F451397

General Info

Members Datasets Scaffolds Average Seq Length
475 222 475 263

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0097009|Ga0451576_0097009_1061_2032
Length 312
Sequence MNLNTDKQRLRPCRAGAAATISNTFTVIRNRTANFFSMAAGPHPRRARSLTPRLGFAWPRLGVAAGAALSVELKVDLSKERAGRPPATFEPMVGTWVVARDGADNVIMVDGRPWVASKDNPTKLLIESARRLYGTSNEELMDNAKQFAYFPVAVLKGVDNFTNGTISVKFKTLSGDADRASGILFNVKPNGDWLAIRYNDTENNVALWEFHNGMRRNMRFSDRAKKFMLDRAAWHELKMTVKDADFKAWLDGELALEYTLGSMPGPGRNGAPPNPDLIPANNPVLQPPVKGKIGLWAKTDSTSYFKDYVVIQ

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 0
Rhizoplane 5.26
Rhizosphere 92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10075118 3300005290 Bacteria 3930
2 Ga0065715_10014812 3300005293 Bacteria 1962
3 Ga0065715_10097179 3300005293 Unclassified 3733
4 Ga0065715_10196078 3300005293 Unclassified 1387
5 Ga0065707_10164547 3300005295 Bacteria 1533
6 Ga0070683_100003650 3300005329 Bacteria 12541
7 Ga0070683_100121570 3300005329 Bacteria 2467
8 Ga0070690_100008523 3300005330 Bacteria 5910
9 Ga0070690_100443036 3300005330 Bacteria 961
10 Ga0070670_100138580 3300005331 Unclassified 2103
11 Ga0070670_100170001 3300005331 Bacteria 1890
12 Ga0068869_100097247 3300005334 Bacteria 2222
13 Ga0068869_100575321 3300005334 Unclassified 949
14 Ga0070666_10040356 3300005335 Bacteria 3115
15 Ga0070666_10080090 3300005335 Bacteria 2231
16 Ga0070666_10357519 3300005335 Unclassified 1046
17 Ga0068868_100025293 3300005338 Bacteria 4514
18 Ga0068868_100077063 3300005338 Unclassified 2667
19 Ga0070689_100069469 3300005340 Bacteria 2748
20 Ga0070689_100103407 3300005340 Bacteria 2257
21 Ga0070687_100023972 3300005343 Bacteria 2906
22 Ga0070687_100034838 3300005343 Bacteria 2495
23 Ga0070668_100036929 3300005347 Bacteria 3729
24 Ga0070669_100001923 3300005353 Bacteria 14987
25 Ga0070669_100012922 3300005353 Bacteria 5929
26 Ga0070675_100000035 3300005354 Bacteria 86571
27 Ga0070675_100027461 3300005354 Bacteria 4572
28 Ga0070671_100292011 3300005355 Bacteria 1387
29 Ga0070674_100050306 3300005356 Bacteria 2868
30 Ga0070674_100240670 3300005356 Unclassified 1417
31 Ga0070673_100000622 3300005364 Bacteria 19404
32 Ga0070673_100054923 3300005364 Bacteria 3136
33 Ga0070673_100128469 3300005364 Unclassified 2123
34 Ga0070688_100225206 3300005365 Bacteria 1324
35 Ga0070688_100433167 3300005365 Bacteria 980
36 Ga0070688_100444000 3300005365 Bacteria 969
37 Ga0070659_100067474 3300005366 Unclassified 2837
38 Ga0070667_100079686 3300005367 Unclassified 2800
39 Ga0070667_100411622 3300005367 Bacteria 1232
40 Ga0070703_10100443 3300005406 Bacteria 1019
41 Ga0070705_100004497 3300005440 Bacteria 6792
42 Ga0070705_100038659 3300005440 Bacteria 2702
43 Ga0070700_100027517 3300005441 Unclassified 3372
44 Ga0070700_100378823 3300005441 Bacteria 1057
45 Ga0070694_100016942 3300005444 Unclassified 4596
46 Ga0070708_100129291 3300005445 Bacteria 2337
47 Ga0070708_100373777 3300005445 Unclassified 1344
48 Ga0070663_100517995 3300005455 Bacteria 993
49 Ga0070678_100019928 3300005456 Bacteria 4388
50 Ga0070662_100044549 3300005457 Unclassified 3179
51 Ga0070662_100050861 3300005457 Unclassified 2990
52 Ga0070662_100214103 3300005457 Bacteria 1535
53 Ga0070662_100222749 3300005457 Bacteria 1506
54 Ga0070681_10287328 3300005458 Unclassified 1555
55 Ga0068867_100017428 3300005459 Bacteria 5103
56 Ga0068867_100039012 3300005459 Bacteria 3461
57 Ga0070685_10033291 3300005466 Bacteria 2894
58 Ga0070707_100374783 3300005468 Unclassified 1383
59 Ga0070698_100022268 3300005471 Bacteria 6630
60 Ga0070699_100079654 3300005518 Bacteria 2854
61 Ga0070679_100109673 3300005530 Unclassified 2746
62 Ga0070684_100042700 3300005535 Unclassified 3915
