F451372

General Info

Members Datasets Scaffolds Average Seq Length
475 225 950 492

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10020167|Ga0265328_100201672
Length 482
Sequence MATSPASPAAARSKYEPVIGLEVHVQLLTRTKIFCGCSTQFGDPPNTNVCPVCLGLPGPLPVLNKRAVEFAVLAATALNCRINETSIFARKNYFYPDLPKGYQISQYDKPLAEHGHIEIKTSTGPKRIGITRVHLEEDAGKSLHDGLPDSSQWTSIDLNRSGVPLIEIVSEPDISSPDEAYEYLTRLKEIILYTSVSDCNMEEGSLRCDANVSIRPRGQKEFGTKTEVKNVNSFRFIRHALEYEIERHQQVLDSGGKIEQETRLYNAGEGKTYGMRSKEQAHDYRYFPEPDLLPLVVDEKWLAQIVRELPMVAQYGITEADAQTLTATRARADQFEEAAGAAKNPKRVANLVLSDLLGRLKAKGLDIEQSPISMKGVALSADLVESGTLSSKMLKDLYDLAFDRGQDFPAIYEKEKPQQITDTAVIEKIIAEVIATNPRQLEQYRGGKKTVIAFFVGQVMKASKGQANPTLVNELLAKKLEE

