 3300049742 Bacteria 2688
427 Ga0501081_0000975 3300049743 Bacteria 17007
428 Ga0501081_0027284 3300049743 Bacteria 3852
429 Ga0501083_0203172 3300049744 Bacteria 1292
430 Ga0501035_0227357 3300049822 Bacteria 1591
431 Ga0501045_0028724 3300049824 Bacteria 4013
432 Ga0501045_0041550 3300049824 Bacteria 3346
433 nmdc:mga03683_439208_c1 3300050489 Bacteria 627
434 nmdc:mga05p37_1258557_c1 3300050507 Unclassified 758
435 nmdc:mga05p37_137_c1 3300050507 Bacteria 67873
436 nmdc:mga05p37_488438_c1 3300050507 Bacteria 1416
437 nmdc:mga05p37_914645_c1 3300050507 Unclassified 944
438 nmdc:mga09592_1371_c1 3300050508 Bacteria 19521
439 nmdc:mga09592_1748505_c1 3300050508 Unclassified 500
440 nmdc:mga09592_198207_c1 3300050508 Bacteria 1739
441 nmdc:mga09592_295617_c1 3300050508 Bacteria 1404
442 nmdc:mga0qj67_363565_c1 3300050509 Unclassified 1169
443 nmdc:mga0qj67_457506_c1 3300050509 Bacteria 1028
444 nmdc:mga0qj67_772269_c1 3300050509 Bacteria 762
445 nmdc:mga06r32_259159_c1 3300050510 Bacteria 1727
446 nmdc:mga06r32_504105_c1 3300050510 Bacteria 1187
447 nmdc:mga08y16_12448_c1 3300050511 Bacteria 8950
448 nmdc:mga08y16_1517_c1 3300050511 Bacteria 23363
449 nmdc:mga08y16_45414_c1 3300050511 Bacteria 4603
450 nmdc:mga0n895_1161146_c1 3300050512 Bacteria 747
451 nmdc:mga0n895_134_c1 3300050512 Bacteria 44336
452 nmdc:mga0n895_15290_c1 3300050512 Bacteria 6992
453 nmdc:mga0n895_178188_c1 3300050512 Bacteria 2156
454 nmdc:mga0n895_225358_c1 3300050512 Bacteria 1903
455 nmdc:mga0n895_313882_c1 3300050512 Bacteria 1589
456 nmdc:mga0rr50_1316109_c1 3300050513 Unclassified 613
457 nmdc:mga0rr50_194086_c1 3300050513 Bacteria 1665
458 nmdc:mga0rr50_291066_c1 3300050513 Bacteria 1365
459 nmdc:mga0rr50_3607_c1 3300050513 Bacteria 8947
460 nmdc:mga08x19_102325_c1 3300050514 Bacteria 1902
461 nmdc:mga08x19_17452_c1 3300050514 Bacteria 4391
462 nmdc:mga08x19_2898_c1 3300050514 Bacteria 10326
463 nmdc:mga08x19_3053_c1 3300050514 Bacteria 10064
464 nmdc:mga08x19_420452_c1 3300050514 Bacteria 939
465 nmdc:mga08x19_91342_c1 3300050514 Bacteria 2010
466 nmdc:mga0a205_223661_c1 3300050515 Bacteria 1767
467 nmdc:mga0a205_8520_c1 3300050515 Bacteria 9325
468 nmdc:mga0a205_876004_c1 3300050515 Bacteria 745
469 Ga0495601_0001838 3300053077 Bacteria 11791
470 Ga0495619_0242041 3300053085 Bacteria 1250
471 Ga0501084_0009678 3300054114 Bacteria 7971
472 Ga0501084_0258175 3300054114 Bacteria 1471
473 Ga0501082_0096017 3300060353 Bacteria 2562
474 Ga0501082_0378842 3300060353 Bacteria 1234
475 Ga0530510_0000264 3300061734 Bacteria 33162
476 Ga0070689_100050986
477 Ga0065715_10610795
478 Ga0070683_100191085
479 Ga0070690_101288534
480 Ga0068869_100001790
481 Ga0070680_100009580
482 Ga0070682_100067321
483 Ga0068868_100015142
484 Ga0068868_101176093
485 Ga0070689_100000354
486 Ga0070689_100179743
487 Ga0070689_100207302
488 Ga0070689_101577004
489 Ga0070691_10001025
490 Ga0070691_10362200
491 Ga0070691_10532147
492 Ga0070687_100000710
493 Ga0070687_100044548