63 Ga0070684_100084281 3300005535 Bacteria 2817
64 Ga0070697_100009337 3300005536 Bacteria 7668
65 Ga0068853_100702050 3300005539 Unclassified 965
66 Ga0070672_100022989 3300005543 Bacteria 4589
67 Ga0070672_100029481 3300005543 Bacteria 4115
68 Ga0070672_100173322 3300005543 Bacteria 1795
69 Ga0070686_100004795 3300005544 Bacteria 7463
70 Ga0070686_100105002 3300005544 Bacteria 1915
71 Ga0070686_100198800 3300005544 Bacteria 1435
72 Ga0070695_100006389 3300005545 Bacteria 6966
73 Ga0070695_100033551 3300005545 Bacteria 3212
74 Ga0070696_100013653 3300005546 Bacteria 5452
75 Ga0070696_100049120 3300005546 Bacteria 2930
76 Ga0070696_100195965 3300005546 Bacteria 1506
77 Ga0070693_100034428 3300005547 Bacteria 2803
78 Ga0070665_100003072 3300005548 Bacteria 17981
79 Ga0070665_100005258 3300005548 Bacteria 13380
80 Ga0070704_100015912 3300005549 Bacteria 4738
81 Ga0070704_100028491 3300005549 Bacteria 3716
82 Ga0070704_100226090 3300005549 Bacteria 1524
83 Ga0070664_100002291 3300005564 Bacteria 15388
84 Ga0070664_100172133 3300005564 Bacteria 1921
85 Ga0070664_100377675 3300005564 Bacteria 1293
86 Ga0070664_100631539 3300005564 Unclassified 995
87 Ga0068857_100040867 3300005577 Bacteria 4112
88 Ga0068854_100003187 3300005578 Bacteria 10242
89 Ga0068854_100070524 3300005578 Unclassified 2554
90 Ga0068854_100293610 3300005578 Bacteria 1312
91 Ga0070702_100069897 3300005615 Bacteria 2070
92 Ga0070702_100128796 3300005615 Bacteria 1595
93 Ga0068852_100042166 3300005616 Unclassified 3862
94 Ga0068852_100310211 3300005616 Bacteria 1529
95 Ga0068859_100043788 3300005617 Bacteria 4498
96 Ga0068859_100225859 3300005617 Bacteria 1960
97 Ga0068859_100269437 3300005617 Bacteria 1795
98 Ga0068859_100367227 3300005617 Bacteria 1534
99 Ga0068864_100009264 3300005618 Bacteria 8118
100 Ga0068864_100141775 3300005618 Bacteria 2168
101 Ga0068864_100368653 3300005618 Unclassified 1359
102 Ga0068866_10006194 3300005718 Bacteria 4980
103 Ga0068866_10037352 3300005718 Unclassified 2385
104 Ga0068866_10043565 3300005718 Bacteria 2241
105 Ga0068866_10053970 3300005718 Bacteria 2057
106 Ga0068861_100180064 3300005719 Bacteria 1759
107 Ga0068861_100219097 3300005719 Bacteria 1607
108 Ga0068861_100293192 3300005719 Bacteria 1406
109 Ga0068861_100330890 3300005719 Bacteria 1330
110 Ga0068870_10105758 3300005840 Bacteria 1599
111 Ga0068870_10116350 3300005840 Unclassified 1534
112 Ga0068863_100007150 3300005841 Bacteria 10951
113 Ga0068863_100232856 3300005841 Bacteria 1777
114 Ga0068863_100239181 3300005841 Bacteria 1752
115 Ga0068858_100004003 3300005842 Bacteria 14541
116 Ga0068858_100061890 3300005842 Unclassified 3460
117 Ga0068858_100075913 3300005842 Bacteria 3122
118 Ga0068858_100198302 3300005842 Bacteria 1897
119 Ga0068858_100228535 3300005842 Bacteria 1763
120 Ga0068858_100473736 3300005842 Unclassified 1208
121 Ga0068862_100141316 3300005844 Unclassified 2137
122 Ga0068862_100743463 3300005844 Unclassified 954
123 Ga0081455_10122211 3300005937 Unclassified 2050
124 Ga0081539_10006314 3300005985 Bacteria 11447
125 Ga0075364_10017132 3300006051 Bacteria 4521
126 Ga0075364_10127930 3300006051 Bacteria 1704
127 Ga0075362_10065365 3300006177 Bacteria 1652
128 Ga0075367_10042545 3300006178 Unclassified 2659
129 Ga0075367_10111239 3300006178 Bacteria 1681
130 Ga0075366_10000836 3300006195 Bacteria 14794
131 Ga0097621_100005757 3300006237 Bacteria 8746
132 Ga0075370_10268703 3300006353 Bacteria 1012
133 Ga0068871_100117682 3300006358 Bacteria 2241
134 Ga0068871_100357558 3300006358 Bacteria 1293
135 Ga0075428_100001509 3300006844 Bacteria 24916
136 Ga0075428_100083208 3300006844 Bacteria 3491
137 Ga0075428_100360141 3300006844 Bacteria 1560