Samples

Sample ID Description Type Environment
1 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 6.53
Rhizosphere 93.05
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265328_10020167 3300031239 Bacteria 2555
2 MBSR1b_contig_11295349 2162886012 Bacteria 4612
3 JGI24751J29686_10004404 3300002459 Bacteria 2858
4 Ga0065715_10091563 3300005293 Bacteria 5704
5 Ga0065715_10115093 3300005293 Bacteria 2427
6 Ga0070676_10002402 3300005328 Bacteria 9594
7 Ga0070683_100032072 3300005329 Bacteria 4781
8 Ga0070683_100107916 3300005329 Bacteria 2625
9 Ga0070670_100006204 3300005331 Bacteria 10106
10 Ga0070670_100119618 3300005331 Bacteria 2272
11 Ga0068869_100004786 3300005334 Bacteria 8451
12 Ga0068869_100006334 3300005334 Bacteria 7493
13 Ga0068869_100024898 3300005334 Bacteria 4150
14 Ga0070666_10101886 3300005335 Bacteria 1979
15 Ga0070682_100006207 3300005337 Bacteria 6697
16 Ga0068868_100048676 3300005338 Bacteria 3325
17 Ga0070660_100008599 3300005339 Bacteria 7147
18 Ga0070689_100000875 3300005340 Bacteria 18757
19 Ga0070687_100085351 3300005343 Bacteria 1733
20 Ga0070661_100013124 3300005344 Bacteria 5813
21 Ga0070661_100015803 3300005344 Bacteria 5327
22 Ga0070668_100001377 3300005347 Bacteria 17440
23 Ga0070669_100087068 3300005353 Bacteria 2335
24 Ga0070675_100015044 3300005354 Bacteria 6111
25 Ga0070675_100083727 3300005354 Bacteria 2663
26 Ga0070671_100027495 3300005355 Bacteria 4682
27 Ga0070674_100002171 3300005356 Bacteria 10784
28 Ga0070673_100015480 3300005364 Bacteria 5358
29 Ga0070688_100020644 3300005365 Bacteria 3833
30 Ga0070659_100033793 3300005366 Bacteria 3975
31 Ga0070709_10022625 3300005434 Bacteria 3680
32 Ga0070709_10028406 3300005434 Bacteria 3335
33 Ga0070709_10031868 3300005434 Bacteria 3175
34 Ga0070714_100000040 3300005435 Bacteria 119253
35 Ga0070714_100004620 3300005435 Bacteria 10388
36 Ga0070714_100020692 3300005435 Bacteria 5377
37 Ga0070714_100058753 3300005435 Bacteria 3296
38 Ga0070714_100083293 3300005435 Bacteria 2788
39 Ga0070714_100127191 3300005435 Bacteria 2273
40 Ga0070714_100213226 3300005435 Bacteria 1771
41 Ga0070713_100000442 3300005436 Bacteria 26498
42 Ga0070713_100065555 3300005436 Bacteria 3051
43 Ga0070713_100092614 3300005436 Bacteria 2602
44 Ga0070710_10001355 3300005437 Bacteria 11557
45 Ga0070701_10016760 3300005438 Bacteria 3413
46 Ga0070711_100001759 3300005439 Bacteria 12020
47 Ga0070711_100066155 3300005439 Bacteria 2531
48 Ga0070708_100000830 3300005445 Bacteria 23291
49 Ga0070708_100005717 3300005445 Bacteria 9865
50 Ga0070708_100018309 3300005445 Bacteria 5862
51 Ga0070708_100020633 3300005445 Bacteria 5561
52 Ga0070708_100029089 3300005445 Bacteria 4762
53 Ga0070708_100103708 3300005445 Bacteria 2608
54 Ga0070662_100008173 3300005457 Bacteria 6815
55 Ga0070662_100031921 3300005457 Bacteria 3700
56 Ga0070662_100045507 3300005457 Bacteria 3149
57 Ga0070681_10000513 3300005458 Bacteria 31715
58 Ga0070681_10000775 3300005458 Bacteria 26562
59 Ga0068867_100017369 3300005459 Bacteria 5111
60 Ga0070685_10029377 3300005466 Bacteria 3053
61 Ga0070706_100001077 3300005467 Bacteria 29535
62 Ga0070706_100001512 3300005467 Bacteria 24397
63 Ga0070706_100016275 3300005467 Bacteria 6870
64 Ga0070706_100079493 3300005467 Bacteria 3035
65 Ga0070707_100010025 3300005468 Bacteria 8815
66 Ga0070707_100046770 3300005468 Bacteria 4141
67 Ga0070707_100049252 3300005468 Bacteria 4038
68 Ga0070707_100083178 3300005468 Bacteria 3092
69 Ga0070707_100083406 3300005468 Bacteria 3088
70 Ga0070698_100001953 3300005471 Bacteria 22886
71 Ga0070698_100011395 3300005471 Bacteria 9434
72 Ga0070698_100048773 3300005471 Bacteria 4326
73 Ga0070698_100055131 3300005471 Bacteria 4033
74 Ga0070699_100002129 3300005518 Bacteria 17965
75 Ga0070699_100002651 3300005518 Bacteria 15983
76 Ga0070699_100006909 3300005518 Bacteria 9867
77 Ga0070699_100155708 3300005518 Bacteria 2022
78 Ga0070679_100006393 3300005530 Bacteria 10975
79 Ga0070679_100019192 3300005530 Bacteria 6645
80 Ga0070684_100028995 3300005535 Bacteria 4687
81 Ga0070684_100031677 3300005535 Bacteria 4503
82 Ga0070684_100122452 3300005535 Bacteria 2340
83 Ga0070697_100000178 3300005536 Bacteria 52143
84 Ga0070697_100000541 3300005536 Bacteria 28440
85 Ga0070697_100001187 3300005536 Bacteria 19726
86 Ga0070697_100001901 3300005536 Bacteria 15969
87 Ga0070697_100002705 3300005536 Bacteria 13654
88 Ga0070697_100005176 3300005536 Bacteria 10020
89 Ga0070697_100025058 3300005536 Bacteria 4755
90 Ga0068853_100030013 3300005539 Bacteria 4589
91 Ga0070672_100001909 3300005543 Bacteria 13066
92 Ga0070695_100102320 3300005545 Bacteria 1931
93 Ga0070696_100030371 3300005546 Bacteria 3699
94 Ga0070696_100136816 3300005546 Bacteria 1786
95 Ga0070693_100049821 3300005547 Bacteria 2391
96 Ga0068855_100000412 3300005563 Bacteria 52997
97 Ga0068855_100000425 3300005563 Bacteria 52146
98 Ga0068855_100032861 3300005563 Bacteria 6194
99 Ga0068855_100078813 3300005563 Bacteria 3821
100 Ga0068855_100095301 3300005563 Bacteria 3430
101 Ga0070664_100009758 3300005564 Bacteria 7778
102 Ga0070664_100030524 3300005564 Bacteria 4497
103 Ga0070664_100031696 3300005564 Bacteria 4419
104 Ga0070664_100035166 3300005564 Bacteria 4205
105 Ga0070664_100113155 3300005564 Bacteria 2370
106 Ga0068857_100000034 3300005577 Bacteria 73294
107 Ga0068857_100034830 3300005577 Bacteria 4454
108 Ga0068857_100040381 3300005577 Bacteria 4137
109 Ga0068857_100073485 3300005577 Bacteria 3047
110 Ga0068854_100004112 3300005578 Bacteria 9144
111 Ga0068854_100009983 3300005578 Bacteria 6145
112 Ga0068854_100012035 3300005578 Bacteria 5655
113 Ga0068854_100031655 3300005578 Bacteria 3676
114 Ga0068856_100001577 3300005614 Bacteria 23871
