F451394

General Info

Members Datasets Scaffolds Average Seq Length
475 232 468 158

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0060587|Ga0466972_0060587_19_594
Length 191
Sequence LCASDAEDARLPGQGGAVMVEGRGLGAVRTLAEDAVYVVKSPLSDPDLKTVAEALQGALVDLLDLSLMAKQIHWNIIGPRFRSIHLQLDEVVDTARQHSDTVAERASALGVPPDGRAGTVARSSGIGSVPQGWVKDTDAVGTLVSALGAVIARMRERVEVTAEADPVSQDIFIAVTADLEKHHWMFQAENG

Samples

Sample ID Description Type Environment
1 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
2 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
3 2867369537 Streptomyces sp. Z26 Isolate Unclassified
4 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
5 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
6 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
26 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
27 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
28 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
31 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
43 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
44 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
57 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
58 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
59 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
62 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
63 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
64 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
65 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
66 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
67 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
68 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
69 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
70 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
71 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
72 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
73 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
74 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
75 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
161 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
162 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
209 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
210 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
211 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
212 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
213 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
216 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
217 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
218 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
219 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
220 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
221 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
222 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
225 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
226 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
227 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 2.32
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.47
Nodule 0.21
Rhizoplane 0.84
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10054619 3300002067 Bacteria 1151
2 rootH2_10043623 3300003320 Bacteria 4120
3 rootL2_10265815 3300003322 Bacteria 1320
4 rootH1_10033745 3300003323 Bacteria 3491
5 JGI25160J50197_1029549 3300003354 Bacteria 1446
6 Ga0006562J51391_1080552 3300003578 Bacteria 2420
7 Ga0006562J51391_1080556 3300003578 Bacteria 1190
8 Ga0058861_11345383 3300004800 Bacteria 559
9 Ga0058860_11989380 3300004801 Bacteria 1262
10 Ga0068853_100359049 3300005539 Bacteria 1357
11 Ga0068854_100438964 3300005578 Bacteria 1088
12 Ga0075368_10093537 3300006042 Bacteria 1231
13 Ga0075363_100013892 3300006048 Bacteria 3919
14 Ga0075363_100125823 3300006048 Bacteria 1435
15 Ga0075367_10000581 3300006178 Bacteria 13993
16 Ga0075370_10027344 3300006353 Bacteria 3164
17 Ga0105238_10094267 3300009551 Bacteria 2981
18 Ga0105246_10097485 3300011119 Bacteria 2134
19 Ga0157372_10510752 3300013307 Bacteria 1401
20 Ga0182008_10003109 3300014497 Bacteria 10168
21 Ga0182007_10000210 3300015262 Bacteria 39149
22 Ga0182005_1024939 3300015265 Bacteria 1632
23 Ga0183367_1001 3300015688 Bacteria 1225545
24 Ga0183367_1019 3300015688 Bacteria 100516
25 Ga0197907_11443965 3300020069 Bacteria 553
26 Ga0206349_1916094 3300020075 Bacteria 558
27 Ga0206355_1236033 3300020076 Bacteria 893
28 Ga0206351_10042917 3300020077 Bacteria 678
29 Ga0206350_10361717 3300020080 Bacteria 1235
30 Ga0224712_10099613 3300022467 Bacteria 1230
31 Ga0224712_10340307 3300022467 Bacteria 707
32 Ga0209758_1003914 3300025297 Bacteria 12992
33 Ga0207426_1001178 3300025302 Bacteria 23387
34 Ga0207426_1022704 3300025302 Bacteria 2150
35 Ga0207426_1029250 3300025302 Bacteria 1819
36 Ga0207426_1061721 3300025302 Bacteria 1075
37 Ga0207647_10195403 3300025904 Bacteria 1171
38 Ga0207652_10061678 3300025921 Bacteria 3238
39 Ga0207711_11142562 3300025941 Bacteria 720
40 Ga0207661_10238693 3300025944 Bacteria 1612
41 Ga0207640_10624822 3300025981 Bacteria 915
42 Ga0209371_1023559 3300027312 Bacteria 1448
43 Ga0307517_10004476 3300028786 Bacteria 21448
44 Ga0268256_1032081 3300030500 Bacteria 1255
45 Ga0307512_10009194 3300030522 Bacteria 9549
46 Ga0307512_10043630 3300030522 Bacteria 3696
47 Ga0307513_10002713 3300031456 Bacteria 24368
48 Ga0307513_10476607 3300031456 Bacteria 968
49 Ga0307509_10260959 3300031507 Bacteria 1508
50 Ga0307508_10005933 3300031616 Bacteria 11527
51 Ga0307508_10116246 3300031616 Bacteria 2276
52 Ga0307514_10061802 3300031649 Bacteria 2851
53 Ga0307514_10077464 3300031649 Bacteria 2473
54 Ga0307514_10088685 3300031649 Bacteria 2262
55 Ga0307514_10223036 3300031649 Bacteria 1153
56 Ga0307516_10124172 3300031730 Bacteria 2368
57 Ga0307516_10394792 3300031730 Bacteria 1043
58 Ga0307518_10169319 3300031838 Bacteria 1491
59 Ga0307518_10213938 3300031838 Bacteria 1266
60 Ga0307411_10332176 3300032005 Bacteria 1232
61 Ga0307510_10035289 3300033180 Bacteria 5588
62 Ga0395899_0820502 3300037312 Bacteria 573
63 Ga0395900_0064559 3300037418 Bacteria 3762
64 Ga0395900_1054240 3300037418 Bacteria 731
65 Ga0395900_1828955 3300037418 Bacteria 518
66 Ga0395898_0165770 3300037466 Bacteria 2113
67 Ga0439439_0021458 3300041406 Bacteria 1609
68 Ga0439439_0057143 3300041406 Bacteria 1032
69 Ga0439439_0117484 3300041406 Bacteria 740
70 Ga0439466_0214196 3300041411 Bacteria 585
71 Ga0451797_0586783 3300041453 Bacteria 716
72 Ga0451797_1231293 3300041453 Bacteria 590
73 Ga0451833_0418675 3300041491 Bacteria 1270
74 Ga0451853_0074895 3300041512 Bacteria 1148
75 Ga0451853_0076768 3300041512 Bacteria 3380
76 Ga0439433_0012431 3300041999 Bacteria 1866
77 Ga0439433_0086856 3300041999 Bacteria 765
78 Ga0439448_0002017 3300042005 Bacteria 5427
79 Ga0439448_0027354 3300042005 Bacteria 1797
80 Ga0439449_0007320 3300042007 Bacteria 4193
81 Ga0439449_0131231 3300042007 Bacteria 931
82 Ga0439454_017906 3300042011 Bacteria 1016
83 Ga0439455_0000112 3300042012 Bacteria 8240