494 Ga0070687_101290335
495 Ga0070692_10216317
496 Ga0070692_10279581
497 Ga0070675_100798998
498 Ga0070674_100276893
499 Ga0070673_100304511
500 Ga0070688_100166888
501 Ga0070703_10006186
502 Ga0070710_10553129
503 Ga0070701_10000907
504 Ga0070701_10439694
505 Ga0070705_100000902
506 Ga0070705_100018068
507 Ga0070700_100015380
508 Ga0070700_100756537
509 Ga0070700_101223150
510 Ga0070694_100001920
511 Ga0070694_100097732
512 Ga0070694_100099062
513 Ga0070694_100115709
514 Ga0070708_100176550
515 Ga0070681_10109171
516 Ga0070681_10676740
517 Ga0068867_100000656
518 Ga0070685_11037130
519 Ga0070706_100032346
520 Ga0070707_101153497
521 Ga0070699_100008087
522 Ga0070699_100022732
523 Ga0070699_100298934
524 Ga0070699_102227877
525 Ga0070684_100728932
526 Ga0070684_100932422
527 Ga0070697_100005347
528 Ga0070697_100021112
529 Ga0070697_100577440
530 Ga0070697_100889286
531 Ga0068853_101071231
532 Ga0070686_100000107
533 Ga0070686_100241382
534 Ga0070695_100001550
535 Ga0070695_100047842
536 Ga0070695_100050036
537 Ga0070695_100145042
538 Ga0070695_100189347
539 Ga0070696_100002104
540 Ga0070696_100025195
541 Ga0070696_100052874
542 Ga0070693_100000606
543 Ga0070693_101326684
544 Ga0070704_100000347
545 Ga0070704_100409528
546 Ga0068855_100004392
547 Ga0068855_100373055
548 Ga0070664_100704044
549 Ga0068854_100037770
550 Ga0068854_100258513
551 Ga0068856_100019751
552 Ga0068856_100093411
553 Ga0068856_100115404
554 Ga0070702_100000219
555 Ga0070702_100100019
556 Ga0070702_100497998
557 Ga0070702_100528924
558 Ga0068852_100141209
559 Ga0068859_100004135
560 Ga0068859_100277592
561 Ga0068864_100359865
562 Ga0068864_101146724
563 Ga0068866_10000328
564 Ga0068861_100032569
565 Ga0068870_10157723
566 Ga0068863_100131990
567 Ga0068863_100858432
568 Ga0068858_100000324
569 Ga0068858_100236612
570 Ga0068860_100000836
571 Ga0068860_101012935
572 Ga0068862_100025993
573 Ga0068862_100932720
574 Ga0068862_100995430
575 Ga0081539_10000188
576 Ga0070715_10021589
577 Ga0070712_100718625
578 Ga0075362_10147041
579 Ga0097621_100004271
580 Ga0097621_100029516
581 Ga0097621_100700006
582 Ga0068871_100012982
583 Ga0068871_100042805
584 Ga0075428_100035134
585 Ga0075428_101011566
586 Ga0075430_100098829
587 Ga0075430_100598232
588 Ga0075430_101117479
589 Ga0075433_10000496
590 Ga0075433_10065177
591 Ga0075433_10967463
592 Ga0075434_100007441
593 Ga0075434_100022419
594 Ga0075434_100152138
595 Ga0075434_100540066
596 Ga0075429_100000121
597 Ga0075429_100500343
598 Ga0068865_100001679
599 Ga0075436_100004877
600 Ga0075436_100007640
601 Ga0075436_100019372
602 Ga0075436_100019533
603 Ga0075436_100270189
604 Ga0097620_100004135
605 Ga0097620_100277597
606 Ga0075435_100000808
607 Ga0075435_100035448
608 Ga0075435_101027696
609 Ga0099794_10228060
610 Ga0105250_10294990
611 Ga0111539_10011015
612 Ga0111539_10021238
613 Ga0111539_10129258
614 Ga0105245_10006327
615 Ga0105245_10888703
616 Ga0114129_10000140
617 Ga0114129_10057107
618 Ga0114129_10203742
619 Ga0114129_11452947