115 Ga0068856_100001663 3300005614 Bacteria 23300
116 Ga0068856_100003658 3300005614 Bacteria 15434
117 Ga0068856_100018200 3300005614 Bacteria 6809
118 Ga0068856_100163179 3300005614 Bacteria 2239
119 Ga0070702_100079809 3300005615 Bacteria 1956
120 Ga0068852_100008076 3300005616 Bacteria 7722
121 Ga0068852_100054971 3300005616 Bacteria 3434
122 Ga0068859_100000279 3300005617 Bacteria 50882
123 Ga0068859_100011899 3300005617 Bacteria 8743
124 Ga0068864_100000722 3300005618 Bacteria 27599
125 Ga0068864_100041782 3300005618 Bacteria 3921
126 Ga0068864_100047759 3300005618 Bacteria 3678
127 Ga0068866_10000995 3300005718 Bacteria 12438
128 Ga0068866_10010196 3300005718 Bacteria 4020
129 Ga0068861_100010299 3300005719 Bacteria 6487
130 Ga0068861_100145541 3300005719 Bacteria 1939
131 Ga0068851_10007549 3300005834 Bacteria 4997
132 Ga0068851_10009349 3300005834 Bacteria 4555
133 Ga0068870_10000744 3300005840 Bacteria 12541
134 Ga0068863_100057353 3300005841 Bacteria 3686
135 Ga0068863_100104832 3300005841 Bacteria 2690
136 Ga0068858_100002272 3300005842 Bacteria 19444
137 Ga0068858_100017219 3300005842 Bacteria 6782
138 Ga0068862_100022763 3300005844 Bacteria 5243
139 Ga0081540_1013485 3300005983 Bacteria 5308
140 Ga0070717_10000503 3300006028 Bacteria 24750
141 Ga0070717_10002868 3300006028 Bacteria 12228
142 Ga0070717_10035021 3300006028 Bacteria 4061
143 Ga0070717_10056591 3300006028 Bacteria 3240
144 Ga0070717_10057894 3300006028 Bacteria 3203
145 Ga0075363_100022647 3300006048 Bacteria 3178
146 Ga0070715_10020917 3300006163 Bacteria 2530
147 Ga0070716_100007802 3300006173 Bacteria 5287
148 Ga0070716_100011273 3300006173 Bacteria 4501
149 Ga0070712_100001571 3300006175 Bacteria 13968
150 Ga0070712_100004155 3300006175 Bacteria 8897
151 Ga0070712_100005339 3300006175 Bacteria 7952
152 Ga0070712_100007556 3300006175 Bacteria 6794
153 Ga0070712_100109416 3300006175 Bacteria 2059
154 Ga0097621_100000210 3300006237 Bacteria 38363
155 Ga0097621_100000747 3300006237 Bacteria 22785
156 Ga0097621_100001095 3300006237 Bacteria 18946
157 Ga0097621_100028906 3300006237 Bacteria 4374
158 Ga0097621_100199393 3300006237 Bacteria 1737
159 Ga0068871_100000168 3300006358 Bacteria 43632
160 Ga0068871_100000787 3300006358 Bacteria 21292
161 Ga0068871_100006547 3300006358 Bacteria 8252
162 Ga0068871_100043027 3300006358 Bacteria 3627
163 Ga0075433_10005726 3300006852 Bacteria 9775
164 Ga0068865_100004476 3300006881 Bacteria 8430
165 Ga0068865_100044984 3300006881 Bacteria 3024
166 Ga0068865_100051811 3300006881 Bacteria 2842
167 Ga0097620_100000279 3300006931 Bacteria 50882
168 Ga0097620_100011898 3300006931 Bacteria 8743
169 Ga0075435_100096302 3300007076 Bacteria 2448
170 Ga0105240_10074324 3300009093 Bacteria 4196
171 Ga0105240_10107144 3300009093 Bacteria 3389
172 Ga0105240_10241501 3300009093 Bacteria 2094
173 Ga0105245_10002780 3300009098 Bacteria 15730
174 Ga0105245_10023966 3300009098 Bacteria 5356
175 Ga0105245_10032442 3300009098 Bacteria 4624
176 Ga0105247_10044224 3300009101 Bacteria 2730
177 Ga0105243_10031697 3300009148 Bacteria 4077
178 Ga0105241_10003234 3300009174 Bacteria 12120
179 Ga0105242_10041671 3300009176 Bacteria 3704
180 Ga0105242_10076831 3300009176 Bacteria 2785
181 Ga0105242_10127750 3300009176 Bacteria 2190
182 Ga0105248_10013124 3300009177 Bacteria 9124
183 Ga0105248_10042656 3300009177 Bacteria 5088
184 Ga0105248_10048218 3300009177 Bacteria 4778
185 Ga0105248_10248189 3300009177 Bacteria 2004
186 Ga0105237_10159798 3300009545 Bacteria 2251
187 Ga0105238_10017540 3300009551 Bacteria 7280
188 Ga0105238_10065226 3300009551 Bacteria 3642
189 Ga0105238_10089455 3300009551 Bacteria 3066
190 Ga0105238_10169352 3300009551 Bacteria 2160
191 Ga0105249_10004808 3300009553 Bacteria 11657
192 Ga0105249_10178963 3300009553 Bacteria 2062
193 Ga0105239_10019632 3300010375 Bacteria 7461
194 Ga0105239_10093169 3300010375 Bacteria 3326
195 Ga0105239_10167831 3300010375 Bacteria 2454
196 Ga0105246_10000310 3300011119 Bacteria 25833
197 Ga0105246_10007916 3300011119 Bacteria 6522
198 Ga0105246_10009850 3300011119 Bacteria 5892
199 Ga0157373_10071215 3300013100 Bacteria 2456
200 Ga0157373_10071946 3300013100 Bacteria 2442
201 Ga0157371_10007274 3300013102 Bacteria 8993
202 Ga0157369_10000269 3300013105 Bacteria 69979
203 Ga0157369_10009722 3300013105 Bacteria 10998
204 Ga0157369_10037582 3300013105 Bacteria 5301
205 Ga0157369_10050126 3300013105 Bacteria 4523
206 Ga0157374_10000436 3300013296 Bacteria 37798
207 Ga0157374_10002373 3300013296 Bacteria 15864
208 Ga0157374_10010543 3300013296 Bacteria 7955
209 Ga0157374_10055445 3300013296 Bacteria 3699
210 Ga0157374_10061838 3300013296 Bacteria 3508
211 Ga0157378_10000014 3300013297 Bacteria 144214
212 Ga0157378_10000023 3300013297 Bacteria 129977
213 Ga0157378_10000413 3300013297 Bacteria 42040
214 Ga0157378_10039952 3300013297 Bacteria 4161
215 Ga0157378_10049661 3300013297 Bacteria 3732
216 Ga0163162_10001630 3300013306 Bacteria 20998
217 Ga0163162_10006383 3300013306 Bacteria 11417
218 Ga0157372_10000423 3300013307 Bacteria 46475
219 Ga0157372_10001025 3300013307 Bacteria 30552
220 Ga0157372_10003752 3300013307 Bacteria 16311
221 Ga0157372_10045157 3300013307 Bacteria 4886
222 Ga0157372_10058439 3300013307 Bacteria 4311
223 Ga0157372_10073579 3300013307 Bacteria 3852
224 Ga0157375_10117648 3300013308 Bacteria 2763
225 Ga0157375_10178953 3300013308 Bacteria 2271
226 Ga0163163_10017908 3300014325 Bacteria 6616
227 Ga0163163_10103895 3300014325 Bacteria 2866
228 Ga0157377_10001351 3300014745 Bacteria 10531
229 Ga0157379_10004171 3300014968 Bacteria 12339
230 Ga0157379_10054198 3300014968 Bacteria 3583
231 Ga0157376_10046570 3300014969 Bacteria 3576
