F451341

General Info

Members Datasets Scaffolds Average Seq Length
475 243 950 264

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10033386|Ga0157371_100333862
Length 296
Sequence MTPEYRPAGQCRMASFLRKPILMTDIMNSDNATSFAGGKILQSAFEGVGVIAFNNPEKRNAISLEMWEGLGEALTRLRDDPAIRVVILKGAGDKAFVSGADISQFEKERHNAQASEEYANRSAAQRALLANYPKPVIASISGFCLGGGMQIAMSADIRIAADNGQFGIPAARLGIAYGYDGLRNLVSLVGPSQARLLMYTGMRIDADEAARIGLIDRMVPAGDLWAATMDIATTIAGNAPLAVQAAKVTIAEVLKDPGSRDMEAIRRIGTACMDSEDFREGRRAFMEKRKPRFVGK

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
236 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
242 2855730933 Achromobacter sp. HZ28 Isolate Nodule
243 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.21
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0.21
Rhizoplane 2.53
Rhizosphere 93.26
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10033386 3300013102 Bacteria 3698
2 JGI25151J46595_10000658 3300003187 Bacteria 29412
3 JGI25406J46586_10023324 3300003203 Bacteria 2446
4 rootL2_10208257 3300003322 Bacteria 2297
5 JGI25405J52794_10003681 3300003911 Bacteria 2703
6 Ga0058859_10694639 3300004798 Bacteria 1185
7 Ga0070676_10154379 3300005328 Bacteria 1472
8 Ga0070670_100208548 3300005331 Bacteria 1699
9 Ga0070680_100017523 3300005336 Bacteria 5649
10 Ga0070689_100123463 3300005340 Bacteria 2070
11 Ga0070669_100023201 3300005353 Bacteria 4443
12 Ga0070669_100127853 3300005353 Bacteria 1946
13 Ga0070671_100153002 3300005355 Bacteria 1948
14 Ga0070659_100436476 3300005366 Bacteria 1109
15 Ga0070667_100180998 3300005367 Bacteria 1864
16 Ga0070700_100127019 3300005441 Bacteria 1716
17 Ga0070694_100112564 3300005444 Bacteria 1941
18 Ga0070708_100115255 3300005445 Bacteria 2473
19 Ga0070708_100134942 3300005445 Bacteria 2286
20 Ga0070681_10323763 3300005458 Bacteria 1451
21 Ga0070685_10033486 3300005466 Bacteria 2887
22 Ga0070706_100000008 3300005467 Bacteria 225667
23 Ga0070706_100248826 3300005467 Bacteria 1660
24 Ga0070706_100280629 3300005467 Bacteria 1555
25 Ga0070706_100468895 3300005467 Bacteria 1171
26 Ga0070707_100009952 3300005468 Bacteria 8849
27 Ga0070707_100222350 3300005468 Bacteria 1839
28 Ga0070707_100565921 3300005468 Bacteria 1099
29 Ga0070698_100005584 3300005471 Bacteria 13751
30 Ga0070698_100010515 3300005471 Bacteria 9866
31 Ga0070698_100133454 3300005471 Bacteria 2437
32 Ga0070699_100008624 3300005518 Bacteria 8835
33 Ga0070699_100042892 3300005518 Bacteria 3915
34 Ga0070699_100052779 3300005518 Bacteria 3518
35 Ga0070697_100006631 3300005536 Bacteria 8977
36 Ga0070697_100313768 3300005536 Bacteria 1349
37 Ga0070696_100171480 3300005546 Bacteria 1604
38 Ga0070665_100211763 3300005548 Bacteria 1939
39 Ga0068855_100162936 3300005563 Bacteria 2530
40 Ga0068857_100185257 3300005577 Bacteria 1895
41 Ga0068856_100266795 3300005614 Bacteria 1728
42 Ga0068859_100397471 3300005617 Bacteria 1474
43 Ga0068864_100018373 3300005618 Bacteria 5841
44 Ga0068861_100254226 3300005719 Bacteria 1501
45 Ga0068861_100321852 3300005719 Bacteria 1347
46 Ga0068870_10226313 3300005840 Bacteria 1148
47 Ga0068863_100115921 3300005841 Bacteria 2553
48 Ga0068858_100186229 3300005842 Bacteria 1961
49 Ga0068858_100234994 3300005842 Bacteria 1738
50 Ga0068858_100517031 3300005842 Bacteria 1154
51 Ga0068860_100141922 3300005843 Bacteria 2309
52 Ga0068860_100210077 3300005843 Bacteria 1888
53 Ga0068862_100191836 3300005844 Bacteria 1839
54 Ga0068862_100356587 3300005844 Bacteria 1358
55 Ga0081455_10005537 3300005937 Bacteria 13829
56 Ga0081455_10011542 3300005937 Bacteria 8869
57 Ga0081455_10044526 3300005937 Archaea 3870
58 Ga0081455_10158561 3300005937 Bacteria 1737
59 Ga0081455_10379802 3300005937 Bacteria 987
60 Ga0081538_10011727 3300005981 Bacteria 7075
61 Ga0081538_10040150 3300005981 Bacteria 2989
62 Ga0081540_1035582 3300005983 Bacteria 2668
63 Ga0081539_10000020 3300005985 Bacteria 366549
64 Ga0081539_10000606 3300005985 Bacteria 72943
65 Ga0081539_10034736 3300005985 Bacteria 3042
66 Ga0070717_10410973 3300006028 Bacteria 1216
67 Ga0075427_10015083 3300006194 Bacteria 1191
68 Ga0075428_100000420 3300006844 Bacteria 42195
69 Ga0075428_100000707 3300006844 Bacteria 34498
70 Ga0075428_100007106 3300006844 Bacteria 12398
71 Ga0075428_100008704 3300006844 Bacteria 11258
72 Ga0075428_100010843 3300006844 Bacteria 10129
73 Ga0075428_100056229 3300006844 Bacteria 4310
74 Ga0075428_100080325 3300006844 Bacteria 3559
75 Ga0075428_100088549 3300006844 Bacteria 3377
76 Ga0075428_100164914 3300006844 Unclassified 2404
77 Ga0075428_100192620 3300006844 Bacteria 2205