620 Ga0105243_10001708
621 Ga0105241_10584155
622 Ga0105242_10000703
623 Ga0105242_10227952
624 Ga0105248_10083010
625 Ga0105248_10893060
626 Ga0105237_11706497
627 Ga0105249_10003012
628 Ga0105249_12644386
629 Ga0099796_10220008
630 Ga0105239_10049925
631 Ga0105239_11682078
632 Ga0105246_10075054
633 Ga0157371_10235480
634 Ga0157374_10357511
635 Ga0157378_10052844
636 Ga0163162_10722978
637 Ga0157375_10465820
638 Ga0157380_11319996
639 Ga0157377_10375928
640 Ga0157376_10013539
641 Ga0157376_10154862
642 Ga0157376_13002049
643 Ga0213871_10090604
644 Ga0207653_10018040
645 Ga0207642_10001059
646 Ga0207688_10368256
647 Ga0207685_10213814
648 Ga0207685_10367736
649 Ga0207643_10133767
650 Ga0207684_10074098
651 Ga0207654_11222759
652 Ga0207707_10083467
653 Ga0207707_10631688
654 Ga0207693_10510386
655 Ga0207660_10020295
656 Ga0207662_10000993
657 Ga0207662_10020347
658 Ga0207662_11000531
659 Ga0207646_10396651
660 Ga0207646_11565605
661 Ga0207687_10204975
662 Ga0207700_10428002
663 Ga0207686_10007801
664 Ga0207686_10332571
665 Ga0207709_10001744
666 Ga0207709_11097817
667 Ga0207670_10002341
668 Ga0207670_10075047
669 Ga0207670_10172017
670 Ga0207670_10225645
671 Ga0207669_10494705
672 Ga0207704_10028217
673 Ga0207691_11325723
674 Ga0207711_10068688
675 Ga0207689_10002082
676 Ga0207661_10215019
677 Ga0207667_10118069
678 Ga0207667_10823388
679 Ga0207651_10685168
680 Ga0207712_10015318
681 Ga0207640_10017445
682 Ga0207658_12171757
683 Ga0207677_10063377
684 Ga0207677_11747547
685 Ga0207703_10023007
686 Ga0207703_10107973
687 Ga0207703_10232947
688 Ga0207639_10826144
689 Ga0207708_10003381
690 Ga0207708_10384738
691 Ga0207702_10069665
692 Ga0207702_10115816
693 Ga0207702_10252922
694 Ga0207641_10059939
695 Ga0207641_10704053
696 Ga0207648_10000171
697 Ga0207675_100000321
698 Ga0209967_1001457
699 Ga0209981_1006155
700 Ga0210000_1000915
701 Ga0209971_1057190
702 Ga0209966_1006295
703 Ga0209966_1088827
704 Ga0209974_10037149
705 Ga0207428_10000544
706 Ga0207428_10101856
707 Ga0207428_10221371
708 Ga0268265_10013266
709 Ga0268265_10918834
710 Ga0268265_11424454
711 Ga0268264_10000745
712 Ga0307408_101638996
713 Ga0316575_10071029
714 Ga0316579_10032127
715 Ga0316578_10083273
716 Ga0307416_100188388
717 Ga0307411_10462254
718 Ga0316583_10005541
719 Ga0373930_0023791
720 Ga0373950_0018851
721 Ga0373926_0002730
722 Ga0373929_0008931
723 Ga0373929_0033815
724 Ga0373929_0140762
725 Ga0373934_0003344
726 Ga0373940_0011130
727 Ga0373944_0003299
728 Ga0373949_0002521
729 Ga0373952_0012282
730 Ga0373923_0116168
731 Ga0373932_0017089
732 Ga0373939_0266008
733 Ga0373941_0495387
734 Ga0373945_0016830
735 Ga0373953_0106823
736 Ga0373953_0204224
737 Ga0373953_0499891
738 Ga0373954_0000001
739 Ga0373954_0184972
740 Ga0373956_0039456
741 Ga0373956_0267852
742 Ga0373956_0366285
743 Ga0373957_0024725
744 Ga0373957_0550894
745 Ga0373943_0097393
746 Ga0373943_0107759
747 Ga0373946_0015100
748 Ga0373955_0013563
749 Ga0373955_0142567
750 Ga0373955_0204507