84 Ga0439455_0000533 3300042012 Bacteria 5339
85 Ga0439457_001999 3300042014 Bacteria 5989
86 Ga0439457_007443 3300042014 Bacteria 2626
87 Ga0439457_098239 3300042014 Bacteria 681
88 Ga0439457_121461 3300042014 Bacteria 617
89 Ga0439462_0056418 3300042015 Bacteria 1060
90 Ga0450894_000023 3300042131 Bacteria 21730
91 Ga0450896_005348 3300042133 Bacteria 1752
92 Ga0450896_009911 3300042133 Bacteria 1332
93 Ga0450899_001436 3300042135 Bacteria 2659
94 Ga0450899_001637 3300042135 Bacteria 2480
95 Ga0450903_000018 3300042138 Bacteria 32017
96 Ga0450903_000028 3300042138 Bacteria 29850
97 Ga0450906_018390 3300042145 Bacteria 1254
98 Ga0450906_049134 3300042145 Bacteria 744
99 Ga0450906_061119 3300042145 Bacteria 670
100 Ga0439458_0004585 3300042157 Bacteria 3161
101 Ga0439458_0005682 3300042157 Bacteria 2795
102 Ga0450908_006742 3300042184 Bacteria 2174
103 Ga0450908_033217 3300042184 Bacteria 894
104 Ga0450909_038151 3300042185 Bacteria 737
105 Ga0466969_0003894 3300044656 Bacteria 7922
106 Ga0466969_0046812 3300044656 Bacteria 2143
107 Ga0466972_0003530 3300044658 Bacteria 7763
108 Ga0466972_0060587 3300044658 Bacteria 1815
109 Ga0466972_0129316 3300044658 Bacteria 1189
110 Ga0466972_0283371 3300044658 Bacteria 774
111 Ga0466972_0315449 3300044658 Bacteria 730
112 Ga0466972_0359179 3300044658 Bacteria 681
113 Ga0466965_0017003 3300044683 Bacteria 3470
114 Ga0466965_0147730 3300044683 Bacteria 1227
115 Ga0466966_0000327 3300044684 Bacteria 30788
116 Ga0466966_0053968 3300044684 Bacteria 2548
117 Ga0466966_0226892 3300044684 Bacteria 1127
118 Ga0466961_0000836 3300044693 Bacteria 19234
119 Ga0466961_0005113 3300044693 Bacteria 8257
120 Ga0466961_0041471 3300044693 Bacteria 2951
121 Ga0466963_0007639 3300044694 Bacteria 6455
122 Ga0466963_0039728 3300044694 Bacteria 3082
123 Ga0466963_0732603 3300044694 Bacteria 697
124 Ga0466964_0001230 3300044706 Bacteria 8690
125 Ga0466971_0000392 3300044719 Bacteria 16939
126 Ga0466971_0004812 3300044719 Bacteria 5846
127 Ga0466971_0060510 3300044719 Bacteria 1712
128 Ga0466971_0126657 3300044719 Bacteria 1184
129 Ga0466970_0000256 3300044765 Bacteria 26142
130 Ga0466970_0122155 3300044765 Bacteria 1427
131 Ga0466957_0000809 3300044842 Bacteria 15950
132 Ga0466957_0669383 3300044842 Bacteria 731
133 Ga0466960_0002070 3300044901 Bacteria 7461
134 Ga0466960_0012345 3300044901 Bacteria 3602
135 Ga0466960_0118378 3300044901 Bacteria 1385
136 Ga0466960_0150156 3300044901 Bacteria 1244
137 Ga0466959_0013094 3300045049 Bacteria 6006
138 Ga0466959_0016967 3300045049 Bacteria 5329
139 Ga0466958_0000126 3300045836 Bacteria 25142
140 Ga0466958_0211520 3300045836 Bacteria 1236
141 Ga0466958_0805049 3300045836 Bacteria 613
142 Ga0466967_0004337 3300045976 Bacteria 9540
143 Ga0466967_0025529 3300045976 Bacteria 4875
144 Ga0466967_0124301 3300045976 Bacteria 2388
145 Ga0466967_0574332 3300045976 Bacteria 1111
146 Ga0466967_1772351 3300045976 Bacteria 615
147 Ga0495627_054734 3300046453 Bacteria 1192
148 Ga0495627_151869 3300046453 Bacteria 646
149 Ga0495592_0012495 3300046454 Bacteria 6452
150 Ga0495603_0006158 3300046455 Bacteria 7170
151 Ga0495603_0011467 3300046455 Bacteria 5365
152 Ga0495603_0025388 3300046455 Bacteria 3583
153 Ga0495629_0032663 3300046459 Bacteria 3684
154 Ga0495629_0194360 3300046459 Bacteria 1403
155 Ga0495629_0265507 3300046459 Bacteria 1179
156 Ga0495638_0042152 3300046460 Bacteria 2884
157 Ga0495651_0052083 3300046462 Bacteria 3154
158 Ga0495651_0123106 3300046462 Bacteria 1902
159 Ga0495580_0321711 3300046472 Bacteria 1051
160 Ga0495582_0246144 3300046473 Bacteria 1025
161 Ga0495605_0076779 3300046474 Bacteria 1568
162 Ga0495605_0164318 3300046474 Bacteria 984
163 Ga0495639_0024417 3300046475 Bacteria 2661
164 Ga0495662_0011138 3300046476 Bacteria 4394
165 Ga0495662_0014903 3300046476 Bacteria 3777
166 Ga0495662_0149198 3300046476 Bacteria 1151
167 Ga0495664_0284176 3300046477 Bacteria 999
168 Ga0495664_0468691 3300046477 Bacteria 753
169 Ga0495584_0057884 3300046491 Bacteria 1950
170 Ga0495585_0032898 3300046492 Bacteria 2937
171 Ga0495585_0046875 3300046492 Bacteria 2409
172 Ga0495585_0241167 3300046492 Bacteria 905
173 Ga0495594_0016378 3300046499 Bacteria 3905
174 Ga0495594_0068323 3300046499 Bacteria 1973
175 Ga0495594_0125815 3300046499 Bacteria 1450
176 Ga0495596_0161016 3300046500 Bacteria 872
177 Ga0495607_0042896 3300046501 Bacteria 2678
178 Ga0495607_0199780 3300046501 Bacteria 990
179 Ga0495583_0017706 3300046506 Bacteria 3775
180 Ga0495583_0098068 3300046506 Bacteria 1253
181 Ga0495606_0066745 3300046507 Bacteria 2280
182 Ga0495606_0606012 3300046507 Bacteria 536
183 Ga0495608_0109919 3300046511 Bacteria 1772
184 Ga0495610_0120767 3300046512 Bacteria 1149
185 Ga0495616_0070938 3300046513 Bacteria 1685
186 Ga0495618_0122457 3300046514 Bacteria 1666
187 Ga0495618_0262816 3300046514 Bacteria 1080
188 Ga0495620_0025352 3300046515 Bacteria 2806
189 Ga0495620_0087102 3300046515 Bacteria 1256
190 Ga0495628_0029239 3300046516 Bacteria 4470
191 Ga0495628_0056152 3300046516 Bacteria 3100
192 Ga0495628_0349672 3300046516 Bacteria 1087
193 Ga0495631_0032940 3300046518 Bacteria 2331
194 Ga0495632_0397204 3300046519 Bacteria 602
195 Ga0495643_0002847 3300046522 Bacteria 13158
196 Ga0495643_0019362 3300046522 Bacteria 3938
197 Ga0495644_0400172 3300046523 Bacteria 543
198 Ga0495648_0201055 3300046524 Bacteria 997
199 Ga0495648_0392466 3300046524 Bacteria 622
200 Ga0495666_0006497 3300046526 Bacteria 5887
201 Ga0495642_0206783 3300046528 Bacteria 856
202 Ga0495652_0130175 3300046529 Bacteria 1993
203 Ga0495654_0250188 3300046530 Bacteria 738
204 Ga0495640_0024380 3300046533 Bacteria 4402
205 Ga0495640_0029959 3300046533 Bacteria 3900
206 Ga0495640_0051144 3300046533 Bacteria 2841
207 Ga0495587_0166922 3300046536 Bacteria 1251
208 Ga0495609_0004538 3300046538 Bacteria 7549
209 Ga0495597_0034840 3300046542 Bacteria 2273
210 Ga0495597_0161700 3300046542 Bacteria 913
211 Ga0495645_0029459 3300046543 Bacteria 3993
212 Ga0495622_0084643 3300046557 Bacteria 1458
213 Ga0495622_0184704 3300046557 Bacteria 934
214 Ga0495633_0007379 3300046558 Bacteria 6332
215 Ga0495633_0044251 3300046558 Bacteria 2110
216 Ga0495667_0519354 3300046559 Bacteria 745
217 Ga0495656_0243612 3300046615 Bacteria 906
218 Ga0495668_0009753 3300046616 Bacteria 5864
219 Ga0495668_0259901 3300046616 Bacteria 950
220 Ga0495634_0012846 3300046642 Bacteria 6061
221 Ga0495634_0124876 3300046642 Bacteria 1645
222 Ga0495611_0041924 3300046648 Bacteria 2042
223 Ga0495611_0176548 3300046648 Bacteria 998
224 Ga0495625_0091732 3300046660 Bacteria 2099
225 Ga0495625_0744907 3300046660 Bacteria 575
226 Ga0495635_0116968 3300046663 Bacteria 1819
227 Ga0495635_0435233 3300046663 Bacteria 868
228 Ga0495661_0169170 3300046665 Bacteria 1167
229 Ga0495588_0055612 3300046674 Bacteria 2042
230 Ga0495588_0149955 3300046674 Bacteria 1232
231 Ga0495588_0439660 3300046674 Bacteria 684
232 Ga0495657_0074225 3300046675 Bacteria 2213
233 Ga0495623_0202161 3300046679 Bacteria 1142
234 Ga0495613_0071219 3300046689 Bacteria 2534
235 Ga0495613_0095100 3300046689 Bacteria 2155