78 Ga0075428_100226746 3300006844 Bacteria 2017
79 Ga0075428_100732933 3300006844 Bacteria 1052
80 Ga0075430_100010107 3300006846 Bacteria 7985
81 Ga0075430_100014263 3300006846 Bacteria 6775
82 Ga0075430_100041107 3300006846 Bacteria 3913
83 Ga0075430_100084905 3300006846 Bacteria 2651
84 Ga0075430_100112071 3300006846 Bacteria 2274
85 Ga0075430_100204928 3300006846 Bacteria 1637
86 Ga0075430_100377099 3300006846 Unclassified 1171
87 Ga0075430_100696446 3300006846 Bacteria 837
88 Ga0075431_100000224 3300006847 Bacteria 42279
89 Ga0075431_100000748 3300006847 Bacteria 28070
90 Ga0075431_100011797 3300006847 Bacteria 8819
91 Ga0075431_100017929 3300006847 Bacteria 7200
92 Ga0075431_100018965 3300006847 Bacteria 7007
93 Ga0075431_100054085 3300006847 Bacteria 4140
94 Ga0075431_100062136 3300006847 Bacteria 3854
95 Ga0075431_100126833 3300006847 Bacteria 2633
96 Ga0075431_100147375 3300006847 Bacteria 2425
97 Ga0075431_100282571 3300006847 Unclassified 1680
98 Ga0075433_10000521 3300006852 Bacteria 25116
99 Ga0075433_10254189 3300006852 Bacteria 1559
100 Ga0075434_100055181 3300006871 Bacteria 3948
101 Ga0075429_100004265 3300006880 Bacteria 12259
102 Ga0075429_100014355 3300006880 Bacteria 6867
103 Ga0075429_100015183 3300006880 Bacteria 6676
104 Ga0075429_100016576 3300006880 Bacteria 6383
105 Ga0075429_100064960 3300006880 Bacteria 3177
106 Ga0075429_100150282 3300006880 Bacteria 2039
107 Ga0068865_100165187 3300006881 Bacteria 1692
108 Ga0075436_100007727 3300006914 Bacteria 7349
109 Ga0075436_100024148 3300006914 Bacteria 4179
110 Ga0075435_100061002 3300007076 Bacteria 3059
111 Ga0099794_10018379 3300007265 Bacteria 3134
112 Ga0111539_10004118 3300009094 Bacteria 19078
113 Ga0111539_10015885 3300009094 Bacteria 9350
114 Ga0105245_10476938 3300009098 Bacteria 1260
115 Ga0114129_10000795 3300009147 Bacteria 40478
116 Ga0114129_10001541 3300009147 Bacteria 31237
117 Ga0114129_10007494 3300009147 Bacteria 15544
118 Ga0114129_10011277 3300009147 Bacteria 12738
119 Ga0114129_10013330 3300009147 Bacteria 11713
120 Ga0114129_10020184 3300009147 Bacteria 9483
121 Ga0114129_10024521 3300009147 Bacteria 8545
122 Ga0114129_10064578 3300009147 Bacteria 5109
123 Ga0114129_10093230 3300009147 Bacteria 4172
124 Ga0114129_10258397 3300009147 Bacteria 2336
125 Ga0114129_10307151 3300009147 Bacteria 2112
126 Ga0114129_10335285 3300009147 Bacteria 2007
127 Ga0114129_10360342 3300009147 Bacteria 1924
128 Ga0105243_10074056 3300009148 Bacteria 2761
129 Ga0105243_10220112 3300009148 Bacteria 1677
130 Ga0105241_10260433 3300009174 Bacteria 1474
131 Ga0105241_10358949 3300009174 Bacteria 1267
132 Ga0105249_10887681 3300009553 Bacteria 958
133 Ga0163162_10522642 3300013306 Bacteria 1316
134 Ga0157375_10211995 3300013308 Bacteria 2094
135 Ga0163163_10159791 3300014325 Bacteria 2298
136 Ga0182008_10262158 3300014497 Bacteria 894
137 Ga0157377_10076193 3300014745 Bacteria 1950
138 Ga0157379_10028024 3300014968 Bacteria 5014
139 Ga0213876_10013031 3300021384 Bacteria 4419
140 Ga0213875_10043005 3300021388 Bacteria 2121
141 Ga0207647_10243364 3300025904 Bacteria 1033
142 Ga0207699_10140599 3300025906 Bacteria 1586
143 Ga0207684_10000029 3300025910 Bacteria 305483
144 Ga0207684_10000408 3300025910 Bacteria 57555
145 Ga0207684_10253229 3300025910 Bacteria 1519
146 Ga0207654_10233698 3300025911 Bacteria 1225
147 Ga0207707_10219518 3300025912 Bacteria 1655
148 Ga0207693_10162483 3300025915 Bacteria 1757
149 Ga0207660_10042964 3300025917 Bacteria 3175
150 Ga0207657_10129409 3300025919 Bacteria 2070
151 Ga0207646_10001585 3300025922 Bacteria 27771
152 Ga0207681_10021006 3300025923 Bacteria 4144
153 Ga0207681_10117648 3300025923 Bacteria 1944
154 Ga0207664_10004305 3300025929 Bacteria 9635
155 Ga0207706_10121885 3300025933 Bacteria 2293
156 Ga0207704_10143531 3300025938 Bacteria 1674
157 Ga0207711_10481354 3300025941 Bacteria 1156
158 Ga0207702_10298482 3300026078 Bacteria 1528
159 Ga0207641_10093183 3300026088 Bacteria 2640
160 Ga0207641_10491035 3300026088 Bacteria 1191
161 Ga0207648_10093064 3300026089 Bacteria 2636
162 Ga0207648_10350880 3300026089 Bacteria 1330
163 Ga0207676_10720149 3300026095 Bacteria 968
164 Ga0207674_10313955 3300026116 Bacteria 1517
165 Ga0207675_100115691 3300026118 Bacteria 2534
166 Ga0207683_10299245 3300026121 Bacteria 1472
167 Ga0209588_1045404 3300027671 Unclassified 1421
168 Ga0207428_10006817 3300027907 Bacteria 10473
169 Ga0207428_10029038 3300027907 Bacteria 4589
170 Ga0207428_10192553 3300027907 Bacteria 1537
171 Ga0268265_10058739 3300028380 Bacteria 2939
172 Ga0268265_10801864 3300028380 Bacteria 918