232 Ga0157376_10054471 3300014969 Bacteria 3335
233 Ga0157376_10076322 3300014969 Bacteria 2863
234 Ga0157376_10119756 3300014969 Bacteria 2331
235 Ga0182006_1015358 3300015261 Bacteria 3284
236 Ga0182007_10013507 3300015262 Unclassified 3111
237 Ga0182007_10016565 3300015262 Bacteria 2716
238 Ga0163161_10005689 3300017792 Bacteria 8642
239 Ga0213872_10002020 3300021361 Bacteria 12321
240 Ga0213872_10014534 3300021361 Bacteria 3672
241 Ga0213872_10054306 3300021361 Bacteria 1817
242 Ga0228598_1000009 3300024227 Bacteria 27166
243 Ga0207682_10006302 3300025893 Bacteria 4789
244 Ga0207692_10067174 3300025898 Bacteria 1876
245 Ga0207642_10030149 3300025899 Bacteria 2256
246 Ga0207688_10012262 3300025901 Bacteria 4663
247 Ga0207647_10001252 3300025904 Bacteria 19532
248 Ga0207647_10002172 3300025904 Bacteria 14965
249 Ga0207685_10015075 3300025905 Bacteria 2439
250 Ga0207699_10020326 3300025906 Bacteria 3556
251 Ga0207645_10000252 3300025907 Bacteria 44594
252 Ga0207643_10000915 3300025908 Bacteria 17653
253 Ga0207684_10000642 3300025910 Bacteria 41399
254 Ga0207684_10020486 3300025910 Bacteria 5651
255 Ga0207684_10028839 3300025910 Bacteria 4727
256 Ga0207684_10031672 3300025910 Bacteria 4498
257 Ga0207684_10037706 3300025910 Bacteria 4102
258 Ga0207654_10014337 3300025911 Bacteria 4095
259 Ga0207654_10026749 3300025911 Bacteria 3128
260 Ga0207707_10029322 3300025912 Bacteria 4809
261 Ga0207707_10070838 3300025912 Bacteria 3038
262 Ga0207695_10006554 3300025913 Bacteria 15076
263 Ga0207695_10020152 3300025913 Bacteria 7648
264 Ga0207695_10169143 3300025913 Bacteria 2112
265 Ga0207695_10237113 3300025913 Bacteria 1726
266 Ga0207671_10016452 3300025914 Bacteria 5746
267 Ga0207671_10057381 3300025914 Bacteria 2886
268 Ga0207693_10000038 3300025915 Bacteria 109225
269 Ga0207693_10003508 3300025915 Bacteria 13395
270 Ga0207693_10007492 3300025915 Bacteria 8971
271 Ga0207693_10008248 3300025915 Bacteria 8529
272 Ga0207693_10010203 3300025915 Bacteria 7625
273 Ga0207663_10010456 3300025916 Bacteria 4941
274 Ga0207662_10079299 3300025918 Bacteria 2000
275 Ga0207657_10000557 3300025919 Bacteria 39699
276 Ga0207657_10002694 3300025919 Bacteria 19148
277 Ga0207657_10005092 3300025919 Bacteria 13772
278 Ga0207649_10000124 3300025920 Bacteria 65086
279 Ga0207652_10009456 3300025921 Bacteria 7838
280 Ga0207652_10087712 3300025921 Bacteria 2729
281 Ga0207646_10001096 3300025922 Bacteria 34455
282 Ga0207646_10017991 3300025922 Bacteria 6599
283 Ga0207646_10084277 3300025922 Bacteria 2844
284 Ga0207646_10123626 3300025922 Bacteria 2326
285 Ga0207681_10024494 3300025923 Bacteria 3874
286 Ga0207694_10000430 3300025924 Bacteria 39056
287 Ga0207650_10000665 3300025925 Bacteria 27103
288 Ga0207650_10005941 3300025925 Bacteria 8332
289 Ga0207650_10027517 3300025925 Bacteria 4071
290 Ga0207659_10140179 3300025926 Bacteria 1876
291 Ga0207687_10000754 3300025927 Bacteria 21872
292 Ga0207687_10010103 3300025927 Bacteria 6171
293 Ga0207700_10012151 3300025928 Bacteria 5538
294 Ga0207700_10019287 3300025928 Bacteria 4604
295 Ga0207700_10068168 3300025928 Bacteria 2726
296 Ga0207700_10109590 3300025928 Bacteria 2219
297 Ga0207700_10164147 3300025928 Bacteria 1847
298 Ga0207664_10000029 3300025929 Bacteria 183815
299 Ga0207664_10031116 3300025929 Bacteria 4080
300 Ga0207664_10039075 3300025929 Bacteria 3682
301 Ga0207664_10132520 3300025929 Bacteria 2100
302 Ga0207690_10065429 3300025932 Bacteria 2486
303 Ga0207690_10067969 3300025932 Bacteria 2446
304 Ga0207706_10000314 3300025933 Bacteria 52222
305 Ga0207706_10000375 3300025933 Bacteria 48561
306 Ga0207706_10013010 3300025933 Bacteria 7572
307 Ga0207709_10017077 3300025935 Bacteria 4045
308 Ga0207704_10024797 3300025938 Bacteria 3261
309 Ga0207704_10068846 3300025938 Bacteria 2233
310 Ga0207665_10000085 3300025939 Bacteria 60799
311 Ga0207665_10007920 3300025939 Bacteria 7019
312 Ga0207665_10009811 3300025939 Bacteria 6286
313 Ga0207665_10072966 3300025939 Bacteria 2346
314 Ga0207665_10122176 3300025939 Bacteria 1841
315 Ga0207691_10001266 3300025940 Bacteria 25285
316 Ga0207711_10005067 3300025941 Bacteria 11173
317 Ga0207711_10011635 3300025941 Bacteria 7311
318 Ga0207711_10012287 3300025941 Bacteria 7118
319 Ga0207689_10000068 3300025942 Bacteria 83861
320 Ga0207689_10000615 3300025942 Bacteria 34012
321 Ga0207689_10009857 3300025942 Bacteria 8234
322 Ga0207689_10032425 3300025942 Bacteria 4347
323 Ga0207689_10066383 3300025942 Bacteria 2967
324 Ga0207661_10000388 3300025944 Bacteria 28484
325 Ga0207661_10019068 3300025944 Bacteria 5106
326 Ga0207679_10000051 3300025945 Bacteria 111207
327 Ga0207679_10009563 3300025945 Bacteria 6215
328 Ga0207679_10020546 3300025945 Bacteria 4457
329 Ga0207679_10032076 3300025945 Bacteria 3684
330 Ga0207667_10000311 3300025949 Bacteria 67671
331 Ga0207667_10002666 3300025949 Bacteria 22067
332 Ga0207667_10005985 3300025949 Bacteria 14798
333 Ga0207667_10006543 3300025949 Bacteria 14094
334 Ga0207651_10005848 3300025960 Bacteria 6358
335 Ga0207651_10040211 3300025960 Bacteria 3091
336 Ga0207712_10004868 3300025961 Bacteria 8491
337 Ga0207668_10081244 3300025972 Bacteria 2350
338 Ga0207640_10002549 3300025981 Bacteria 9765
339 Ga0207640_10055921 3300025981 Bacteria 2587
340 Ga0207640_10094543 3300025981 Bacteria 2079
341 Ga0207658_10079567 3300025986 Bacteria 2507
342 Ga0207677_10033698 3300026023 Bacteria 3308
343 Ga0207677_10034652 3300026023 Bacteria 3271
344 Ga0207677_10068764 3300026023 Bacteria 2487
345 Ga0207703_10001667 3300026035 Bacteria 19971
346 Ga0207703_10020874 3300026035 Bacteria 5124
347 Ga0207703_10042584 3300026035 Bacteria 3642
348 Ga0207639_10039242 3300026041 Bacteria 3527
349 Ga0207678_10000178 3300026067 Bacteria 54207