236 Ga0495613_0261110 3300046689 Bacteria 1206
237 Ga0495613_0653508 3300046689 Bacteria 695
238 Ga0495624_0181551 3300046690 Bacteria 1282
239 Ga0495624_0284284 3300046690 Bacteria 998
240 Ga0495624_0400084 3300046690 Bacteria 824
241 Ga0495670_0034446 3300046691 Bacteria 2522
242 Ga0495670_0385893 3300046691 Bacteria 756
243 Ga0495649_0049062 3300046694 Bacteria 2293
244 Ga0495649_0094034 3300046694 Bacteria 1596
245 Ga0495649_0163899 3300046694 Bacteria 1165
246 Ga0495649_0239934 3300046694 Bacteria 933
247 Ga0495589_0146567 3300046794 Bacteria 1128
248 Ga0495589_0165873 3300046794 Bacteria 1051
249 Ga0495589_0223722 3300046794 Bacteria 883
250 Ga0495600_0093687 3300046809 Bacteria 1958
251 Ga0495600_0106830 3300046809 Bacteria 1823
252 Ga0495660_0020572 3300046810 Bacteria 3783
253 Ga0495604_0053191 3300047317 Bacteria 3131
254 Ga0495604_0103961 3300047317 Bacteria 2082
255 Ga0495636_0006090 3300047318 Bacteria 4735
256 Ga0495636_0045558 3300047318 Bacteria 1828
257 Ga0495636_0167302 3300047318 Bacteria 993
258 Ga0495636_0218868 3300047318 Bacteria 874
259 Ga0495636_0283993 3300047318 Bacteria 771
260 Ga0495636_0449742 3300047318 Bacteria 618
261 Ga0495674_0182242 3300047319 Bacteria 1748
262 Ga0495672_0110830 3300047320 Bacteria 1473
263 Ga0495676_0003653 3300047321 Bacteria 13953
264 Ga0495676_0059596 3300047321 Bacteria 2996
265 Ga0495676_0298684 3300047321 Bacteria 1086
266 Ga0495680_0018338 3300047322 Bacteria 5944
267 Ga0495683_0087567 3300047323 Bacteria 1512
268 Ga0495687_005104 3300047443 Bacteria 8510
269 Ga0495687_007279 3300047443 Bacteria 6559
270 Ga0495687_077163 3300047443 Bacteria 1316
271 Ga0495687_084636 3300047443 Bacteria 1232
272 Ga0495687_200733 3300047443 Bacteria 633
273 Ga0495675_0142420 3300047444 Bacteria 1485
274 Ga0495675_0306790 3300047444 Bacteria 941
275 Ga0495675_0335405 3300047444 Bacteria 892
276 Ga0495677_0096209 3300047445 Bacteria 1118
277 Ga0495677_0234645 3300047445 Bacteria 716
278 Ga0495679_056861 3300047446 Bacteria 1158
279 Ga0495685_000747 3300047447 Bacteria 9975
280 Ga0495685_017678 3300047447 Bacteria 2443
281 Ga0495685_058862 3300047447 Bacteria 1296
282 Ga0495685_058871 3300047447 Bacteria 1296
283 Ga0495673_0228601 3300047469 Bacteria 686
284 Ga0495681_0001605 3300047470 Bacteria 16822
285 Ga0495681_0158271 3300047470 Bacteria 945
286 Ga0495684_0358906 3300047471 Bacteria 1033
287 Ga0495686_0245458 3300047472 Bacteria 1008
288 Ga0495614_0274842 3300048089 Bacteria 775
289 Ga0495626_0007359 3300048091 Bacteria 6132
290 Ga0495626_0191827 3300048091 Bacteria 842
291 Ga0496108_0090828 3300048911 Bacteria 2596
292 Ga0496110_1612331 3300048913 Bacteria 559
293 Ga0495678_234330 3300049459 Bacteria 551
294 Ga0501031_0007893 3300049568 Bacteria 6927
295 Ga0501031_0358297 3300049568 Bacteria 944
296 Ga0501031_0408082 3300049568 Bacteria 878
297 Ga0501031_0650446 3300049568 Bacteria 677
298 Ga0501032_0002476 3300049569 Bacteria 14418
299 Ga0501032_0010709 3300049569 Bacteria 6599
300 Ga0501032_0029964 3300049569 Bacteria 3732
301 Ga0501032_0095779 3300049569 Bacteria 1967
302 Ga0501032_0464268 3300049569 Bacteria 810
303 Ga0501033_0011219 3300049570 Bacteria 6862
304 Ga0501033_0049043 3300049570 Bacteria 3135
305 Ga0501033_0058759 3300049570 Bacteria 2840
306 Ga0501033_0079785 3300049570 Bacteria 2401
307 Ga0501033_0204471 3300049570 Bacteria 1409
308 Ga0501034_0001799 3300049571 Bacteria 27362
309 Ga0501034_0005069 3300049571 Bacteria 14469
310 Ga0501034_0017002 3300049571 Bacteria 7456
311 Ga0501034_0029376 3300049571 Bacteria 5587
312 Ga0501034_0035382 3300049571 Bacteria 5063
313 Ga0501034_0083387 3300049571 Bacteria 3198
314 Ga0501034_0432095 3300049571 Bacteria 1236
315 Ga0501034_0746018 3300049571 Bacteria 875
316 Ga0501036_0001032 3300049572 Bacteria 21031
317 Ga0501036_0002121 3300049572 Bacteria 15482
318 Ga0501036_0012118 3300049572 Bacteria 7147
319 Ga0501036_0033952 3300049572 Bacteria 4315
320 Ga0501036_0036927 3300049572 Bacteria 4133
321 Ga0501036_0140758 3300049572 Bacteria 2036
322 Ga0501036_0330114 3300049572 Bacteria 1274
323 Ga0501036_1279298 3300049572 Bacteria 596
324 Ga0501037_0002582 3300049573 Bacteria 13082
325 Ga0501037_0003989 3300049573 Bacteria 10701
326 Ga0501037_0004985 3300049573 Bacteria 9653
327 Ga0501037_0164155 3300049573 Bacteria 1582
328 Ga0501037_0171194 3300049573 Bacteria 1543
329 Ga0501038_0009331 3300049574 Bacteria 8999
330 Ga0501038_0027101 3300049574 Bacteria 5100
331 Ga0501038_0028115 3300049574 Bacteria 4995
332 Ga0501038_0036249 3300049574 Bacteria 4330
333 Ga0501038_0053902 3300049574 Bacteria 3460
334 Ga0501038_0139229 3300049574 Bacteria 1987
335 Ga0501038_0238050 3300049574 Bacteria 1446
336 Ga0501039_0003392 3300049575 Bacteria 11910
337 Ga0501039_0017638 3300049575 Bacteria 5475
338 Ga0501039_0022252 3300049575 Bacteria 4866
339 Ga0501039_0058372 3300049575 Bacteria 2989
340 Ga0501039_0092206 3300049575 Bacteria 2361
341 Ga0501040_0010279 3300049576 Bacteria 6120
342 Ga0501041_0001503 3300049577 Bacteria 12931
343 Ga0501042_0005235 3300049578 Bacteria 8334
344 Ga0501042_0009389 3300049578 Bacteria 6518
345 Ga0501042_0010455 3300049578 Bacteria 6225
346 Ga0501043_0001820 3300049579 Bacteria 18305
347 Ga0501043_0003644 3300049579 Bacteria 12641
348 Ga0501043_0013307 3300049579 Bacteria 6433
349 Ga0501043_0070071 3300049579 Bacteria 2754
350 Ga0501043_0073964 3300049579 Bacteria 2676
351 Ga0501043_0075220 3300049579 Bacteria 2653
352 Ga0501043_0119156 3300049579 Bacteria 2070
353 Ga0501043_0540768 3300049579 Bacteria 866
354 Ga0501043_0819242 3300049579 Bacteria 672
355 Ga0501046_0040645 3300049580 Bacteria 3714
356 Ga0501046_0055434 3300049580 Bacteria 3114
357 Ga0501046_0061950 3300049580 Bacteria 2923
358 Ga0501047_0000074 3300049581 Bacteria 125728
359 Ga0501047_0000612 3300049581 Bacteria 37733
360 Ga0501047_0004363 3300049581 Bacteria 13310
361 Ga0501047_0022246 3300049581 Bacteria 6090
362 Ga0501047_0024184 3300049581 Bacteria 5833
363 Ga0501047_0031912 3300049581 Bacteria 5083
364 Ga0501047_0050978 3300049581 Bacteria 3997
365 Ga0501047_0058244 3300049581 Bacteria 3732
366 Ga0501047_0080350 3300049581 Bacteria 3134
367 Ga0501047_0089577 3300049581 Bacteria 2954
368 Ga0501047_0452694 3300049581 Bacteria 1113
369 Ga0501047_0689098 3300049581 Bacteria 840
370 Ga0501047_0732365 3300049581 Bacteria 805
371 Ga0501048_0006349 3300049582 Bacteria 8990
372 Ga0501048_0006577 3300049582 Bacteria 8834
373 Ga0501048_0031765 3300049582 Bacteria 3818
374 Ga0501048_0278428 3300049582 Bacteria 1189
375 Ga0501067_0150741 3300049583 Bacteria 1295
376 Ga0501068_0005307 3300049584 Bacteria 7040
377 Ga0501068_0628434 3300049584 Bacteria 700
378 Ga0501069_0038925 3300049585 Bacteria 2625
379 Ga0501070_0006363 3300049586 Bacteria 10051
380 Ga0501070_0016804 3300049586 Bacteria 6142
381 Ga0501070_0105928 3300049586 Bacteria 2324
382 Ga0501070_0132275 3300049586 Bacteria 2061
383 Ga0501070_0268715 3300049586 Bacteria 1393
384 Ga0501070_0407824 3300049586 Bacteria 1098
385 Ga0501070_0569858 3300049586 Unclassified 905
386 Ga0501071_0004954 3300049587 Bacteria 8506