173 Ga0268264_10118030 3300028381 Bacteria 2334
174 Ga0268264_10147132 3300028381 Bacteria 2108
175 Ga0268264_10252151 3300028381 Bacteria 1640
176 Ga0265319_1039284 3300028563 Bacteria 1605
177 Ga0265334_10020365 3300028573 Bacteria 2717
178 Ga0265336_10003576 3300028666 Bacteria 6069
179 Ga0265324_10021686 3300029957 Bacteria 2301
180 Ga0307511_10016131 3300030521 Bacteria 7216
181 Ga0265328_10071979 3300031239 Bacteria 1271
182 Ga0265339_10000525 3300031249 Bacteria 29987
183 Ga0307408_100014097 3300031548 Bacteria 5311
184 Ga0307408_100029874 3300031548 Bacteria 3780
185 Ga0307408_100427444 3300031548 Bacteria 1144
186 Ga0265314_10001070 3300031711 Bacteria 31767
187 Ga0265342_10042109 3300031712 Bacteria 2761
188 Ga0307406_10133228 3300031901 Bacteria 1748
189 Ga0307407_10160897 3300031903 Bacteria 1469
190 Ga0307407_10468273 3300031903 Bacteria 918
191 Ga0307412_10025009 3300031911 Bacteria 3693
192 Ga0307409_100255845 3300031995 Bacteria 1604
193 Ga0307416_100723321 3300032002 Unclassified 1086
194 Ga0307416_100840299 3300032002 Bacteria 1016
195 Ga0307415_100330175 3300032126 Bacteria 1276
196 Ga0373948_0003126 3300034817 Bacteria 2517
197 Ga0373934_0005731 3300035086 Bacteria 4600
198 Ga0373923_0004994 3300035111 Bacteria 4462
199 Ga0373936_0071179 3300035113 Bacteria 1433
200 Ga0373953_0013471 3300035117 Bacteria 2922
201 Ga0373954_0022424 3300035118 Bacteria 2864
202 Ga0373957_0020587 3300035120 Bacteria 2332
203 Ga0373960_0033548 3300035121 Bacteria 1448
204 Ga0373955_0007236 3300035172 Bacteria 5092
205 Ga0316574_0133035 3300035398 Bacteria 1601
206 Ga0373931_0000019 3300035691 Bacteria 186534
207 Ga0373931_0281582 3300035691 Bacteria 1021
208 Ga0373933_0051428 3300035724 Bacteria 2462
209 Ga0373947_0334351 3300035725 Bacteria 1014
210 Ga0373937_0002675 3300036401 Bacteria 14854
211 Ga0373925_0008737 3300037068 Bacteria 7378
212 Ga0373925_0033857 3300037068 Bacteria 3764
213 Ga0395900_0007310 3300037418 Bacteria 11423
214 Ga0395898_0003128 3300037466 Bacteria 18689
215 Ga0436364_1107886 3300037853 Bacteria 1020
216 Ga0436364_1363204 3300037853 Bacteria 2206
217 Ga0395901_0671278 3300038443 Bacteria 1037
218 Ga0436365_0017693 3300039437 Bacteria 25048
219 Ga0436360_0150690 3300039438 Bacteria 2267
220 Ga0439435_0073503 3300042436 Bacteria 1016
221 Ga0451577_0545288 3300042876 Bacteria 1053
222 Ga0439440_0016921 3300042993 Bacteria 1601
223 Ga0453683_0045517 3300044673 Bacteria 2751
224 Ga0451576_0822843 3300045051 Bacteria 975
225 Ga0466967_0087645 3300045976 Bacteria 2823
226 Ga0466967_0145214 3300045976 Bacteria 2213
227 Ga0495592_0011468 3300046454 Bacteria 6708
228 Ga0495603_0066538 3300046455 Bacteria 2122
229 Ga0495629_0018231 3300046459 Bacteria 5027
230 Ga0495629_0024491 3300046459 Bacteria 4298
231 Ga0495629_0085683 3300046459 Bacteria 2198
232 Ga0495641_0017794 3300046461 Bacteria 3689
233 Ga0495651_0036523 3300046462 Bacteria 3825
234 Ga0495653_0233904 3300046463 Bacteria 1228
235 Ga0495582_0021707 3300046473 Bacteria 3513
236 Ga0495582_0052133 3300046473 Bacteria 2256
237 Ga0495639_0030926 3300046475 Bacteria 2381
238 Ga0495662_0016988 3300046476 Bacteria 3521
239 Ga0495662_0018704 3300046476 Bacteria 3354
240 Ga0495662_0188146 3300046476 Bacteria 1018
241 Ga0495664_0052163 3300046477 Bacteria 2429
242 Ga0495594_0183158 3300046499 Bacteria 1192
243 Ga0495608_0290944 3300046511 Bacteria 1012
244 Ga0495618_0034876 3300046514 Bacteria 3157
245 Ga0495630_0013315 3300046517 Bacteria 5985
246 Ga0495630_0017325 3300046517 Bacteria 5276
247 Ga0495630_0480687 3300046517 Bacteria 952
248 Ga0495666_0207150 3300046526 Bacteria 900
249 Ga0495665_0012259 3300046531 Bacteria 4638
250 Ga0495640_0160593 3300046533 Bacteria 1440
251 Ga0495598_0054796 3300046537 Bacteria 1212
252 Ga0495621_0102917 3300046539 Bacteria 1088
253 Ga0495667_0204963 3300046559 Bacteria 1261
254 Ga0495634_0024065 3300046642 Bacteria 4276
255 Ga0495635_0033659 3300046663 Bacteria 3554
256 Ga0495635_0035189 3300046663 Bacteria 3472
257 Ga0495661_0007336 3300046665 Bacteria 7685
258 Ga0495599_0164059 3300046678 Bacteria 1372
259 Ga0495647_0026389 3300046681 Bacteria 2128
260 Ga0495647_0043764 3300046681 Bacteria 1714
261 Ga0495658_0013408 3300046683 Bacteria 4172
262 Ga0495613_0113152 3300046689 Bacteria 1954
263 Ga0495613_0162909 3300046689 Bacteria 1585
264 Ga0495624_0036308 3300046690 Bacteria 3178
265 Ga0495600_0082913 3300046809 Bacteria 2092
266 Ga0495581_0032738 3300047315 Bacteria 3010
267 Ga0495581_0049449 3300047315 Bacteria 2428
268 Ga0495581_0064544 3300047315 Bacteria 2115