751 Ga0373961_0009693
752 Ga0373962_0252629
753 Ga0316574_0796490
754 Ga0373924_0009847
755 Ga0373924_0050300
756 Ga0373931_0000474
757 Ga0373931_0020186
758 Ga0373931_0077001
759 Ga0373931_0599983
760 Ga0373935_0035605
761 Ga0373935_0523545
762 Ga0373935_1084188
763 Ga0373927_0013771
764 Ga0373927_0271802
765 Ga0373933_0002321
766 Ga0373933_0005099
767 Ga0373933_0166888
768 Ga0373933_0662960
769 Ga0373947_0170075
770 Ga0373947_0357527
771 Ga0373937_0002024
772 Ga0373937_0024411
773 Ga0373937_0104509
774 Ga0373937_0527042
775 Ga0316582_0004025
776 Ga0316584_0274873
777 Ga0373925_0036088
778 Ga0373925_0651973
779 Ga0316581_0032114
780 Ga0436360_1181460
781 Ga0439436_0099134
782 Ga0439438_091025
783 Ga0439453_0021828
784 Ga0439461_0000947
785 Ga0451807_1260896
786 Ga0439441_001825
787 Ga0439443_011957
788 Ga0439456_138391
789 Ga0439446_0108465
790 Ga0439434_0000266
791 Ga0439435_0000003
792 Ga0439444_0004987
793 Ga0439460_0002261
794 Ga0450916_059353
795 Ga0451577_2016617
796 Ga0466960_0517531
797 Ga0466960_0893329
798 Ga0451576_0012118
799 Ga0451576_0037187
800 Ga0451576_0101679
801 Ga0495592_0000274
802 Ga0495603_0003125
803 Ga0495629_0164917
804 Ga0495651_0713272
805 Ga0495653_0256126
806 Ga0495580_0017287
807 Ga0495582_0144306
808 Ga0495582_0171182
809 Ga0495639_0025562
810 Ga0495639_0060897
811 Ga0495662_0015364
812 Ga0495662_0031701
813 Ga0495664_0420110
814 Ga0495608_0013519
815 Ga0495608_0477174
816 Ga0495618_0008843
817 Ga0495628_0000155
818 Ga0495630_0001341
819 Ga0495666_0008802
820 Ga0495652_0165973
821 Ga0495652_0205117
822 Ga0495652_0279301
823 Ga0495640_0000470
824 Ga0495640_0017100
825 Ga0495586_0003028
826 Ga0495587_0032560
827 Ga0495598_0005928
828 Ga0495645_0033726
829 Ga0495622_0433134
830 Ga0495667_0001302
831 Ga0495667_0080091
832 Ga0495667_0220656
833 Ga0495656_0226191
834 Ga0495634_0003300
835 Ga0495635_0010007
836 Ga0495635_0019885
837 Ga0495635_0076184
838 Ga0495599_0003173
839 Ga0495647_0037753
840 Ga0495647_0121944
841 Ga0495658_0012227
842 Ga0495613_0000960
843 Ga0495613_0743928
844 Ga0495624_0025098
845 Ga0495600_0015921
846 Ga0495604_0001586
847 Ga0495604_0158670
848 Ga0495604_0874054
849 Ga0495636_0000352
850 Ga0495674_0175309
851 Ga0495674_0788972
852 Ga0495676_0094476
853 Ga0495680_0000202
854 Ga0495680_0079858
855 Ga0495680_0427565
856 Ga0495684_1023274
857 Ga0495593_0236526
858 Ga0495593_0249881
859 Ga0496106_0632025
860 Ga0496112_1512049
861 Ga0496114_0523027
862 Ga0501299_203090
863 Ga0501031_0103606
864 Ga0501031_1041512
865 Ga0501033_0134818
866 Ga0501036_0643062
867 Ga0501036_0848822
868 Ga0501036_1675428
869 Ga0501038_0033404
870 Ga0501038_0344208
871 Ga0501039_0016663
872 Ga0501039_0035648
873 Ga0501039_0119010
874 Ga0501040_0001554
875 Ga0501040_0031718
876 Ga0501040_0897749
877 Ga0501041_0007932
878 Ga0501041_0047670
879 Ga0501041_1094370
880 Ga0501042_0071446
881 Ga0501042_0578817
882 Ga0501046_0132752
883 Ga0501046_0323493
884 Ga0501048_0007565
885 Ga0501048_0024128
886 Ga0501071_0317387