387 Ga0501072_0052767 3300049588 Bacteria 3201
388 Ga0501073_0071839 3300049589 Bacteria 2410
389 Ga0501073_0718271 3300049589 Bacteria 689
390 Ga0501073_1102902 3300049589 Bacteria 545
391 Ga0501074_0000518 3300049590 Bacteria 23708
392 Ga0501074_0056977 3300049590 Bacteria 2816
393 Ga0501076_0004399 3300049592 Bacteria 10015
394 Ga0501079_0092824 3300049741 Bacteria 2338
395 Ga0501080_0078507 3300049742 Bacteria 3070
396 Ga0501080_0095600 3300049742 Bacteria 2759
397 Ga0501080_0342414 3300049742 Bacteria 1351
398 Ga0501083_0063004 3300049744 Bacteria 2473
399 Ga0501035_0001339 3300049822 Bacteria 25392
400 Ga0501035_0007127 3300049822 Bacteria 10451
401 Ga0501035_0020225 3300049822 Bacteria 6113
402 Ga0501035_0023808 3300049822 Bacteria 5618
403 Ga0501035_0128940 3300049822 Bacteria 2206
404 Ga0501035_0203781 3300049822 Bacteria 1695
405 Ga0501035_0292640 3300049822 Bacteria 1374
406 Ga0501035_0343770 3300049822 Bacteria 1249
407 Ga0501035_0551412 3300049822 Bacteria 944
408 Ga0501035_0813634 3300049822 Bacteria 746
409 Ga0501044_0001473 3300049823 Bacteria 27597
410 Ga0501044_0013710 3300049823 Bacteria 8761
411 Ga0501044_0026456 3300049823 Bacteria 6139
412 Ga0501044_0046932 3300049823 Bacteria 4469
413 Ga0501044_0059920 3300049823 Bacteria 3899
414 Ga0501044_0067940 3300049823 Bacteria 3631
415 Ga0501044_0238396 3300049823 Bacteria 1763
416 Ga0501044_0286683 3300049823 Bacteria 1579
417 Ga0501044_0363243 3300049823 Bacteria 1365
418 Ga0501044_0472659 3300049823 Bacteria 1157
419 Ga0501044_0717574 3300049823 Bacteria 884
420 Ga0501044_0730659 3300049823 Bacteria 873
421 Ga0501045_0017023 3300049824 Bacteria 5162
422 Ga0501045_0080596 3300049824 Bacteria 2400
423 Ga0501045_0122600 3300049824 Bacteria 1930
424 Ga0501045_0155144 3300049824 Bacteria 1704
425 Ga0501045_0176238 3300049824 Bacteria 1593
426 nmdc:mga03n38_12313_c1 3300050490 Bacteria 3214
427 nmdc:mga03n38_13879_c1 3300050490 Bacteria 3073
428 nmdc:mga03n38_203569_c1 3300050490 Bacteria 1025
429 nmdc:mga03n38_7795_c1 3300050490 Bacteria 3802
430 nmdc:mga06z11_728_c1 3300050494 Bacteria 12021
431 nmdc:mga04h51_9852_c1 3300050495 Bacteria 2606
432 nmdc:mga07m45_20721_c1 3300050496 Bacteria 3573
433 nmdc:mga07m45_64833_c1 3300050496 Bacteria 2073
434 Ga0495655_0046643 3300053083 Bacteria 1130
435 Ga0500578_0007037 3300053086 Bacteria 7450
436 Ga0500578_0350393 3300053086 Bacteria 863
437 Ga0500646_0154293 3300053090 Bacteria 762
438 Ga0500651_0248496 3300053093 Bacteria 1035
439 Ga0500654_080366 3300053099 Bacteria 1523
440 Ga0500660_191004 3300053100 Bacteria 721
441 Ga0500553_116085 3300053101 Bacteria 1114
442 Ga0500556_0263468 3300053104 Bacteria 677
443 Ga0500560_039132 3300053107 Bacteria 1478
444 Ga0500560_128780 3300053107 Bacteria 847
445 Ga0500569_003061 3300053109 Bacteria 3370
446 Ga0500594_0218004 3300053118 Bacteria 630
447 Ga0500628_013422 3300053129 Bacteria 1529
448 Ga0500652_013194 3300053131 Bacteria 2919
449 Ga0500658_0262685 3300053134 Bacteria 793
450 Ga0500561_0071047 3300053137 Bacteria 995
451 Ga0500573_0141384 3300053140 Bacteria 1325
452 Ga0500579_087810 3300053143 Bacteria 1698
453 Ga0500600_0001065 3300053149 Bacteria 13984
454 Ga0500600_0276275 3300053149 Bacteria 735
455 Ga0500603_202258 3300053150 Bacteria 630
456 Ga0500616_0021934 3300053153 Bacteria 3571
457 Ga0500633_0000261 3300053160 Bacteria 7647
458 Ga0500634_0000647 3300053161 Bacteria 11777
459 Ga0500656_018535 3300053732 Bacteria 842
460 Ga0500587_003667 3300053739 Bacteria 2134
461 Ga0501084_0047666 3300054114 Bacteria 3588
462 Ga0501084_0236523 3300054114 Bacteria 1542
463 Ga0501082_0004568 3300060353 Bacteria 12087
464 Ga0466962_0000069 3300061719 Bacteria 42565
465 Ga0466962_0006493 3300061719 Bacteria 5613
466 Ga0466962_0089102 3300061719 Bacteria 1478
467 Ga0466962_0111125 3300061719 Bacteria 1319
468 Ga0530510_0214932 3300061734 Bacteria 1428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2862281513 2862284236 154
2 iso_pu_bacteria 2863404153 2863409018 154
3 iso_pu_bacteria 2867369537 2867373968 154
4 iso_pu_bacteria 2990059506 2990067360 154
5 iso_pu_bacteria 2990088156 2990091458 154
6 iso_pu_bacteria 8008558824 8008563173 154
7 3300020075 Ga0206349_1916094 Ga0206349_19160941 155
8 3300025921 Ga0207652_10061678 Ga0207652_100616783 155
9 3300049572 Ga0501036_0001032 Ga0501036_0001032_11891_12358 155
10 3300049572 Ga0501036_1279298 Ga0501036_1279298_66_533 155
11 3300049573 Ga0501037_0004985 Ga0501037_0004985_6609_7076 155
12 3300049574 Ga0501038_0027101 Ga0501038_0027101_4272_4739 155
13 3300049574 Ga0501038_0139229 Ga0501038_0139229_1292_1759 155
14 3300049575 Ga0501039_0092206 Ga0501039_0092206_1525_1992 155
15 3300049578 Ga0501042_0005235 Ga0501042_0005235_3195_3662 155
16 3300049579 Ga0501043_0073964 Ga0501043_0073964_267_734 155
17 3300049579 Ga0501043_0819242 Ga0501043_0819242_146_613 155
18 3300049581 Ga0501047_0004363 Ga0501047_0004363_5506_5973 155
19 3300049581 Ga0501047_0089577 Ga0501047_0089577_1531_1998 155
20 3300049582 Ga0501048_0006349 Ga0501048_0006349_770_1237 155
21 3300049586 Ga0501070_0105928 Ga0501070_0105928_1288_1761 155
22 3300049589 Ga0501073_1102902 Ga0501073_1102902_54_521 155
23 3300049590 Ga0501074_0000518 Ga0501074_0000518_15701_16168 155
24 3300049590 Ga0501074_0056977 Ga0501074_0056977_1553_2026 155
25 3300049742 Ga0501080_0095600 Ga0501080_0095600_1695_2168 155
26 3300049822 Ga0501035_0551412 Ga0501035_0551412_271_738 155
27 3300049823 Ga0501044_0001473 Ga0501044_0001473_5124_5591 155
28 3300049823 Ga0501044_0013710 Ga0501044_0013710_6653_7120 155
29 3300003320 rootH2_10043623 rootH2_100436235 156
30 3300003322 rootL2_10265815 rootL2_102658152 156
31 3300003354 JGI25160J50197_1029549 JGI25160J50197_10295493 156
32 3300003578 Ga0006562J51391_1080552 Ga0006562J51391_10805524 156
33 3300003578 Ga0006562J51391_1080556 Ga0006562J51391_10805562 156
34 3300004800 Ga0058861_11345383 Ga0058861_113453831 156
35 3300005539 Ga0068853_100359049 Ga0068853_1003590492 156
36 3300005578 Ga0068854_100438964 Ga0068854_1004389642 156
37 3300009551 Ga0105238_10094267 Ga0105238_100942673 156
38 3300015688 Ga0183367_1019 Ga0183367_101913 156
39 3300020076 Ga0206355_1236033 Ga0206355_12360331 156
40 3300020077 Ga0206351_10042917 Ga0206351_100429171 156
41 3300022467 Ga0224712_10340307 Ga0224712_103403071 156
42 3300025297 Ga0209758_1003914 Ga0209758_10039146 156
43 3300025302 Ga0207426_1001178 Ga0207426_100117815 156
44 3300025302 Ga0207426_1022704 Ga0207426_10227042 156
45 3300025302 Ga0207426_1029250 Ga0207426_10292502 156
46 3300025302 Ga0207426_1061721 Ga0207426_10617211 156
47 3300025941 Ga0207711_11142562 Ga0207711_111425621 156
48 3300025944 Ga0207661_10238693 Ga0207661_102386933 156
49 3300025981 Ga0207640_10624822 Ga0207640_106248221 156
50 3300028786 Ga0307517_10004476 Ga0307517_1000447613 156
51 3300031507 Ga0307509_10260959 Ga0307509_102609593 156
52 3300031616 Ga0307508_10005933 Ga0307508_100059339 156
53 3300031649 Ga0307514_10223036 Ga0307514_102230362 156
54 3300031730 Ga0307516_10394792 Ga0307516_103947922 156
55 3300032005 Ga0307411_10332176 Ga0307411_103321761 156