269 Ga0495674_0013967 3300047319 Bacteria 7532
270 Ga0495674_0266499 3300047319 Bacteria 1406
271 Ga0495676_0028659 3300047321 Bacteria 4751
272 Ga0495676_0048096 3300047321 Bacteria 3442
273 Ga0495680_0136674 3300047322 Bacteria 1796
274 Ga0495687_015050 3300047443 Bacteria 3948
275 Ga0495675_0015614 3300047444 Bacteria 4800
276 Ga0495677_0009158 3300047445 Bacteria 3659
277 Ga0495684_0107560 3300047471 Bacteria 2106
278 Ga0495686_0000007 3300047472 Bacteria 732622
279 Ga0495593_0013849 3300047673 Bacteria 4594
280 Ga0495602_0026424 3300048088 Bacteria 5598
281 Ga0495614_0084488 3300048089 Bacteria 1377
282 Ga0496102_0079844 3300048905 Bacteria 3013
283 Ga0496104_0019088 3300048907 Bacteria 6266
284 Ga0496105_0039511 3300048908 Bacteria 3889
285 Ga0496105_0047510 3300048908 Bacteria 3542
286 Ga0496108_0012517 3300048911 Bacteria 6909
287 Ga0496109_0021566 3300048912 Bacteria 5698
288 Ga0496109_0023249 3300048912 Bacteria 5499
289 Ga0496110_0009747 3300048913 Bacteria 7780
290 Ga0496110_0042699 3300048913 Bacteria 3958
291 Ga0496111_0001075 3300048914 Bacteria 15069
292 Ga0496113_0044330 3300048916 Bacteria 3295
293 Ga0496113_0061686 3300048916 Bacteria 2829
294 Ga0496118_0086717 3300048921 Bacteria 2174
295 Ga0496120_0083134 3300048923 Bacteria 1729
296 Ga0496121_0003633 3300048924 Bacteria 21728
297 Ga0496126_0111649 3300048929 Bacteria 2381
298 Ga0501031_0046809 3300049568 Bacteria 2820
299 Ga0501032_0000086 3300049569 Bacteria 81788
300 Ga0501032_0000829 3300049569 Bacteria 25098
301 Ga0501033_0000116 3300049570 Bacteria 76410
302 Ga0501034_0000108 3300049571 Bacteria 152258
303 Ga0501034_0357604 3300049571 Bacteria 1387
304 Ga0501036_0000065 3300049572 Bacteria 68031
305 Ga0501036_0048132 3300049572 Bacteria 3610
306 Ga0501037_0000173 3300049573 Bacteria 61084
307 Ga0501037_0035153 3300049573 Bacteria 3696
308 Ga0501037_0147854 3300049573 Bacteria 1680
309 Ga0501038_0000416 3300049574 Bacteria 36963
310 Ga0501038_0025824 3300049574 Bacteria 5233
311 Ga0501039_0000265 3300049575 Bacteria 38188
312 Ga0501039_0128579 3300049575 Bacteria 1988
313 Ga0501040_0031717 3300049576 Bacteria 3573
314 Ga0501040_0204672 3300049576 Unclassified 1402
315 Ga0501041_0083743 3300049577 Bacteria 1966
316 Ga0501042_0122910 3300049578 Bacteria 1869
317 Ga0501042_0137417 3300049578 Bacteria 1762
318 Ga0501042_0160599 3300049578 Bacteria 1621
319 Ga0501042_0396251 3300049578 Unclassified 1000
320 Ga0501043_0000226 3300049579 Bacteria 51303
321 Ga0501043_0029080 3300049579 Bacteria 4340
322 Ga0501046_0002306 3300049580 Bacteria 17989
323 Ga0501046_0162793 3300049580 Bacteria 1677
324 Ga0501047_0000325 3300049581 Bacteria 55223
325 Ga0501047_0003421 3300049581 Bacteria 15008
326 Ga0501047_0055524 3300049581 Bacteria 3830
327 Ga0501047_0330796 3300049581 Unclassified 1362
328 Ga0501048_0000202 3300049582 Bacteria 39003
329 Ga0501048_0032545 3300049582 Bacteria 3768
330 Ga0501048_0089037 3300049582 Bacteria 2177
331 Ga0501048_0131156 3300049582 Unclassified 1772
332 Ga0501067_0000368 3300049583 Bacteria 24643
333 Ga0501067_0053842 3300049583 Bacteria 2229
334 Ga0501067_0086106 3300049583 Bacteria 1744
335 Ga0501067_0092035 3300049583 Bacteria 1683
336 Ga0501068_0008642 3300049584 Bacteria 5676
337 Ga0501068_0017088 3300049584 Bacteria 4192
338 Ga0501068_0045106 3300049584 Bacteria 2656
339 Ga0501068_0070627 3300049584 Bacteria 2130
340 Ga0501068_0097574 3300049584 Bacteria 1819
341 Ga0501069_0110103 3300049585 Bacteria 1568
342 Ga0501070_0000560 3300049586 Bacteria 33902
343 Ga0501070_0154692 3300049586 Bacteria 1891
344 Ga0501070_0391359 3300049586 Bacteria 1125
345 Ga0501071_0007735 3300049587 Bacteria 7086
346 Ga0501071_0155755 3300049587 Bacteria 1706
347 Ga0501071_0162549 3300049587 Bacteria 1669
348 Ga0501071_0236704 3300049587 Bacteria 1376
349 Ga0501072_0001118 3300049588 Bacteria 19961
350 Ga0501072_0002196 3300049588 Bacteria 14584
351 Ga0501072_0002693 3300049588 Bacteria 13329
352 Ga0501072_0057445 3300049588 Bacteria 3066
353 Ga0501072_0112987 3300049588 Bacteria 2162
354 Ga0501073_0000058 3300049589 Bacteria 70421
355 Ga0501073_0000154 3300049589 Bacteria 45306
356 Ga0501075_0015366 3300049591 Bacteria 5493
357 Ga0501075_0027304 3300049591 Unclassified 4207
358 Ga0501076_0012202 3300049592 Bacteria 6424
359 Ga0501076_0016389 3300049592 Bacteria 5620
360 Ga0501076_0046626 3300049592 Bacteria 3425
361 Ga0501076_0049597 3300049592 Bacteria 3321
362 Ga0501076_0075546 3300049592 Bacteria 2701
363 Ga0501077_0004410 3300049593 Bacteria 8539