350 Ga0207678_10002437 3300026067 Bacteria 16910
351 Ga0207702_10001654 3300026078 Bacteria 22011
352 Ga0207702_10001985 3300026078 Bacteria 19857
353 Ga0207702_10003682 3300026078 Bacteria 13874
354 Ga0207702_10005648 3300026078 Bacteria 10909
355 Ga0207702_10091168 3300026078 Bacteria 2668
356 Ga0207641_10000020 3300026088 Bacteria 286415
357 Ga0207641_10011077 3300026088 Bacteria 7396
358 Ga0207641_10043468 3300026088 Bacteria 3774
359 Ga0207641_10046212 3300026088 Bacteria 3669
360 Ga0207641_10137091 3300026088 Bacteria 2204
361 Ga0207648_10000698 3300026089 Bacteria 37564
362 Ga0207648_10026170 3300026089 Bacteria 5187
363 Ga0207676_10000081 3300026095 Bacteria 92635
364 Ga0207676_10014026 3300026095 Bacteria 5754
365 Ga0207674_10000163 3300026116 Bacteria 79568
366 Ga0207674_10000203 3300026116 Bacteria 73537
367 Ga0207674_10037976 3300026116 Bacteria 5003
368 Ga0207675_100091907 3300026118 Bacteria 2854
369 Ga0207675_100187617 3300026118 Bacteria 1982
370 Ga0207683_10002797 3300026121 Bacteria 15233
371 Ga0207698_10022645 3300026142 Bacteria 4371
372 Ga0207698_10038679 3300026142 Bacteria 3527
373 Ga0268265_10162606 3300028380 Bacteria 1898
374 Ga0268264_10012292 3300028381 Bacteria 7046
375 Ga0268264_10037354 3300028381 Bacteria 4005
376 Ga0265338_10029070 3300028800 Bacteria 5492
377 Ga0265338_10115137 3300028800 Bacteria 2156
378 Ga0265760_10000222 3300031090 Bacteria 15502
379 Ga0265330_10015543 3300031235 Bacteria 3519
380 Ga0265325_10002851 3300031241 Bacteria 11529
381 Ga0265325_10004666 3300031241 Bacteria 8595
382 Ga0265340_10014992 3300031247 Bacteria 4036
383 Ga0265339_10069109 3300031249 Bacteria 1886
384 Ga0265331_10009323 3300031250 Bacteria 5517
385 Ga0265327_10020420 3300031251 Bacteria 4036
386 Ga0265316_10000914 3300031344 Bacteria 32110
387 Ga0265316_10019003 3300031344 Bacteria 5892
388 Ga0265316_10043165 3300031344 Bacteria 3598
389 Ga0265316_10165925 3300031344 Bacteria 1649
390 Ga0265313_10015779 3300031595 Bacteria 4376
391 Ga0265314_10000915 3300031711 Bacteria 34762
392 Ga0307409_100017960 3300031995 Bacteria 4734
393 Ga0307414_10016770 3300032004 Bacteria 4465
394 Ga0373923_0002814 3300035111 Bacteria 5450
395 Ga0373936_0003234 3300035113 Bacteria 6110
396 Ga0373945_0003913 3300035116 Bacteria 4709
397 Ga0373953_0048794 3300035117 Bacteria 1706
398 Ga0373943_0000083 3300035170 Bacteria 33682
399 Ga0373943_0041569 3300035170 Bacteria 2224
400 Ga0373943_0092650 3300035170 Bacteria 1567
401 Ga0373946_0002607 3300035171 Bacteria 6373
402 Ga0373924_0025686 3300035410 Bacteria 2329
403 Ga0373935_0000675 3300035692 Bacteria 18013
404 Ga0373927_0000193 3300035695 Bacteria 48831
405 Ga0373927_0055963 3300035695 Bacteria 2550
406 Ga0373933_0033054 3300035724 Bacteria 3008
407 Ga0373947_0000611 3300035725 Bacteria 21046
408 Ga0373947_0053008 3300035725 Bacteria 2445
409 Ga0373937_0002749 3300036401 Bacteria 14680
410 Ga0373937_0012656 3300036401 Bacteria 7425
411 Ga0373937_0014955 3300036401 Bacteria 6855
412 Ga0373937_0046320 3300036401 Bacteria 3977
413 Ga0373925_0016555 3300037068 Bacteria 5341
414 Ga0373925_0023285 3300037068 Bacteria 4520
415 Ga0373925_0029727 3300037068 Bacteria 4008
416 Ga0373925_0050274 3300037068 Bacteria 3109
417 Ga0395905_0012621 3300037471 Bacteria 8128
418 Ga0395905_0106925 3300037471 Bacteria 2627
419 Ga0436360_0296211 3300039438 Bacteria 1865
420 Ga0436361_0312218 3300039447 Bacteria 9562
421 Ga0436361_1195243 3300039447 Bacteria 23574
422 Ga0436363_0536010 3300039450 Bacteria 5252
423 Ga0451577_0000241 3300042876 Bacteria 108191
424 Ga0453683_0006553 3300044673 Bacteria 7983
425 Ga0453684_0000366 3300044712 Bacteria 186117
426 Ga0451576_0042708 3300045051 Bacteria 4786
427 Ga0495650_0000037 3300046471 Bacteria 390090
428 Ga0495580_0002512 3300046472 Bacteria 16001
429 Ga0495580_0004877 3300046472 Bacteria 11219
430 Ga0495580_0053794 3300046472 Bacteria 2840
431 Ga0495580_0084467 3300046472 Bacteria 2211
432 Ga0495664_0040633 3300046477 Bacteria 2751
433 Ga0495630_0164906 3300046517 Bacteria 1687
434 Ga0495669_0018005 3300046684 Bacteria 3034
435 Ga0495581_0009671 3300047315 Bacteria 5579
436 Ga0495674_0014642 3300047319 Bacteria 7340
437 Ga0495602_0141011 3300048088 Bacteria 1908
438 Ga0496100_0067289 3300048903 Bacteria 2379
439 Ga0496101_0017327 3300048904 Bacteria 4887
440 Ga0496102_0024492 3300048905 Bacteria 5367
441 Ga0496102_0060996 3300048905 Bacteria 3451
442 Ga0496103_0001140 3300048906 Bacteria 18455
443 Ga0496104_0077049 3300048907 Bacteria 3177
444 Ga0496104_0113146 3300048907 Bacteria 2603
445 Ga0496104_0140562 3300048907 Bacteria 2319
446 Ga0496105_0103287 3300048908 Bacteria 2354
447 Ga0496106_0011552 3300048909 Bacteria 6528
448 Ga0496106_0054457 3300048909 Bacteria 3022
449 Ga0496107_0037010 3300048910 Bacteria 3502
450 Ga0496107_0134919 3300048910 Bacteria 1823
451 Ga0496108_0000655 3300048911 Bacteria 26703
452 Ga0496108_0045536 3300048911 Bacteria 3664
453 Ga0496109_0000247 3300048912 Bacteria 51929
454 Ga0496109_0058455 3300048912 Bacteria 3522
455 Ga0496110_0000506 3300048913 Bacteria 26464
456 Ga0496110_0065738 3300048913 Bacteria 3207
457 Ga0496110_0236025 3300048913 Bacteria 1664
458 Ga0496111_0022188 3300048914 Bacteria 4441
459 Ga0496111_0062161 3300048914 Bacteria 2708
460 Ga0496112_0000062 3300048915 Bacteria 72601
461 Ga0496112_0000754 3300048915 Bacteria 22675
462 Ga0496112_0012461 3300048915 Bacteria 7820
463 Ga0496112_0023657 3300048915 Bacteria 5875
464 Ga0496112_0056459 3300048915 Bacteria 3864
465 Ga0496113_0007469 3300048916 Bacteria 7038
466 Ga0496114_0028235 3300048917 Bacteria 4603
467 Ga0496115_0016718 3300048918 Bacteria 5590
468 Ga0496115_0146939 3300048918 Bacteria 1946
469 Ga0501073_0010534 3300049589 Bacteria 6771