56 3300037312 Ga0395899_0820502 Ga0395899_0820502_73_543 156
57 3300037418 Ga0395900_0064559 Ga0395900_0064559_1194_1664 156
58 3300037418 Ga0395900_1828955 Ga0395900_1828955_20_496 156
59 3300037466 Ga0395898_0165770 Ga0395898_0165770_1111_1581 156
60 3300041406 Ga0439439_0021458 Ga0439439_0021458_1088_1558 156
61 3300041406 Ga0439439_0057143 Ga0439439_0057143_191_661 156
62 3300041406 Ga0439439_0117484 Ga0439439_0117484_154_624 156
63 3300041411 Ga0439466_0214196 Ga0439466_0214196_66_536 156
64 3300041512 Ga0451853_0074895 Ga0451853_0074895_45_515 156
65 3300041512 Ga0451853_0076768 Ga0451853_0076768_596_1066 156
66 3300041999 Ga0439433_0012431 Ga0439433_0012431_732_1202 156
67 3300041999 Ga0439433_0086856 Ga0439433_0086856_219_689 156
68 3300042007 Ga0439449_0007320 Ga0439449_0007320_1350_1820 156
69 3300042014 Ga0439457_001999 Ga0439457_001999_2829_3299 156
70 3300042014 Ga0439457_098239 Ga0439457_098239_141_611 156
71 3300042014 Ga0439457_121461 Ga0439457_121461_78_548 156
72 3300042131 Ga0450894_000023 Ga0450894_000023_8439_8909 156
73 3300042133 Ga0450896_005348 Ga0450896_005348_483_953 156
74 3300042135 Ga0450899_001637 Ga0450899_001637_1635_2105 156
75 3300042145 Ga0450906_018390 Ga0450906_018390_645_1115 156
76 3300042184 Ga0450908_006742 Ga0450908_006742_278_748 156
77 3300042185 Ga0450909_038151 Ga0450909_038151_40_510 156
78 3300044656 Ga0466969_0046812 Ga0466969_0046812_298_819 156
79 3300044658 Ga0466972_0003530 Ga0466972_0003530_7190_7660 156
80 3300044658 Ga0466972_0060587 Ga0466972_0060587_19_594 156
81 3300044658 Ga0466972_0315449 Ga0466972_0315449_69_545 156
82 3300044683 Ga0466965_0147730 Ga0466965_0147730_214_735 156
83 3300044719 Ga0466971_0126657 Ga0466971_0126657_65_586 156
84 3300044765 Ga0466970_0122155 Ga0466970_0122155_539_1009 156
85 3300044901 Ga0466960_0002070 Ga0466960_0002070_906_1376 156
86 3300044901 Ga0466960_0150156 Ga0466960_0150156_617_1087 156
87 3300045976 Ga0466967_0004337 Ga0466967_0004337_8725_9195 156
88 3300046453 Ga0495627_054734 Ga0495627_054734_21_491 156
89 3300046453 Ga0495627_151869 Ga0495627_151869_43_513 156
90 3300046454 Ga0495592_0012495 Ga0495592_0012495_147_617 156
91 3300046455 Ga0495603_0006158 Ga0495603_0006158_767_1237 156
92 3300046455 Ga0495603_0011467 Ga0495603_0011467_3160_3636 156
93 3300046455 Ga0495603_0025388 Ga0495603_0025388_2185_2655 156
94 3300046459 Ga0495629_0032663 Ga0495629_0032663_2166_2636 156
95 3300046459 Ga0495629_0194360 Ga0495629_0194360_226_696 156
96 3300046459 Ga0495629_0265507 Ga0495629_0265507_542_1012 156
97 3300046460 Ga0495638_0042152 Ga0495638_0042152_119_589 156
98 3300046462 Ga0495651_0052083 Ga0495651_0052083_123_593 156
99 3300046472 Ga0495580_0321711 Ga0495580_0321711_562_1032 156
100 3300046473 Ga0495582_0246144 Ga0495582_0246144_133_603 156
101 3300046474 Ga0495605_0076779 Ga0495605_0076779_289_759 156
102 3300046474 Ga0495605_0164318 Ga0495605_0164318_149_619 156
103 3300046475 Ga0495639_0024417 Ga0495639_0024417_677_1147 156
104 3300046476 Ga0495662_0011138 Ga0495662_0011138_472_942 156
105 3300046476 Ga0495662_0014903 Ga0495662_0014903_2869_3345 156
106 3300046476 Ga0495662_0149198 Ga0495662_0149198_254_724 156
107 3300046477 Ga0495664_0284176 Ga0495664_0284176_462_932 156
108 3300046477 Ga0495664_0468691 Ga0495664_0468691_206_676 156
109 3300046491 Ga0495584_0057884 Ga0495584_0057884_1396_1866 156
110 3300046492 Ga0495585_0032898 Ga0495585_0032898_176_646 156
111 3300046492 Ga0495585_0046875 Ga0495585_0046875_1521_1991 156
112 3300046499 Ga0495594_0016378 Ga0495594_0016378_129_599 156
113 3300046499 Ga0495594_0068323 Ga0495594_0068323_737_1207 156
114 3300046499 Ga0495594_0125815 Ga0495594_0125815_362_838 156
115 3300046500 Ga0495596_0161016 Ga0495596_0161016_106_576 156
116 3300046501 Ga0495607_0042896 Ga0495607_0042896_1442_1912 156
117 3300046501 Ga0495607_0199780 Ga0495607_0199780_241_711 156
118 3300046506 Ga0495583_0017706 Ga0495583_0017706_810_1280 156
119 3300046506 Ga0495583_0098068 Ga0495583_0098068_372_842 156
120 3300046507 Ga0495606_0066745 Ga0495606_0066745_497_967 156
121 3300046507 Ga0495606_0606012 Ga0495606_0606012_38_508 156
122 3300046511 Ga0495608_0109919 Ga0495608_0109919_182_652 156
123 3300046512 Ga0495610_0120767 Ga0495610_0120767_159_629 156
124 3300046513 Ga0495616_0070938 Ga0495616_0070938_288_758 156
125 3300046514 Ga0495618_0122457 Ga0495618_0122457_1121_1591 156
126 3300046514 Ga0495618_0262816 Ga0495618_0262816_52_522 156
127 3300046515 Ga0495620_0025352 Ga0495620_0025352_2303_2773 156
128 3300046515 Ga0495620_0087102 Ga0495620_0087102_451_921 156
129 3300046516 Ga0495628_0029239 Ga0495628_0029239_3867_4337 156
130 3300046516 Ga0495628_0056152 Ga0495628_0056152_2454_2924 156
131 3300046516 Ga0495628_0349672 Ga0495628_0349672_44_514 156
132 3300046518 Ga0495631_0032940 Ga0495631_0032940_548_1018 156
133 3300046519 Ga0495632_0397204 Ga0495632_0397204_86_556 156
134 3300046522 Ga0495643_0002847 Ga0495643_0002847_1396_1866 156
135 3300046522 Ga0495643_0019362 Ga0495643_0019362_1363_1833 156
136 3300046523 Ga0495644_0400172 Ga0495644_0400172_33_503 156
137 3300046524 Ga0495648_0201055 Ga0495648_0201055_293_763 156
138 3300046524 Ga0495648_0392466 Ga0495648_0392466_52_522 156
139 3300046526 Ga0495666_0006497 Ga0495666_0006497_492_962 156
140 3300046528 Ga0495642_0206783 Ga0495642_0206783_360_830 156
141 3300046529 Ga0495652_0130175 Ga0495652_0130175_100_570 156
142 3300046530 Ga0495654_0250188 Ga0495654_0250188_179_649 156
143 3300046533 Ga0495640_0024380 Ga0495640_0024380_1339_1809 156
144 3300046533 Ga0495640_0029959 Ga0495640_0029959_3306_3776 156
145 3300046533 Ga0495640_0051144 Ga0495640_0051144_1186_1656 156
146 3300046536 Ga0495587_0166922 Ga0495587_0166922_454_930 156
147 3300046538 Ga0495609_0004538 Ga0495609_0004538_6864_7334 156
148 3300046542 Ga0495597_0034840 Ga0495597_0034840_810_1280 156
149 3300046542 Ga0495597_0161700 Ga0495597_0161700_120_590 156
150 3300046543 Ga0495645_0029459 Ga0495645_0029459_583_1059 156
151 3300046557 Ga0495622_0084643 Ga0495622_0084643_11_481 156
152 3300046557 Ga0495622_0184704 Ga0495622_0184704_317_787 156
153 3300046558 Ga0495633_0007379 Ga0495633_0007379_5404_5874 156
154 3300046558 Ga0495633_0044251 Ga0495633_0044251_63_533 156
155 3300046559 Ga0495667_0519354 Ga0495667_0519354_228_698 156
156 3300046615 Ga0495656_0243612 Ga0495656_0243612_331_807 156
157 3300046616 Ga0495668_0009753 Ga0495668_0009753_4453_4923 156
158 3300046616 Ga0495668_0259901 Ga0495668_0259901_351_821 156
159 3300046642 Ga0495634_0012846 Ga0495634_0012846_89_559 156
160 3300046642 Ga0495634_0124876 Ga0495634_0124876_441_911 156
161 3300046648 Ga0495611_0041924 Ga0495611_0041924_21_491 156
162 3300046648 Ga0495611_0176548 Ga0495611_0176548_269_739 156
163 3300046660 Ga0495625_0091732 Ga0495625_0091732_195_665 156
164 3300046660 Ga0495625_0744907 Ga0495625_0744907_60_530 156
165 3300046663 Ga0495635_0116968 Ga0495635_0116968_482_952 156
166 3300046663 Ga0495635_0435233 Ga0495635_0435233_373_849 156
167 3300046665 Ga0495661_0169170 Ga0495661_0169170_424_894 156