364 Ga0501077_0056345 3300049593 Bacteria 2494
365 Ga0501077_0101853 3300049593 Bacteria 1820
366 Ga0501077_0196399 3300049593 Bacteria 1282
367 Ga0501077_0223253 3300049593 Bacteria 1197
368 Ga0501079_0000678 3300049741 Bacteria 22885
369 Ga0501079_0023179 3300049741 Bacteria 4766
370 Ga0501079_0030254 3300049741 Bacteria 4160
371 Ga0501079_0248830 3300049741 Bacteria 1389
372 Ga0501079_0572631 3300049741 Bacteria 888
373 Ga0501080_0000317 3300049742 Bacteria 36817
374 Ga0501080_0001734 3300049742 Bacteria 18663
375 Ga0501080_0004731 3300049742 Bacteria 12135
376 Ga0501080_0373646 3300049742 Bacteria 1285
377 Ga0501080_0486589 3300049742 Bacteria 1104
378 Ga0501081_0020340 3300049743 Bacteria 4423
379 Ga0501081_0033095 3300049743 Bacteria 3510
380 Ga0501081_0186330 3300049743 Bacteria 1502
381 Ga0501081_0246767 3300049743 Bacteria 1303
382 Ga0501081_0735559 3300049743 Bacteria 741
383 Ga0501083_0000286 3300049744 Bacteria 32127
384 Ga0501083_0016741 3300049744 Bacteria 5122
385 Ga0501083_0166296 3300049744 Bacteria 1442
386 Ga0501035_0000079 3300049822 Bacteria 118194
387 Ga0501035_0171051 3300049822 Bacteria 1877
388 Ga0501044_0000085 3300049823 Bacteria 114339
389 Ga0501044_0041585 3300049823 Bacteria 4785
390 Ga0501044_0093643 3300049823 Bacteria 3029
391 Ga0501044_0103488 3300049823 Bacteria 2862
392 Ga0501044_0240344 3300049823 Bacteria 1755
393 Ga0501045_0002753 3300049824 Bacteria 12004
394 Ga0501045_0036193 3300049824 Bacteria 3584
395 Ga0501045_0151240 3300049824 Bacteria 1727
396 nmdc:mga05p37_127403_c1 3300050507 Bacteria 3126
397 nmdc:mga05p37_14475_c1 3300050507 Bacteria 9471
398 nmdc:mga05p37_15321_c1 3300050507 Bacteria 9209
399 nmdc:mga05p37_212776_c1 3300050507 Bacteria 2336
400 nmdc:mga05p37_229665_c1 3300050507 Bacteria 2236
401 nmdc:mga05p37_29826_c1 3300050507 Bacteria 6656
402 nmdc:mga05p37_322740_c1 3300050507 Bacteria 1827
403 nmdc:mga05p37_512070_c1 3300050507 Bacteria 1375
404 nmdc:mga05p37_5938_c1 3300050507 Bacteria 14366
405 nmdc:mga05p37_6136_c1 3300050507 Bacteria 14148
406 nmdc:mga05p37_682575_c1 3300050507 Bacteria 1144
407 nmdc:mga05p37_693523_c1 3300050507 Bacteria 1133
408 nmdc:mga05p37_7813_c1 3300050507 Bacteria 12628
409 nmdc:mga09592_123039_c1 3300050508 Bacteria 2229
410 nmdc:mga09592_163584_c1 3300050508 Bacteria 1923
411 nmdc:mga09592_24454_c1 3300050508 Bacteria 4996
412 nmdc:mga09592_24573_c1 3300050508 Bacteria 4983
413 nmdc:mga09592_3039_c1 3300050508 Bacteria 13609
414 nmdc:mga09592_30607_c1 3300050508 Bacteria 4479
415 nmdc:mga09592_38818_c1 3300050508 Bacteria 3998
416 nmdc:mga09592_706743_c1 3300050508 Bacteria 857
417 nmdc:mga09592_84410_c1 3300050508 Bacteria 2708
418 nmdc:mga0qj67_103455_c1 3300050509 Bacteria 2297
419 nmdc:mga0qj67_24410_c1 3300050509 Bacteria 4659
420 nmdc:mga0qj67_248245_c1 3300050509 Bacteria 1444
421 nmdc:mga0qj67_25447_c1 3300050509 Bacteria 4573
422 nmdc:mga0qj67_392972_c1 3300050509 Bacteria 1119
423 nmdc:mga0qj67_42321_c1 3300050509 Bacteria 3586
424 nmdc:mga0qj67_5932_c1 3300050509 Bacteria 8950
425 nmdc:mga06r32_129009_c1 3300050510 Bacteria 2499
426 nmdc:mga06r32_131571_c1 3300050510 Bacteria 2474
427 nmdc:mga06r32_14672_c1 3300050510 Bacteria 7111
428 nmdc:mga06r32_16727_c1 3300050510 Bacteria 6685
429 nmdc:mga06r32_19463_c1 3300050510 Bacteria 6231
430 nmdc:mga06r32_1993_c1 3300050510 Bacteria 18248
431 nmdc:mga06r32_22657_c1 3300050510 Bacteria 5809
432 nmdc:mga06r32_413644_c1 3300050510 Bacteria 1330
433 nmdc:mga06r32_568231_c1 3300050510 Bacteria 1107
434 nmdc:mga06r32_84112_c1 3300050510 Bacteria 3101
435 nmdc:mga08y16_12399_c1 3300050511 Bacteria 8966
436 nmdc:mga08y16_27221_c1 3300050511 Bacteria 6023
437 nmdc:mga08y16_313237_c1 3300050511 Bacteria 1616
438 nmdc:mga08y16_4628_c1 3300050511 Bacteria 14338
439 nmdc:mga0n895_139081_c1 3300050512 Bacteria 2456
440 nmdc:mga0n895_323472_c1 3300050512 Bacteria 1563
441 nmdc:mga0n895_3642_c1 3300050512 Bacteria 12460
442 nmdc:mga0rr50_273036_c1 3300050513 Bacteria 1409
443 nmdc:mga0rr50_649_c1 3300050513 Bacteria 18668
444 nmdc:mga08x19_32701_c2 3300050514 Bacteria 1473
445 nmdc:mga08x19_4915_c1 3300050514 Bacteria 7895
446 nmdc:mga0a205_147289_c1 3300050515 Bacteria 2255
447 nmdc:mga0a205_152055_c1 3300050515 Unclassified 2213
448 nmdc:mga0a205_482407_c1 3300050515 Bacteria 1098
449 nmdc:mga0a205_795_c1 3300050515 Bacteria 25627
450 Ga0495601_0063966 3300053077 Bacteria 2338
451 Ga0495601_0092366 3300053077 Bacteria 1949
452 Ga0495612_0016503 3300053078 Bacteria 2958
453 Ga0495595_0115143 3300053084 Bacteria 1306
454 Ga0495595_0155746 3300053084 Bacteria 1126