470 Ga0501083_0050280 3300049744 Bacteria 2806
471 nmdc:mga05p37_377342_c1 3300050507 Bacteria 1662
472 nmdc:mga0rr50_63101_c1 3300050513 Bacteria 2797
473 nmdc:mga0rr50_74199_c1 3300050513 Bacteria 2603
474 nmdc:mga08x19_9471_c1 3300050514 Bacteria 5835
475 nmdc:mga0a205_5284_c1 3300050515 Bacteria 11630
476 Ga0265328_10020167
477 MBSR1b_contig_11295349
478 JGI24751J29686_10004404
479 Ga0065715_10091563
480 Ga0065715_10115093
481 Ga0070676_10002402
482 Ga0070683_100032072
483 Ga0070683_100107916
484 Ga0070670_100006204
485 Ga0070670_100119618
486 Ga0068869_100004786
487 Ga0068869_100006334
488 Ga0068869_100024898
489 Ga0070666_10101886
490 Ga0070682_100006207
491 Ga0068868_100048676
492 Ga0070660_100008599
493 Ga0070689_100000875
494 Ga0070687_100085351
495 Ga0070661_100013124
496 Ga0070661_100015803
497 Ga0070668_100001377
498 Ga0070669_100087068
499 Ga0070675_100015044
500 Ga0070675_100083727
501 Ga0070671_100027495
502 Ga0070674_100002171
503 Ga0070673_100015480
504 Ga0070688_100020644
505 Ga0070659_100033793
506 Ga0070709_10022625
507 Ga0070709_10028406
508 Ga0070709_10031868
509 Ga0070714_100000040
510 Ga0070714_100004620
511 Ga0070714_100020692
512 Ga0070714_100058753
513 Ga0070714_100083293
514 Ga0070714_100127191
515 Ga0070714_100213226
516 Ga0070713_100000442
517 Ga0070713_100065555
518 Ga0070713_100092614
519 Ga0070710_10001355
520 Ga0070701_10016760
521 Ga0070711_100001759
522 Ga0070711_100066155
523 Ga0070708_100000830
524 Ga0070708_100005717
525 Ga0070708_100018309
526 Ga0070708_100020633
527 Ga0070708_100029089
528 Ga0070708_100103708
529 Ga0070662_100008173
530 Ga0070662_100031921
531 Ga0070662_100045507
532 Ga0070681_10000513
533 Ga0070681_10000775
534 Ga0068867_100017369
535 Ga0070685_10029377
536 Ga0070706_100001077
537 Ga0070706_100001512
538 Ga0070706_100016275
539 Ga0070706_100079493
540 Ga0070707_100010025
541 Ga0070707_100046770
542 Ga0070707_100049252
543 Ga0070707_100083178
544 Ga0070707_100083406
545 Ga0070698_100001953
546 Ga0070698_100011395
547 Ga0070698_100048773
548 Ga0070698_100055131
549 Ga0070699_100002129
550 Ga0070699_100002651
551 Ga0070699_100006909
552 Ga0070699_100155708
553 Ga0070679_100006393
554 Ga0070679_100019192
555 Ga0070684_100028995
556 Ga0070684_100031677
557 Ga0070684_100122452
558 Ga0070697_100000178
559 Ga0070697_100000541
560 Ga0070697_100001187
561 Ga0070697_100001901
562 Ga0070697_100002705
563 Ga0070697_100005176
564 Ga0070697_100025058
565 Ga0068853_100030013
566 Ga0070672_100001909
567 Ga0070695_100102320
568 Ga0070696_100030371
569 Ga0070696_100136816
570 Ga0070693_100049821
571 Ga0068855_100000412
572 Ga0068855_100000425
573 Ga0068855_100032861
574 Ga0068855_100078813
575 Ga0068855_100095301
576 Ga0070664_100009758
577 Ga0070664_100030524
578 Ga0070664_100031696
579 Ga0070664_100035166
580 Ga0070664_100113155
581 Ga0068857_100000034
582 Ga0068857_100034830
583 Ga0068857_100040381
584 Ga0068857_100073485
585 Ga0068854_100004112
586 Ga0068854_100009983
587 Ga0068854_100012035
588 Ga0068854_100031655
589 Ga0068856_100001577
590 Ga0068856_100001663
591 Ga0068856_100003658
592 Ga0068856_100018200
593 Ga0068856_100163179
594 Ga0070702_100079809
595 Ga0068852_100008076
596 Ga0068852_100054971
597 Ga0068859_100000279
598 Ga0068859_100011899
599 Ga0068864_100000722
600 Ga0068864_100041782
601 Ga0068864_100047759
602 Ga0068866_10000995
603 Ga0068866_10010196
604 Ga0068861_100010299
605 Ga0068861_100145541
606 Ga0068851_10007549
607 Ga0068851_10009349
608 Ga0068870_10000744
609 Ga0068863_100057353
610 Ga0068863_100104832
611 Ga0068858_100002272
612 Ga0068858_100017219
613 Ga0068862_100022763
614 Ga0081540_1013485
615 Ga0070717_10000503
616 Ga0070717_10002868
617 Ga0070717_10035021
618 Ga0070717_10056591
619 Ga0070717_10057894
620 Ga0075363_100022647
621 Ga0070715_10020917
622 Ga0070716_100007802
623 Ga0070716_100011273
624 Ga0070712_100001571
625 Ga0070712_100004155
626 Ga0070712_100005339
627 Ga0070712_100007556
628 Ga0070712_100109416
629 Ga0097621_100000210
630 Ga0097621_100000747
631 Ga0097621_100001095
632 Ga0097621_100028906
633 Ga0097621_100199393
634 Ga0068871_100000168
635 Ga0068871_100000787
636 Ga0068871_100006547
637 Ga0068871_100043027
638 Ga0075433_10005726
639 Ga0068865_100004476
640 Ga0068865_100044984
641 Ga0068865_100051811
642 Ga0097620_100000279
643 Ga0097620_100011898
644 Ga0075435_100096302
645 Ga0105240_10074324
646 Ga0105240_10107144
647 Ga0105240_10241501
648 Ga0105245_10002780
649 Ga0105245_10023966
650 Ga0105245_10032442
651 Ga0105247_10044224
652 Ga0105243_10031697
653 Ga0105241_10003234
654 Ga0105242_10041671
655 Ga0105242_10076831
656 Ga0105242_10127750
657 Ga0105248_10013124
658 Ga0105248_10042656
659 Ga0105248_10048218
660 Ga0105248_10248189
661 Ga0105237_10159798
662 Ga0105238_10017540
663 Ga0105238_10065226
664 Ga0105238_10089455
665 Ga0105238_10169352
666 Ga0105249_10004808
667 Ga0105249_10178963
668 Ga0105239_10019632
669 Ga0105239_10093169
670 Ga0105239_10167831
671 Ga0105246_10000310
672 Ga0105246_10007916
673 Ga0105246_10009850
674 Ga0157373_10071215
675 Ga0157373_10071946
676 Ga0157371_10007274
677 Ga0157369_10000269
678 Ga0157369_10009722
679 Ga0157369_10037582
680 Ga0157369_10050126
681 Ga0157374_10000436
682 Ga0157374_10002373
683 Ga0157374_10010543
684 Ga0157374_10055445
685 Ga0157374_10061838
686 Ga0157378_10000014
687 Ga0157378_10000023
688 Ga0157378_10000413
689 Ga0157378_10039952
690 Ga0157378_10049661
691 Ga0163162_10001630
692 Ga0163162_10006383
693 Ga0157372_10000423
694 Ga0157372_10001025
695 Ga0157372_10003752
696 Ga0157372_10045157
697 Ga0157372_10058439
698 Ga0157372_10073579
699 Ga0157375_10117648
700 Ga0157375_10178953
701 Ga0163163_10017908
702 Ga0163163_10103895