168 3300046674 Ga0495588_0055612 Ga0495588_0055612_893_1363 156
169 3300046674 Ga0495588_0149955 Ga0495588_0149955_604_1080 156
170 3300046674 Ga0495588_0439660 Ga0495588_0439660_91_567 156
171 3300046675 Ga0495657_0074225 Ga0495657_0074225_328_798 156
172 3300046679 Ga0495623_0202161 Ga0495623_0202161_332_802 156
173 3300046689 Ga0495613_0095100 Ga0495613_0095100_1148_1624 156
174 3300046689 Ga0495613_0261110 Ga0495613_0261110_42_512 156
175 3300046689 Ga0495613_0653508 Ga0495613_0653508_139_609 156
176 3300046690 Ga0495624_0181551 Ga0495624_0181551_795_1265 156
177 3300046690 Ga0495624_0284284 Ga0495624_0284284_49_519 156
178 3300046690 Ga0495624_0400084 Ga0495624_0400084_230_700 156
179 3300046691 Ga0495670_0034446 Ga0495670_0034446_1978_2448 156
180 3300046691 Ga0495670_0385893 Ga0495670_0385893_53_523 156
181 3300046694 Ga0495649_0049062 Ga0495649_0049062_262_732 156
182 3300046694 Ga0495649_0094034 Ga0495649_0094034_134_604 156
183 3300046694 Ga0495649_0163899 Ga0495649_0163899_550_1020 156
184 3300046694 Ga0495649_0239934 Ga0495649_0239934_81_551 156
185 3300046794 Ga0495589_0146567 Ga0495589_0146567_451_921 156
186 3300046794 Ga0495589_0165873 Ga0495589_0165873_396_866 156
187 3300046794 Ga0495589_0223722 Ga0495589_0223722_307_777 156
188 3300046809 Ga0495600_0093687 Ga0495600_0093687_137_607 156
189 3300046809 Ga0495600_0106830 Ga0495600_0106830_1092_1562 156
190 3300046810 Ga0495660_0020572 Ga0495660_0020572_3226_3696 156
191 3300047317 Ga0495604_0053191 Ga0495604_0053191_52_522 156
192 3300047317 Ga0495604_0103961 Ga0495604_0103961_1409_1879 156
193 3300047318 Ga0495636_0006090 Ga0495636_0006090_3722_4192 156
194 3300047318 Ga0495636_0045558 Ga0495636_0045558_616_1092 156
195 3300047318 Ga0495636_0167302 Ga0495636_0167302_153_629 156
196 3300047318 Ga0495636_0218868 Ga0495636_0218868_359_835 156
197 3300047318 Ga0495636_0283993 Ga0495636_0283993_262_732 156
198 3300047318 Ga0495636_0449742 Ga0495636_0449742_34_504 156
199 3300047319 Ga0495674_0182242 Ga0495674_0182242_399_869 156
200 3300047320 Ga0495672_0110830 Ga0495672_0110830_772_1242 156
201 3300047321 Ga0495676_0003653 Ga0495676_0003653_13328_13798 156
202 3300047321 Ga0495676_0059596 Ga0495676_0059596_2516_2986 156
203 3300047321 Ga0495676_0298684 Ga0495676_0298684_300_770 156
204 3300047322 Ga0495680_0018338 Ga0495680_0018338_5256_5726 156
205 3300047323 Ga0495683_0087567 Ga0495683_0087567_333_803 156
206 3300047443 Ga0495687_005104 Ga0495687_005104_4088_4558 156
207 3300047443 Ga0495687_007279 Ga0495687_007279_1820_2290 156
208 3300047443 Ga0495687_077163 Ga0495687_077163_448_918 156
209 3300047443 Ga0495687_084636 Ga0495687_084636_550_1020 156
210 3300047443 Ga0495687_200733 Ga0495687_200733_50_520 156
211 3300047444 Ga0495675_0306790 Ga0495675_0306790_123_593 156
212 3300047444 Ga0495675_0335405 Ga0495675_0335405_270_740 156
213 3300047445 Ga0495677_0096209 Ga0495677_0096209_608_1078 156
214 3300047445 Ga0495677_0234645 Ga0495677_0234645_114_584 156
215 3300047446 Ga0495679_056861 Ga0495679_056861_592_1062 156
216 3300047447 Ga0495685_000747 Ga0495685_000747_1362_1832 156
217 3300047447 Ga0495685_017678 Ga0495685_017678_1824_2300 156
218 3300047447 Ga0495685_058862 Ga0495685_058862_542_1012 156
219 3300047447 Ga0495685_058871 Ga0495685_058871_536_1012 156
220 3300047469 Ga0495673_0228601 Ga0495673_0228601_106_576 156
221 3300047470 Ga0495681_0001605 Ga0495681_0001605_11696_12166 156
222 3300047470 Ga0495681_0158271 Ga0495681_0158271_161_631 156
223 3300047471 Ga0495684_0358906 Ga0495684_0358906_134_604 156
224 3300047472 Ga0495686_0245458 Ga0495686_0245458_522_992 156
225 3300048089 Ga0495614_0274842 Ga0495614_0274842_231_707 156
226 3300048091 Ga0495626_0007359 Ga0495626_0007359_3323_3793 156
227 3300048091 Ga0495626_0191827 Ga0495626_0191827_147_617 156
228 3300048911 Ga0496108_0090828 Ga0496108_0090828_924_1400 156
229 3300048913 Ga0496110_1612331 Ga0496110_1612331_52_528 156
230 3300049459 Ga0495678_234330 Ga0495678_234330_62_532 156
231 3300049568 Ga0501031_0408082 Ga0501031_0408082_215_685 156
232 3300049568 Ga0501031_0650446 Ga0501031_0650446_159_629 156
233 3300049569 Ga0501032_0002476 Ga0501032_0002476_11057_11557 156
234 3300049569 Ga0501032_0029964 Ga0501032_0029964_1623_2093 156
235 3300049569 Ga0501032_0095779 Ga0501032_0095779_68_538 156
236 3300049569 Ga0501032_0464268 Ga0501032_0464268_242_712 156
237 3300049570 Ga0501033_0049043 Ga0501033_0049043_1235_1705 156
238 3300049570 Ga0501033_0058759 Ga0501033_0058759_250_720 156
239 3300049570 Ga0501033_0079785 Ga0501033_0079785_1223_1693 156
240 3300049570 Ga0501033_0204471 Ga0501033_0204471_143_643 156
241 3300049571 Ga0501034_0001799 Ga0501034_0001799_13172_13642 156
242 3300049571 Ga0501034_0005069 Ga0501034_0005069_2862_3362 156
243 3300049571 Ga0501034_0035382 Ga0501034_0035382_3560_4030 156
244 3300049571 Ga0501034_0432095 Ga0501034_0432095_563_1033 156
245 3300049571 Ga0501034_0746018 Ga0501034_0746018_387_857 156
246 3300049572 Ga0501036_0002121 Ga0501036_0002121_1522_1992 156
247 3300049572 Ga0501036_0036927 Ga0501036_0036927_1334_1804 156
248 3300049572 Ga0501036_0330114 Ga0501036_0330114_167_637 156
249 3300049573 Ga0501037_0002582 Ga0501037_0002582_1386_1886 156
250 3300049573 Ga0501037_0171194 Ga0501037_0171194_824_1294 156
251 3300049574 Ga0501038_0036249 Ga0501038_0036249_131_601 156
252 3300049574 Ga0501038_0053902 Ga0501038_0053902_521_991 156
253 3300049575 Ga0501039_0003392 Ga0501039_0003392_8205_8675 156
254 3300049575 Ga0501039_0017638 Ga0501039_0017638_4705_5205 156
255 3300049575 Ga0501039_0022252 Ga0501039_0022252_2325_2795 156
256 3300049576 Ga0501040_0010279 Ga0501040_0010279_1058_1558 156
257 3300049577 Ga0501041_0001503 Ga0501041_0001503_12404_12904 156
258 3300049578 Ga0501042_0010455 Ga0501042_0010455_1163_1663 156
259 3300049579 Ga0501043_0001820 Ga0501043_0001820_10747_11247 156
260 3300049579 Ga0501043_0003644 Ga0501043_0003644_3834_4304 156
261 3300049579 Ga0501043_0070071 Ga0501043_0070071_1456_1926 156
262 3300049579 Ga0501043_0540768 Ga0501043_0540768_231_701 156
263 3300049580 Ga0501046_0055434 Ga0501046_0055434_2483_2953 156
264 3300049580 Ga0501046_0061950 Ga0501046_0061950_1968_2468 156
265 3300049581 Ga0501047_0000074 Ga0501047_0000074_18792_19292 156
266 3300049581 Ga0501047_0000612 Ga0501047_0000612_18517_19017 156
267 3300049581 Ga0501047_0022246 Ga0501047_0022246_807_1277 156
268 3300049581 Ga0501047_0080350 Ga0501047_0080350_2416_2886 156
269 3300049581 Ga0501047_0452694 Ga0501047_0452694_136_606 156
270 3300049581 Ga0501047_0689098 Ga0501047_0689098_191_661 156
271 3300049581 Ga0501047_0732365 Ga0501047_0732365_143_613 156
272 3300049582 Ga0501048_0031765 Ga0501048_0031765_636_1136 156
273 3300049583 Ga0501067_0150741 Ga0501067_0150741_657_1157 156
274 3300049584 Ga0501068_0005307 Ga0501068_0005307_4563_5063 156
275 3300049584 Ga0501068_0628434 Ga0501068_0628434_63_533 156
276 3300049585 Ga0501069_0038925 Ga0501069_0038925_1929_2429 156
277 3300049586 Ga0501070_0006363 Ga0501070_0006363_8361_8831 156
278 3300049586 Ga0501070_0016804 Ga0501070_0016804_5073_5543 156