455 Ga0495619_0070936 3300053085 Bacteria 2330
456 Ga0495619_0216833 3300053085 Bacteria 1325
457 Ga0500651_0010879 3300053093 Bacteria 5470
458 Ga0500593_000261 3300053117 Bacteria 21604
459 Ga0500595_004814 3300053119 Bacteria 5976
460 Ga0500642_0074950 3300053130 Bacteria 1545
461 Ga0501084_0018857 3300054114 Bacteria 5744
462 Ga0501084_0022120 3300054114 Bacteria 5304
463 Ga0501084_0032672 3300054114 Bacteria 4353
464 Ga0501084_0059246 3300054114 Bacteria 3205
465 Ga0501084_0065016 3300054114 Bacteria 3052
466 Ga0501084_0113336 3300054114 Bacteria 2279
467 Ga0501084_0122838 3300054114 Bacteria 2184
468 Ga0501082_0002978 3300060353 Bacteria 14794
469 Ga0501082_0042818 3300060353 Bacteria 3903
470 Ga0501082_0052910 3300060353 Bacteria 3500
471 Ga0501082_0272540 3300060353 Bacteria 1473
472 Ga0530510_0107453 3300061734 Bacteria 2042
473 2842776666 2842775625 Bacteria 5587290
474 2855732223 2855730933 Bacteria 7047938
475 2881415118 2881412998 Bacteria 6492157
476 Ga0157371_10033386
477 JGI25151J46595_10000658
478 JGI25406J46586_10023324
479 rootL2_10208257
480 JGI25405J52794_10003681
481 Ga0058859_10694639
482 Ga0070676_10154379
483 Ga0070670_100208548
484 Ga0070680_100017523
485 Ga0070689_100123463
486 Ga0070669_100023201
487 Ga0070669_100127853
488 Ga0070671_100153002
489 Ga0070659_100436476
490 Ga0070667_100180998
491 Ga0070700_100127019
492 Ga0070694_100112564
493 Ga0070708_100115255
494 Ga0070708_100134942
495 Ga0070681_10323763
496 Ga0070685_10033486
497 Ga0070706_100000008
498 Ga0070706_100248826
499 Ga0070706_100280629
500 Ga0070706_100468895
501 Ga0070707_100009952
502 Ga0070707_100222350
503 Ga0070707_100565921
504 Ga0070698_100005584
505 Ga0070698_100010515
506 Ga0070698_100133454
507 Ga0070699_100008624
508 Ga0070699_100042892
509 Ga0070699_100052779
510 Ga0070697_100006631
511 Ga0070697_100313768
512 Ga0070696_100171480
513 Ga0070665_100211763
514 Ga0068855_100162936
515 Ga0068857_100185257
516 Ga0068856_100266795
517 Ga0068859_100397471
518 Ga0068864_100018373
519 Ga0068861_100254226
520 Ga0068861_100321852
521 Ga0068870_10226313
522 Ga0068863_100115921
523 Ga0068858_100186229
524 Ga0068858_100234994
525 Ga0068858_100517031
526 Ga0068860_100141922
527 Ga0068860_100210077
528 Ga0068862_100191836
529 Ga0068862_100356587
530 Ga0081455_10005537
531 Ga0081455_10011542
532 Ga0081455_10044526
533 Ga0081455_10158561
534 Ga0081455_10379802
535 Ga0081538_10011727
536 Ga0081538_10040150
537 Ga0081540_1035582
538 Ga0081539_10000020
539 Ga0081539_10000606
540 Ga0081539_10034736
541 Ga0070717_10410973
542 Ga0075427_10015083
543 Ga0075428_100000420
544 Ga0075428_100000707
545 Ga0075428_100007106
546 Ga0075428_100008704
547 Ga0075428_100010843
548 Ga0075428_100056229
549 Ga0075428_100080325
550 Ga0075428_100088549
551 Ga0075428_100164914
552 Ga0075428_100192620
553 Ga0075428_100226746
554 Ga0075428_100732933
555 Ga0075430_100010107
556 Ga0075430_100014263
557 Ga0075430_100041107
558 Ga0075430_100084905
559 Ga0075430_100112071
560 Ga0075430_100204928
561 Ga0075430_100377099
562 Ga0075430_100696446
563 Ga0075431_100000224
564 Ga0075431_100000748
565 Ga0075431_100011797
566 Ga0075431_100017929
567 Ga0075431_100018965
568 Ga0075431_100054085
569 Ga0075431_100062136
570 Ga0075431_100126833
571 Ga0075431_100147375
572 Ga0075431_100282571
573 Ga0075433_10000521
574 Ga0075433_10254189
575 Ga0075434_100055181
576 Ga0075429_100004265
577 Ga0075429_100014355
578 Ga0075429_100015183
579 Ga0075429_100016576
580 Ga0075429_100064960
581 Ga0075429_100150282
582 Ga0068865_100165187
583 Ga0075436_100007727
584 Ga0075436_100024148
585 Ga0075435_100061002
586 Ga0099794_10018379
587 Ga0111539_10004118
588 Ga0111539_10015885
589 Ga0105245_10476938
590 Ga0114129_10000795
591 Ga0114129_10001541
592 Ga0114129_10007494
593 Ga0114129_10011277
594 Ga0114129_10013330
595 Ga0114129_10020184
596 Ga0114129_10024521
597 Ga0114129_10064578
598 Ga0114129_10093230
599 Ga0114129_10258397
600 Ga0114129_10307151
601 Ga0114129_10335285
602 Ga0114129_10360342
603 Ga0105243_10074056
604 Ga0105243_10220112
605 Ga0105241_10260433
606 Ga0105241_10358949
607 Ga0105249_10887681
608 Ga0163162_10522642
609 Ga0157375_10211995
610 Ga0163163_10159791
611 Ga0182008_10262158
612 Ga0157377_10076193
613 Ga0157379_10028024
614 Ga0213876_10013031
615 Ga0213875_10043005
616 Ga0207647_10243364
617 Ga0207699_10140599
618 Ga0207684_10000029
619 Ga0207684_10000408
620 Ga0207684_10253229
621 Ga0207654_10233698
622 Ga0207707_10219518
623 Ga0207693_10162483
624 Ga0207660_10042964
625 Ga0207657_10129409
626 Ga0207646_10001585