703 Ga0157377_10001351
704 Ga0157379_10004171
705 Ga0157379_10054198
706 Ga0157376_10046570
707 Ga0157376_10054471
708 Ga0157376_10076322
709 Ga0157376_10119756
710 Ga0182006_1015358
711 Ga0182007_10013507
712 Ga0182007_10016565
713 Ga0163161_10005689
714 Ga0213872_10002020
715 Ga0213872_10014534
716 Ga0213872_10054306
717 Ga0228598_1000009
718 Ga0207682_10006302
719 Ga0207692_10067174
720 Ga0207642_10030149
721 Ga0207688_10012262
722 Ga0207647_10001252
723 Ga0207647_10002172
724 Ga0207685_10015075
725 Ga0207699_10020326
726 Ga0207645_10000252
727 Ga0207643_10000915
728 Ga0207684_10000642
729 Ga0207684_10020486
730 Ga0207684_10028839
731 Ga0207684_10031672
732 Ga0207684_10037706
733 Ga0207654_10014337
734 Ga0207654_10026749
735 Ga0207707_10029322
736 Ga0207707_10070838
737 Ga0207695_10006554
738 Ga0207695_10020152
739 Ga0207695_10169143
740 Ga0207695_10237113
741 Ga0207671_10016452
742 Ga0207671_10057381
743 Ga0207693_10000038
744 Ga0207693_10003508
745 Ga0207693_10007492
746 Ga0207693_10008248
747 Ga0207693_10010203
748 Ga0207663_10010456
749 Ga0207662_10079299
750 Ga0207657_10000557
751 Ga0207657_10002694
752 Ga0207657_10005092
753 Ga0207649_10000124
754 Ga0207652_10009456
755 Ga0207652_10087712
756 Ga0207646_10001096
757 Ga0207646_10017991
758 Ga0207646_10084277
759 Ga0207646_10123626
760 Ga0207681_10024494
761 Ga0207694_10000430
762 Ga0207650_10000665
763 Ga0207650_10005941
764 Ga0207650_10027517
765 Ga0207659_10140179
766 Ga0207687_10000754
767 Ga0207687_10010103
768 Ga0207700_10012151
769 Ga0207700_10019287
770 Ga0207700_10068168
771 Ga0207700_10109590
772 Ga0207700_10164147
773 Ga0207664_10000029
774 Ga0207664_10031116
775 Ga0207664_10039075
776 Ga0207664_10132520
777 Ga0207690_10065429
778 Ga0207690_10067969
779 Ga0207706_10000314
780 Ga0207706_10000375
781 Ga0207706_10013010
782 Ga0207709_10017077
783 Ga0207704_10024797
784 Ga0207704_10068846
785 Ga0207665_10000085
786 Ga0207665_10007920
787 Ga0207665_10009811
788 Ga0207665_10072966
789 Ga0207665_10122176
790 Ga0207691_10001266
791 Ga0207711_10005067
792 Ga0207711_10011635
793 Ga0207711_10012287
794 Ga0207689_10000068
795 Ga0207689_10000615
796 Ga0207689_10009857
797 Ga0207689_10032425
798 Ga0207689_10066383
799 Ga0207661_10000388
800 Ga0207661_10019068
801 Ga0207679_10000051
802 Ga0207679_10009563
803 Ga0207679_10020546
804 Ga0207679_10032076
805 Ga0207667_10000311
806 Ga0207667_10002666
807 Ga0207667_10005985
808 Ga0207667_10006543
809 Ga0207651_10005848
810 Ga0207651_10040211
811 Ga0207712_10004868
812 Ga0207668_10081244
813 Ga0207640_10002549
814 Ga0207640_10055921
815 Ga0207640_10094543
816 Ga0207658_10079567
817 Ga0207677_10033698
818 Ga0207677_10034652
819 Ga0207677_10068764
820 Ga0207703_10001667
821 Ga0207703_10020874
822 Ga0207703_10042584
823 Ga0207639_10039242
824 Ga0207678_10000178
825 Ga0207678_10002437
826 Ga0207702_10001654
827 Ga0207702_10001985
828 Ga0207702_10003682
829 Ga0207702_10005648
830 Ga0207702_10091168
831 Ga0207641_10000020
832 Ga0207641_10011077
833 Ga0207641_10043468
834 Ga0207641_10046212
835 Ga0207641_10137091
836 Ga0207648_10000698
837 Ga0207648_10026170
838 Ga0207676_10000081
839 Ga0207676_10014026
840 Ga0207674_10000163
841 Ga0207674_10000203
842 Ga0207674_10037976
843 Ga0207675_100091907
844 Ga0207675_100187617
845 Ga0207683_10002797
846 Ga0207698_10022645
847 Ga0207698_10038679
848 Ga0268265_10162606
849 Ga0268264_10012292
850 Ga0268264_10037354
851 Ga0265338_10029070
852 Ga0265338_10115137
853 Ga0265760_10000222
854 Ga0265330_10015543
855 Ga0265325_10002851
856 Ga0265325_10004666
857 Ga0265340_10014992
858 Ga0265339_10069109
859 Ga0265331_10009323
860 Ga0265327_10020420
861 Ga0265316_10000914
862 Ga0265316_10019003
863 Ga0265316_10043165
864 Ga0265316_10165925
865 Ga0265313_10015779
866 Ga0265314_10000915
867 Ga0307409_100017960
868 Ga0307414_10016770
869 Ga0373923_0002814
870 Ga0373936_0003234
871 Ga0373945_0003913
872 Ga0373953_0048794
873 Ga0373943_0000083
874 Ga0373943_0041569
875 Ga0373943_0092650
876 Ga0373946_0002607
877 Ga0373924_0025686
878 Ga0373935_0000675
879 Ga0373927_0000193
880 Ga0373927_0055963
881 Ga0373933_0033054
882 Ga0373947_0000611
883 Ga0373947_0053008
884 Ga0373937_0002749
885 Ga0373937_0012656
886 Ga0373937_0014955
887 Ga0373937_0046320
888 Ga0373925_0016555
889 Ga0373925_0023285
890 Ga0373925_0029727
891 Ga0373925_0050274
892 Ga0395905_0012621
893 Ga0395905_0106925
894 Ga0436360_0296211
895 Ga0436361_0312218
896 Ga0436361_1195243
897 Ga0436363_0536010
898 Ga0451577_0000241
899 Ga0453683_0006553
900 Ga0453684_0000366
901 Ga0451576_0042708
902 Ga0495650_0000037
903 Ga0495580_0002512
904 Ga0495580_0004877
905 Ga0495580_0053794
906 Ga0495580_0084467
907 Ga0495664_0040633
908 Ga0495630_0164906
909 Ga0495669_0018005
910 Ga0495581_0009671
911 Ga0495674_0014642
912 Ga0495602_0141011
913 Ga0496100_0067289
914 Ga0496101_0017327
915 Ga0496102_0024492
916 Ga0496102_0060996
917 Ga0496103_0001140
918 Ga0496104_0077049
919 Ga0496104_0113146
920 Ga0496104_0140562
921 Ga0496105_0103287
922 Ga0496106_0011552
923 Ga0496106_0054457
924 Ga0496107_0037010
925 Ga0496107_0134919
926 Ga0496108_0000655
927 Ga0496108_0045536
928 Ga0496109_0000247
929 Ga0496109_0058455
930 Ga0496110_0000506
931 Ga0496110_0065738
932 Ga0496110_0236025
933 Ga0496111_0022188
934 Ga0496111_0062161
935 Ga0496112_0000062
936 Ga0496112_0000754
937 Ga0496112_0012461
938 Ga0496112_0023657
939 Ga0496112_0056459
940 Ga0496113_0007469
941 Ga0496114_0028235
942 Ga0496115_0016718
943 Ga0496115_0146939
944 Ga0501073_0010534
945 Ga0501083_0050280
946 nmdc:mga05p37_377342_c1
947 nmdc:mga0rr50_63101_c1
948 nmdc:mga0rr50_74199_c1
949 nmdc:mga08x19_9471_c1
950 nmdc:mga0a205_5284_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02637