279 3300049586 Ga0501070_0407824 Ga0501070_0407824_456_956 156
280 3300049586 Ga0501070_0569858 Ga0501070_0569858_283_753 156
281 3300049587 Ga0501071_0004954 Ga0501071_0004954_7424_7924 156
282 3300049588 Ga0501072_0052767 Ga0501072_0052767_143_643 156
283 3300049589 Ga0501073_0071839 Ga0501073_0071839_853_1353 156
284 3300049589 Ga0501073_0718271 Ga0501073_0718271_106_576 156
285 3300049592 Ga0501076_0004399 Ga0501076_0004399_5776_6276 156
286 3300049741 Ga0501079_0092824 Ga0501079_0092824_1186_1686 156
287 3300049744 Ga0501083_0063004 Ga0501083_0063004_1928_2428 156
288 3300049822 Ga0501035_0001339 Ga0501035_0001339_18349_18849 156
289 3300049822 Ga0501035_0007127 Ga0501035_0007127_5073_5543 156
290 3300049822 Ga0501035_0023808 Ga0501035_0023808_4960_5430 156
291 3300049822 Ga0501035_0203781 Ga0501035_0203781_640_1110 156
292 3300049822 Ga0501035_0343770 Ga0501035_0343770_709_1179 156
293 3300049822 Ga0501035_0813634 Ga0501035_0813634_102_572 156
294 3300049823 Ga0501044_0026456 Ga0501044_0026456_710_1180 156
295 3300049823 Ga0501044_0059920 Ga0501044_0059920_617_1087 156
296 3300049823 Ga0501044_0286683 Ga0501044_0286683_797_1267 156
297 3300049823 Ga0501044_0472659 Ga0501044_0472659_247_717 156
298 3300049823 Ga0501044_0717574 Ga0501044_0717574_310_810 156
299 3300049823 Ga0501044_0730659 Ga0501044_0730659_154_624 156
300 3300049824 Ga0501045_0017023 Ga0501045_0017023_1801_2301 156
301 3300049824 Ga0501045_0080596 Ga0501045_0080596_1904_2374 156
302 3300049824 Ga0501045_0176238 Ga0501045_0176238_192_662 156
303 3300050490 nmdc:mga03n38_12313_c1 nmdc:mga03n38_12313_c1_2612_3088 156
304 3300053083 Ga0495655_0046643 Ga0495655_0046643_543_1013 156
305 3300053086 Ga0500578_0007037 Ga0500578_0007037_803_1273 156
306 3300053090 Ga0500646_0154293 Ga0500646_0154293_191_661 156
307 3300053093 Ga0500651_0248496 Ga0500651_0248496_465_935 156
308 3300053099 Ga0500654_080366 Ga0500654_080366_914_1384 156
309 3300053100 Ga0500660_191004 Ga0500660_191004_32_502 156
310 3300053101 Ga0500553_116085 Ga0500553_116085_416_886 156
311 3300053104 Ga0500556_0263468 Ga0500556_0263468_109_579 156
312 3300053107 Ga0500560_039132 Ga0500560_039132_881_1351 156
313 3300053107 Ga0500560_128780 Ga0500560_128780_355_825 156
314 3300053109 Ga0500569_003061 Ga0500569_003061_2778_3248 156
315 3300053118 Ga0500594_0218004 Ga0500594_0218004_37_507 156
316 3300053129 Ga0500628_013422 Ga0500628_013422_941_1411 156
317 3300053131 Ga0500652_013194 Ga0500652_013194_2327_2797 156
318 3300053134 Ga0500658_0262685 Ga0500658_0262685_210_680 156
319 3300053137 Ga0500561_0071047 Ga0500561_0071047_104_574 156
320 3300053140 Ga0500573_0141384 Ga0500573_0141384_715_1185 156
321 3300053143 Ga0500579_087810 Ga0500579_087810_1110_1580 156
322 3300053149 Ga0500600_0001065 Ga0500600_0001065_4334_4804 156
323 3300053150 Ga0500603_202258 Ga0500603_202258_100_570 156
324 3300053153 Ga0500616_0021934 Ga0500616_0021934_2968_3438 156
325 3300053160 Ga0500633_0000261 Ga0500633_0000261_7032_7502 156
326 3300053161 Ga0500634_0000647 Ga0500634_0000647_797_1267 156
327 3300053732 Ga0500656_018535 Ga0500656_018535_47_517 156
328 3300053739 Ga0500587_003667 Ga0500587_003667_1552_2022 156
329 3300054114 Ga0501084_0047666 Ga0501084_0047666_2431_2931 156
330 3300060353 Ga0501082_0004568 Ga0501082_0004568_3774_4274 156
331 3300061719 Ga0466962_0089102 Ga0466962_0089102_792_1262 156
332 3300061719 Ga0466962_0111125 Ga0466962_0111125_253_774 156
333 3300061734 Ga0530510_0214932 Ga0530510_0214932_895_1395 156
334 iso_pu_bacteria 3006425503 3006426150 156
335 3300006048 Ga0075363_100013892 Ga0075363_1000138924 157
336 3300006353 Ga0075370_10027344 Ga0075370_100273442 157
337 3300031838 Ga0307518_10169319 Ga0307518_101693192 157
338 3300041453 Ga0451797_1231293 Ga0451797_1231293_46_519 157
339 3300042005 Ga0439448_0002017 Ga0439448_0002017_4928_5401 157
340 3300042011 Ga0439454_017906 Ga0439454_017906_510_983 157
341 3300042012 Ga0439455_0000112 Ga0439455_0000112_619_1092 157
342 3300042138 Ga0450903_000028 Ga0450903_000028_29213_29686 157
343 3300042157 Ga0439458_0005682 Ga0439458_0005682_2031_2504 157
344 3300044656 Ga0466969_0003894 Ga0466969_0003894_5976_6455 157
345 3300044684 Ga0466966_0053968 Ga0466966_0053968_572_1051 157
346 3300044693 Ga0466961_0005113 Ga0466961_0005113_4884_5363 157
347 3300044719 Ga0466971_0004812 Ga0466971_0004812_241_720 157
348 3300045049 Ga0466959_0016967 Ga0466959_0016967_1949_2428 157
349 3300045836 Ga0466958_0211520 Ga0466958_0211520_240_719 157
350 3300045836 Ga0466958_0805049 Ga0466958_0805049_12_485 157
351 3300046462 Ga0495651_0123106 Ga0495651_0123106_1282_1755 157
352 3300046492 Ga0495585_0241167 Ga0495585_0241167_233_706 157
353 3300046689 Ga0495613_0071219 Ga0495613_0071219_42_515 157
354 3300047444 Ga0495675_0142420 Ga0495675_0142420_87_560 157
355 3300050490 nmdc:mga03n38_13879_c1 nmdc:mga03n38_13879_c1_306_779 157
356 3300050496 nmdc:mga07m45_20721_c1 nmdc:mga07m45_20721_c1_1246_1719 157
357 3300061719 Ga0466962_0006493 Ga0466962_0006493_4897_5376 157
358 3300003323 rootH1_10033745 rootH1_100337454 159
359 3300006048 Ga0075363_100125823 Ga0075363_1001258232 159
360 3300015688 Ga0183367_1001 Ga0183367_1001938 159
361 3300031838 Ga0307518_10213938 Ga0307518_102139383 159
362 3300041453 Ga0451797_0586783 Ga0451797_0586783_91_570 159
363 3300041491 Ga0451833_0418675 Ga0451833_0418675_238_717 159
364 3300042005 Ga0439448_0027354 Ga0439448_0027354_1287_1766 159
365 3300042012 Ga0439455_0000533 Ga0439455_0000533_3488_3967 159
366 3300042138 Ga0450903_000018 Ga0450903_000018_23199_23678 159
367 3300042157 Ga0439458_0004585 Ga0439458_0004585_398_877 159
368 3300044658 Ga0466972_0359179 Ga0466972_0359179_41_520 159
369 3300044693 Ga0466961_0041471 Ga0466961_0041471_634_1113 159
370 3300044694 Ga0466963_0732603 Ga0466963_0732603_122_601 159
371 3300044842 Ga0466957_0669383 Ga0466957_0669383_194_673 159
372 3300044901 Ga0466960_0012345 Ga0466960_0012345_1604_2083 159
373 3300049582 Ga0501048_0278428 Ga0501048_0278428_125_604 159
374 3300050490 nmdc:mga03n38_203569_c1 nmdc:mga03n38_203569_c1_39_518 159
375 3300050490 nmdc:mga03n38_7795_c1 nmdc:mga03n38_7795_c1_867_1346 159
376 3300050496 nmdc:mga07m45_64833_c1 nmdc:mga07m45_64833_c1_1457_1936 159
377 3300002067 JGI24735J21928_10054619 JGI24735J21928_100546191 160
378 3300004801 Ga0058860_11989380 Ga0058860_119893801 160
379 3300006042 Ga0075368_10093537 Ga0075368_100935372 160
380 3300006178 Ga0075367_10000581 Ga0075367_100005819 160
381 3300011119 Ga0105246_10097485 Ga0105246_100974852 160
382 3300013307 Ga0157372_10510752 Ga0157372_105107522 160
383 3300014497 Ga0182008_10003109 Ga0182008_100031094 160
384 3300015262 Ga0182007_10000210 Ga0182007_100002108 160
385 3300015265 Ga0182005_1024939 Ga0182005_10249392 160
386 3300020069 Ga0197907_11443965 Ga0197907_114439651 160
387 3300020080 Ga0206350_10361717 Ga0206350_103617171 160
388 3300022467 Ga0224712_10099613 Ga0224712_100996132 160
389 3300025904 Ga0207647_10195403 Ga0207647_101954032 160
390 3300027312 Ga0209371_1023559 Ga0209371_10235592 160
391 3300030500 Ga0268256_1032081 Ga0268256_10320813 160