627 Ga0207681_10021006
628 Ga0207681_10117648
629 Ga0207664_10004305
630 Ga0207706_10121885
631 Ga0207704_10143531
632 Ga0207711_10481354
633 Ga0207702_10298482
634 Ga0207641_10093183
635 Ga0207641_10491035
636 Ga0207648_10093064
637 Ga0207648_10350880
638 Ga0207676_10720149
639 Ga0207674_10313955
640 Ga0207675_100115691
641 Ga0207683_10299245
642 Ga0209588_1045404
643 Ga0207428_10006817
644 Ga0207428_10029038
645 Ga0207428_10192553
646 Ga0268265_10058739
647 Ga0268265_10801864
648 Ga0268264_10118030
649 Ga0268264_10147132
650 Ga0268264_10252151
651 Ga0265319_1039284
652 Ga0265334_10020365
653 Ga0265336_10003576
654 Ga0265324_10021686
655 Ga0307511_10016131
656 Ga0265328_10071979
657 Ga0265339_10000525
658 Ga0307408_100014097
659 Ga0307408_100029874
660 Ga0307408_100427444
661 Ga0265314_10001070
662 Ga0265342_10042109
663 Ga0307406_10133228
664 Ga0307407_10160897
665 Ga0307407_10468273
666 Ga0307412_10025009
667 Ga0307409_100255845
668 Ga0307416_100723321
669 Ga0307416_100840299
670 Ga0307415_100330175
671 Ga0373948_0003126
672 Ga0373934_0005731
673 Ga0373923_0004994
674 Ga0373936_0071179
675 Ga0373953_0013471
676 Ga0373954_0022424
677 Ga0373957_0020587
678 Ga0373960_0033548
679 Ga0373955_0007236
680 Ga0316574_0133035
681 Ga0373931_0000019
682 Ga0373931_0281582
683 Ga0373933_0051428
684 Ga0373947_0334351
685 Ga0373937_0002675
686 Ga0373925_0008737
687 Ga0373925_0033857
688 Ga0395900_0007310
689 Ga0395898_0003128
690 Ga0436364_1107886
691 Ga0436364_1363204
692 Ga0395901_0671278
693 Ga0436365_0017693
694 Ga0436360_0150690
695 Ga0439435_0073503
696 Ga0451577_0545288
697 Ga0439440_0016921
698 Ga0453683_0045517
699 Ga0451576_0822843
700 Ga0466967_0087645
701 Ga0466967_0145214
702 Ga0495592_0011468
703 Ga0495603_0066538
704 Ga0495629_0018231
705 Ga0495629_0024491
706 Ga0495629_0085683
707 Ga0495641_0017794
708 Ga0495651_0036523
709 Ga0495653_0233904
710 Ga0495582_0021707
711 Ga0495582_0052133
712 Ga0495639_0030926
713 Ga0495662_0016988
714 Ga0495662_0018704
715 Ga0495662_0188146
716 Ga0495664_0052163
717 Ga0495594_0183158
718 Ga0495608_0290944
719 Ga0495618_0034876
720 Ga0495630_0013315
721 Ga0495630_0017325
722 Ga0495630_0480687
723 Ga0495666_0207150
724 Ga0495665_0012259
725 Ga0495640_0160593
726 Ga0495598_0054796
727 Ga0495621_0102917
728 Ga0495667_0204963
729 Ga0495634_0024065
730 Ga0495635_0033659
731 Ga0495635_0035189
732 Ga0495661_0007336
733 Ga0495599_0164059
734 Ga0495647_0026389
735 Ga0495647_0043764
736 Ga0495658_0013408
737 Ga0495613_0113152
738 Ga0495613_0162909
739 Ga0495624_0036308
740 Ga0495600_0082913
741 Ga0495581_0032738
742 Ga0495581_0049449
743 Ga0495581_0064544
744 Ga0495674_0013967
745 Ga0495674_0266499
746 Ga0495676_0028659
747 Ga0495676_0048096
748 Ga0495680_0136674
749 Ga0495687_015050
750 Ga0495675_0015614
751 Ga0495677_0009158
752 Ga0495684_0107560
753 Ga0495686_0000007
754 Ga0495593_0013849
755 Ga0495602_0026424
756 Ga0495614_0084488
757 Ga0496102_0079844
758 Ga0496104_0019088
759 Ga0496105_0039511
760 Ga0496105_0047510
761 Ga0496108_0012517
762 Ga0496109_0021566
763 Ga0496109_0023249
764 Ga0496110_0009747
765 Ga0496110_0042699
766 Ga0496111_0001075
767 Ga0496113_0044330
768 Ga0496113_0061686
769 Ga0496118_0086717
770 Ga0496120_0083134
771 Ga0496121_0003633
772 Ga0496126_0111649
773 Ga0501031_0046809
774 Ga0501032_0000086
775 Ga0501032_0000829
776 Ga0501033_0000116
777 Ga0501034_0000108
778 Ga0501034_0357604
779 Ga0501036_0000065
780 Ga0501036_0048132
781 Ga0501037_0000173
782 Ga0501037_0035153
783 Ga0501037_0147854
784 Ga0501038_0000416
785 Ga0501038_0025824
786 Ga0501039_0000265
787 Ga0501039_0128579
788 Ga0501040_0031717
789 Ga0501040_0204672
790 Ga0501041_0083743
791 Ga0501042_0122910
792 Ga0501042_0137417
793 Ga0501042_0160599
794 Ga0501042_0396251
795 Ga0501043_0000226
796 Ga0501043_0029080
797 Ga0501046_0002306
798 Ga0501046_0162793
799 Ga0501047_0000325
800 Ga0501047_0003421
801 Ga0501047_0055524
802 Ga0501047_0330796
803 Ga0501048_0000202
804 Ga0501048_0032545
805 Ga0501048_0089037
806 Ga0501048_0131156
807 Ga0501067_0000368
808 Ga0501067_0053842
809 Ga0501067_0086106
810 Ga0501067_0092035
811 Ga0501068_0008642
812 Ga0501068_0017088
813 Ga0501068_0045106
814 Ga0501068_0070627
815 Ga0501068_0097574
816 Ga0501069_0110103
817 Ga0501070_0000560
818 Ga0501070_0154692
819 Ga0501070_0391359
820 Ga0501071_0007735
821 Ga0501071_0155755
822 Ga0501071_0162549
823 Ga0501071_0236704
824 Ga0501072_0001118
825 Ga0501072_0002196
826 Ga0501072_0002693
827 Ga0501072_0057445
828 Ga0501072_0112987
829 Ga0501073_0000058
830 Ga0501073_0000154
831 Ga0501075_0015366