887 Ga0501071_1274409
888 Ga0501072_0020854
889 Ga0501072_0039913
890 Ga0501072_0251037
891 Ga0501074_0031021
892 Ga0501074_0070493
893 Ga0501075_0006283
894 Ga0501075_0159503
895 Ga0501076_0056882
896 Ga0501076_0128473
897 Ga0501077_0004607
898 Ga0501216_087676
899 Ga0501233_151246
900 Ga0501079_0004381
901 Ga0501080_0100154
902 Ga0501081_0000975
903 Ga0501081_0027284
904 Ga0501083_0203172
905 Ga0501035_0227357
906 Ga0501045_0028724
907 Ga0501045_0041550
908 nmdc:mga03683_439208_c1
909 nmdc:mga05p37_1258557_c1
910 nmdc:mga05p37_137_c1
911 nmdc:mga05p37_488438_c1
912 nmdc:mga05p37_914645_c1
913 nmdc:mga09592_1371_c1
914 nmdc:mga09592_1748505_c1
915 nmdc:mga09592_198207_c1
916 nmdc:mga09592_295617_c1
917 nmdc:mga0qj67_363565_c1
918 nmdc:mga0qj67_457506_c1
919 nmdc:mga0qj67_772269_c1
920 nmdc:mga06r32_259159_c1
921 nmdc:mga06r32_504105_c1
922 nmdc:mga08y16_12448_c1
923 nmdc:mga08y16_1517_c1
924 nmdc:mga08y16_45414_c1
925 nmdc:mga0n895_1161146_c1
926 nmdc:mga0n895_134_c1
927 nmdc:mga0n895_15290_c1
928 nmdc:mga0n895_178188_c1
929 nmdc:mga0n895_225358_c1
930 nmdc:mga0n895_313882_c1
931 nmdc:mga0rr50_1316109_c1
932 nmdc:mga0rr50_194086_c1
933 nmdc:mga0rr50_291066_c1
934 nmdc:mga0rr50_3607_c1
935 nmdc:mga08x19_102325_c1
936 nmdc:mga08x19_17452_c1
937 nmdc:mga08x19_2898_c1
938 nmdc:mga08x19_3053_c1
939 nmdc:mga08x19_420452_c1
940 nmdc:mga08x19_91342_c1
941 nmdc:mga0a205_223661_c1
942 nmdc:mga0a205_8520_c1
943 nmdc:mga0a205_876004_c1
944 Ga0495601_0001838
945 Ga0495619_0242041
946 Ga0501084_0009678
947 Ga0501084_0258175
948 Ga0501082_0096017
949 Ga0501082_0378842
950 Ga0530510_0000264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

66

117

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9665 53 107
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.966 53 101
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9607 54 106
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9591 53 101
6b3a-assembly1.cif.gz_A apra methyltransferase 1 - gnat didomain in complex with mn2+ and sam 0.952 59 106
ID Description Score Start End Superfamily
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9741 53 106 1.10.10.10
af_Q2RAU2_5_159_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9624 54 99 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9607 54 106 1.10.10.10
af_A4I3U0_697_766_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9445 54 106 1.10.10.10
af_P76268_11_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.944 53 106 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2M7AFN2-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9865 50 106 GO:0016301
AF-M0ME02-F1-model_v4 DeoR family transcriptional regulator 0.9819 50 107
AF-A0A2U0XS01-F1-model_v4 deleted 0.9797 54 106
AF-A0A7W7QSG6-F1-model_v4 DNA-binding IclR family transcriptional regulator 0.9774 54 106 GO:0003677
GO:0003700
GO:0045892
AF-A0A1R4HVL7-F1-model_v4 Transcriptional regulator, IclR family 0.9759 50 106 GO:0003677
GO:0003700
GO:0045892

Map