GatB_Yqey

GatB domain

333

480

0.99

PF02934

GatB_N

GatB/GatE catalytic domain

17

303

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h0l-assembly2.cif.gz_E structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.9237 38 450
3h0l-assembly2.cif.gz_E structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.9173 38 450
2g5h-assembly1.cif.gz_B structure of trna-dependent amidotransferase gatcab 0.8963 40 433
4wj3-assembly2.cif.gz_H crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.8852 40 440
2g5h-assembly1.cif.gz_B structure of trna-dependent amidotransferase gatcab 0.8732 40 433
ID Description Score Start End Superfamily
af_I1KQC8_485_546_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.985 455 516 1.10.10.410
af_I1K5J4_480_543_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9834 455 515 1.10.10.410
af_Q7T010_492_552_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9793 455 514 1.10.10.410
af_Q2R2Z0_480_542_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9777 455 515 1.10.10.410
af_Q9UT77_462_524_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9748 455 515 1.10.10.410
ID Description Score Start End GO Terms
AF-A0A2V9YS75-F1-model_v4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT subunit B) (EC 6.3.5.-) 0.9509 33 515 GO:0005524
GO:0006412
GO:0016740
GO:0050566
GO:0050567
GO:0070681
AF-A0A3N5Z2W4-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB 0.9365 39 384 GO:0005524
GO:0006412
GO:0016740
GO:0050567
GO:0070681
AF-A0A7W1VYF4-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB 0.9365 39 425 GO:0005524
GO:0006412
GO:0016740
GO:0050567
GO:0070681
AF-A0A0J7KXP1-F1-model_v4 Multifunctional fusion protein [Includes: Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial (Glu-AdT subunit B) (EC 6.3.5.-); Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial (Glu-AdT subunit A) (EC 6.3.5.7)] 0.9361 39 515 GO:0005524
GO:0005739
GO:0016740
GO:0030956
GO:0032543
GO:0050566
GO:0050567
GO:0070681
AF-K1U974-F1-model_v4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 0.9361 92 302 GO:0005524
GO:0006412
GO:0016740
GO:0050567
GO:0070681

Map