832 Ga0501075_0027304
833 Ga0501076_0012202
834 Ga0501076_0016389
835 Ga0501076_0046626
836 Ga0501076_0049597
837 Ga0501076_0075546
838 Ga0501077_0004410
839 Ga0501077_0056345
840 Ga0501077_0101853
841 Ga0501077_0196399
842 Ga0501077_0223253
843 Ga0501079_0000678
844 Ga0501079_0023179
845 Ga0501079_0030254
846 Ga0501079_0248830
847 Ga0501079_0572631
848 Ga0501080_0000317
849 Ga0501080_0001734
850 Ga0501080_0004731
851 Ga0501080_0373646
852 Ga0501080_0486589
853 Ga0501081_0020340
854 Ga0501081_0033095
855 Ga0501081_0186330
856 Ga0501081_0246767
857 Ga0501081_0735559
858 Ga0501083_0000286
859 Ga0501083_0016741
860 Ga0501083_0166296
861 Ga0501035_0000079
862 Ga0501035_0171051
863 Ga0501044_0000085
864 Ga0501044_0041585
865 Ga0501044_0093643
866 Ga0501044_0103488
867 Ga0501044_0240344
868 Ga0501045_0002753
869 Ga0501045_0036193
870 Ga0501045_0151240
871 nmdc:mga05p37_127403_c1
872 nmdc:mga05p37_14475_c1
873 nmdc:mga05p37_15321_c1
874 nmdc:mga05p37_212776_c1
875 nmdc:mga05p37_229665_c1
876 nmdc:mga05p37_29826_c1
877 nmdc:mga05p37_322740_c1
878 nmdc:mga05p37_512070_c1
879 nmdc:mga05p37_5938_c1
880 nmdc:mga05p37_6136_c1
881 nmdc:mga05p37_682575_c1
882 nmdc:mga05p37_693523_c1
883 nmdc:mga05p37_7813_c1
884 nmdc:mga09592_123039_c1
885 nmdc:mga09592_163584_c1
886 nmdc:mga09592_24454_c1
887 nmdc:mga09592_24573_c1
888 nmdc:mga09592_3039_c1
889 nmdc:mga09592_30607_c1
890 nmdc:mga09592_38818_c1
891 nmdc:mga09592_706743_c1
892 nmdc:mga09592_84410_c1
893 nmdc:mga0qj67_103455_c1
894 nmdc:mga0qj67_24410_c1
895 nmdc:mga0qj67_248245_c1
896 nmdc:mga0qj67_25447_c1
897 nmdc:mga0qj67_392972_c1
898 nmdc:mga0qj67_42321_c1
899 nmdc:mga0qj67_5932_c1
900 nmdc:mga06r32_129009_c1
901 nmdc:mga06r32_131571_c1
902 nmdc:mga06r32_14672_c1
903 nmdc:mga06r32_16727_c1
904 nmdc:mga06r32_19463_c1
905 nmdc:mga06r32_1993_c1
906 nmdc:mga06r32_22657_c1
907 nmdc:mga06r32_413644_c1
908 nmdc:mga06r32_568231_c1
909 nmdc:mga06r32_84112_c1
910 nmdc:mga08y16_12399_c1
911 nmdc:mga08y16_27221_c1
912 nmdc:mga08y16_313237_c1
913 nmdc:mga08y16_4628_c1
914 nmdc:mga0n895_139081_c1
915 nmdc:mga0n895_323472_c1
916 nmdc:mga0n895_3642_c1
917 nmdc:mga0rr50_273036_c1
918 nmdc:mga0rr50_649_c1
919 nmdc:mga08x19_32701_c2
920 nmdc:mga08x19_4915_c1
921 nmdc:mga0a205_147289_c1
922 nmdc:mga0a205_152055_c1
923 nmdc:mga0a205_482407_c1
924 nmdc:mga0a205_795_c1
925 Ga0495601_0063966
926 Ga0495601_0092366
927 Ga0495612_0016503
928 Ga0495595_0115143
929 Ga0495595_0155746
930 Ga0495619_0070936
931 Ga0495619_0216833
932 Ga0500651_0010879
933 Ga0500593_000261
934 Ga0500595_004814
935 Ga0500642_0074950
936 Ga0501084_0018857
937 Ga0501084_0022120
938 Ga0501084_0032672
939 Ga0501084_0059246
940 Ga0501084_0065016
941 Ga0501084_0113336
942 Ga0501084_0122838
943 Ga0501082_0002978
944 Ga0501082_0042818
945 Ga0501082_0052910
946 Ga0501082_0272540
947 Ga0530510_0107453
948 2842776666
949 2855732223
950 2881415118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

43

296

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

48

233

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o34-assembly1.cif.gz_A thne from s.clavuligerus 0.9584 7 214
5c9g-assembly2.cif.gz_F crystal structure of a putative enoyl-coa hydratase/isomerase family protein from hyphomonas neptunium 0.9517 6 263
4wcz-assembly2.cif.gz_E crystal structure of a putative enoyl-coa hydratase/isomerase from novosphingobium aromaticivorans 0.9475 6 260
4k2n-assembly1.cif.gz_A crystal structure of an enoyl-coa hydratase/ carnithine racemase from magnetospirillum magneticum 0.9474 3 263
5o34-assembly1.cif.gz_C thne from s.clavuligerus 0.9441 7 214
ID Description Score Start End Superfamily
af_O50402_25_213_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9771 4 178 3.90.226.10
5c9gA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9743 6 205 3.90.226.10
4k2nA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9736 4 205 3.90.226.10
af_B7F9R1_37_234_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9627 15 203 3.90.226.10
5wydE01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9594 1 202 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A069IFA6-F1-model_v4 Enoyl-CoA hydratase 0.9936 1 263 GO:0006635
GO:0016829
AF-A0A352KDP5-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9936 8 263 GO:0004300
GO:0006635
AF-A0A1F4E7A4-F1-model_v4 Enoyl-CoA hydratase 0.9921 54 263 GO:0006635
GO:0016829
AF-A0A1F4EZH5-F1-model_v4 Enoyl-CoA hydratase 0.9906 7 263 GO:0006635
GO:0016829
AF-A0A2E8CJ64-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9878 3 263 GO:0004300
GO:0006635

Map