392 3300030522 Ga0307512_10009194 Ga0307512_100091949 160
393 3300030522 Ga0307512_10043630 Ga0307512_100436304 160
394 3300031456 Ga0307513_10002713 Ga0307513_1000271316 160
395 3300031456 Ga0307513_10476607 Ga0307513_104766072 160
396 3300031616 Ga0307508_10116246 Ga0307508_101162463 160
397 3300031649 Ga0307514_10061802 Ga0307514_100618024 160
398 3300031649 Ga0307514_10077464 Ga0307514_100774642 160
399 3300031649 Ga0307514_10088685 Ga0307514_100886853 160
400 3300031730 Ga0307516_10124172 Ga0307516_101241723 160
401 3300033180 Ga0307510_10035289 Ga0307510_100352893 160
402 3300037418 Ga0395900_1054240 Ga0395900_1054240_24_515 160
403 3300042007 Ga0439449_0131231 Ga0439449_0131231_149_634 160
404 3300042014 Ga0439457_007443 Ga0439457_007443_1568_2053 160
405 3300042015 Ga0439462_0056418 Ga0439462_0056418_149_634 160
406 3300042133 Ga0450896_009911 Ga0450896_009911_264_746 160
407 3300042135 Ga0450899_001436 Ga0450899_001436_1611_2093 160
408 3300042145 Ga0450906_049134 Ga0450906_049134_197_679 160
409 3300042145 Ga0450906_061119 Ga0450906_061119_161_646 160
410 3300042184 Ga0450908_033217 Ga0450908_033217_262_744 160
411 3300044658 Ga0466972_0129316 Ga0466972_0129316_77_568 160
412 3300044658 Ga0466972_0283371 Ga0466972_0283371_270_752 160
413 3300044683 Ga0466965_0017003 Ga0466965_0017003_706_1188 160
414 3300044684 Ga0466966_0000327 Ga0466966_0000327_19631_20113 160
415 3300044684 Ga0466966_0226892 Ga0466966_0226892_140_622 160
416 3300044693 Ga0466961_0000836 Ga0466961_0000836_12251_12733 160
417 3300044694 Ga0466963_0007639 Ga0466963_0007639_3247_3732 160
418 3300044694 Ga0466963_0039728 Ga0466963_0039728_985_1467 160
419 3300044706 Ga0466964_0001230 Ga0466964_0001230_4900_5382 160
420 3300044719 Ga0466971_0000392 Ga0466971_0000392_399_881 160
421 3300044719 Ga0466971_0060510 Ga0466971_0060510_328_840 160
422 3300044765 Ga0466970_0000256 Ga0466970_0000256_14938_15420 160
423 3300044842 Ga0466957_0000809 Ga0466957_0000809_15048_15530 160
424 3300044901 Ga0466960_0118378 Ga0466960_0118378_747_1229 160
425 3300045049 Ga0466959_0013094 Ga0466959_0013094_4998_5480 160
426 3300045836 Ga0466958_0000126 Ga0466958_0000126_7070_7552 160
427 3300045976 Ga0466967_0025529 Ga0466967_0025529_2342_2824 160
428 3300045976 Ga0466967_0124301 Ga0466967_0124301_461_943 160
429 3300045976 Ga0466967_0574332 Ga0466967_0574332_105_590 160
430 3300045976 Ga0466967_1772351 Ga0466967_1772351_45_527 160
431 3300049568 Ga0501031_0007893 Ga0501031_0007893_3115_3600 160
432 3300049568 Ga0501031_0358297 Ga0501031_0358297_224_706 160
433 3300049569 Ga0501032_0010709 Ga0501032_0010709_2030_2515 160
434 3300049570 Ga0501033_0011219 Ga0501033_0011219_3796_4308 160
435 3300049571 Ga0501034_0017002 Ga0501034_0017002_3465_3950 160
436 3300049571 Ga0501034_0029376 Ga0501034_0029376_3201_3683 160
437 3300049571 Ga0501034_0083387 Ga0501034_0083387_1380_1862 160
438 3300049572 Ga0501036_0012118 Ga0501036_0012118_4430_4915 160
439 3300049572 Ga0501036_0033952 Ga0501036_0033952_1775_2257 160
440 3300049572 Ga0501036_0140758 Ga0501036_0140758_323_805 160
441 3300049573 Ga0501037_0003989 Ga0501037_0003989_3961_4446 160
442 3300049573 Ga0501037_0164155 Ga0501037_0164155_580_1062 160
443 3300049574 Ga0501038_0009331 Ga0501038_0009331_6575_7057 160
444 3300049574 Ga0501038_0028115 Ga0501038_0028115_2920_3405 160
445 3300049574 Ga0501038_0238050 Ga0501038_0238050_705_1187 160
446 3300049575 Ga0501039_0058372 Ga0501039_0058372_1701_2186 160
447 3300049578 Ga0501042_0009389 Ga0501042_0009389_3685_4170 160
448 3300049579 Ga0501043_0013307 Ga0501043_0013307_5479_5964 160
449 3300049579 Ga0501043_0075220 Ga0501043_0075220_782_1264 160
450 3300049579 Ga0501043_0119156 Ga0501043_0119156_1259_1741 160
451 3300049580 Ga0501046_0040645 Ga0501046_0040645_2442_2927 160
452 3300049581 Ga0501047_0024184 Ga0501047_0024184_3346_3831 160
453 3300049581 Ga0501047_0031912 Ga0501047_0031912_3080_3562 160
454 3300049581 Ga0501047_0050978 Ga0501047_0050978_2617_3111 160
455 3300049581 Ga0501047_0058244 Ga0501047_0058244_2668_3150 160
456 3300049582 Ga0501048_0006577 Ga0501048_0006577_602_1087 160
457 3300049586 Ga0501070_0132275 Ga0501070_0132275_191_673 160
458 3300049586 Ga0501070_0268715 Ga0501070_0268715_566_1048 160
459 3300049742 Ga0501080_0078507 Ga0501080_0078507_1776_2258 160
460 3300049742 Ga0501080_0342414 Ga0501080_0342414_463_945 160
461 3300049822 Ga0501035_0020225 Ga0501035_0020225_2124_2609 160
462 3300049822 Ga0501035_0128940 Ga0501035_0128940_1448_1930 160
463 3300049822 Ga0501035_0292640 Ga0501035_0292640_487_969 160
464 3300049823 Ga0501044_0046932 Ga0501044_0046932_602_1087 160
465 3300049823 Ga0501044_0067940 Ga0501044_0067940_3056_3550 160
466 3300049823 Ga0501044_0238396 Ga0501044_0238396_584_1066 160
467 3300049823 Ga0501044_0363243 Ga0501044_0363243_390_872 160
468 3300049824 Ga0501045_0122600 Ga0501045_0122600_718_1203 160
469 3300049824 Ga0501045_0155144 Ga0501045_0155144_155_637 160
470 3300050494 nmdc:mga06z11_728_c1 nmdc:mga06z11_728_c1_5721_6203 160
471 3300050495 nmdc:mga04h51_9852_c1 nmdc:mga04h51_9852_c1_1111_1593 160
472 3300053086 Ga0500578_0350393 Ga0500578_0350393_16_498 160
473 3300053149 Ga0500600_0276275 Ga0500600_0276275_169_657 160
474 3300054114 Ga0501084_0236523 Ga0501084_0236523_964_1449 160
475 3300061719 Ga0466962_0000069 Ga0466962_0000069_14623_15105 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

52

190

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yw7-assembly1.cif.gz_G crystal structure of c-terminal deletion mutant of mycobacterium smegmatis dps 0.9555 17 153
2yjk-assembly1.cif.gz_B structure of dps from microbacterium arborescens in the high iron form 0.9543 5 154
2c2j-assembly1.cif.gz_A crystal structure of the dps92 from deinococcus radiodurans 0.9533 11 158
4m32-assembly1.cif.gz_D crystal structure of gated-pore mutant d138n of second dna-binding protein under starvation from mycobacterium smegmatis 0.9522 5 155
1vel-assembly1.cif.gz_D mycobacterium smegmatis dps tetragonal form 0.9519 7 154
ID Description Score Start End Superfamily
2c6rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9549 12 158 1.20.1260.10
2yw6A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9535 10 154 1.20.1260.10
2yw7F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.952 10 151 1.20.1260.10
1uvhA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9501 6 154 1.20.1260.10
2yw7A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9484 10 154 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A3N2H9P2-F1-model_v4 Starvation-inducible DNA-binding protein 0.9938 8 154 GO:0003677
GO:0008199
GO:0016722
AF-A0A7Y5UDX1-F1-model_v4 deleted 0.9915 5 155
AF-A0A4S2RC44-F1-model_v4 Methyltransferase domain-containing protein 0.9904 1 160 GO:0008168
GO:0008199
GO:0009058
GO:0016722
GO:0032259
AF-A0A5C5RKE9-F1-model_v4 DNA starvation/stationary phase protection protein 0.9895 4 155 GO:0008199
GO:0016722
AF-V8D2I3-F1-model_v4 Ferritin 0.9894 4 154 GO:0008199
GO:0016722

Feature Viewer

pLDDT pTM Quality
94.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map