138 Ga0075431_100042121 3300006847 Unclassified 4709
139 Ga0075433_10031726 3300006852 Bacteria 4519
140 Ga0075433_10163354 3300006852 Bacteria 1982
141 Ga0075433_10279631 3300006852 Bacteria 1478
142 Ga0075434_100000422 3300006871 Bacteria 31341
143 Ga0075434_100030314 3300006871 Bacteria 5325
144 Ga0075434_100037852 3300006871 Bacteria 4776
145 Ga0075434_100043349 3300006871 Bacteria 4462
146 Ga0075434_100124466 3300006871 Unclassified 2595
147 Ga0075429_100213608 3300006880 Bacteria 1690
148 Ga0075429_100275674 3300006880 Bacteria 1473
149 Ga0068865_100006947 3300006881 Bacteria 6941
150 Ga0068865_100066394 3300006881 Bacteria 2545
151 Ga0068865_100153659 3300006881 Bacteria 1748
152 Ga0075436_100005606 3300006914 Bacteria 8614
153 Ga0075436_100028917 3300006914 Bacteria 3813
154 Ga0075436_100034402 3300006914 Unclassified 3494
155 Ga0075436_100225478 3300006914 Bacteria 1330
156 Ga0075436_100264625 3300006914 Unclassified 1227
157 Ga0097620_100043786 3300006931 Bacteria 4498
158 Ga0097620_100225866 3300006931 Bacteria 1960
159 Ga0097620_100269455 3300006931 Bacteria 1795
160 Ga0097620_100367194 3300006931 Bacteria 1534
161 Ga0075435_100000012 3300007076 Bacteria 108852
162 Ga0075435_100001689 3300007076 Bacteria 14336
163 Ga0075435_100014611 3300007076 Bacteria 5876
164 Ga0075435_100032221 3300007076 Bacteria 4137
165 Ga0075435_100046916 3300007076 Bacteria 3467
166 Ga0075435_100080581 3300007076 Unclassified 2673
167 Ga0075435_100081612 3300007076 Bacteria 2656
168 Ga0075435_100110374 3300007076 Bacteria 2287
169 Ga0105240_10127726 3300009093 Unclassified 3053
170 Ga0105240_10272501 3300009093 Bacteria 1948
171 Ga0105240_10304819 3300009093 Unclassified 1821
172 Ga0111539_10001106 3300009094 Bacteria 35560
173 Ga0111539_10014453 3300009094 Bacteria 9851
174 Ga0111539_10080316 3300009094 Unclassified 3836
175 Ga0111539_10385478 3300009094 Bacteria 1632
176 Ga0105245_10011294 3300009098 Bacteria 7777
177 Ga0105245_10026213 3300009098 Bacteria 5130
178 Ga0105247_10007815 3300009101 Bacteria 6544
179 Ga0114129_10011555 3300009147 Bacteria 12573
180 Ga0114129_10038577 3300009147 Bacteria 6737
181 Ga0114129_10079563 3300009147 Unclassified 4557
182 Ga0114129_10115639 3300009147 Bacteria 3697
183 Ga0114129_10184214 3300009147 Bacteria 2839
184 Ga0114129_10461916 3300009147 Unclassified 1664
185 Ga0114129_10737329 3300009147 Bacteria 1262
186 Ga0105243_10040410 3300009148 Unclassified 3643
187 Ga0105243_10633840 3300009148 Bacteria 1034
188 Ga0105241_10038797 3300009174 Unclassified 3591
189 Ga0105241_10201121 3300009174 Bacteria 1664
190 Ga0105241_10398963 3300009174 Bacteria 1206
191 Ga0105242_10002061 3300009176 Bacteria 15837
192 Ga0105242_10008568 3300009176 Bacteria 7852
193 Ga0105242_10009458 3300009176 Bacteria 7469
194 Ga0105242_10012650 3300009176 Bacteria 6498
195 Ga0105242_10080506 3300009176 Bacteria 2722
196 Ga0105248_10062352 3300009177 Bacteria 4187
197 Ga0105248_10069002 3300009177 Unclassified 3969
198 Ga0105248_10071665 3300009177 Bacteria 3893
199 Ga0105248_10137271 3300009177 Bacteria 2759
200 Ga0105248_10149704 3300009177 Unclassified 2633
201 Ga0105248_10252718 3300009177 Unclassified 1984
202 Ga0105248_10437229 3300009177 Bacteria 1474
203 Ga0105248_10455494 3300009177 Bacteria 1442
204 Ga0105248_10487126 3300009177 Unclassified 1390
205 Ga0105248_10533484 3300009177 Bacteria 1324
206 Ga0105237_10034258 3300009545 Bacteria 5142
207 Ga0105237_10302508 3300009545 Bacteria 1603
208 Ga0105238_10440374 3300009551 Bacteria 1299
209 Ga0105249_10043328 3300009553 Bacteria 4093
210 Ga0105249_10270995 3300009553 Bacteria 1691
211 Ga0105249_10496057 3300009553 Bacteria 1266
212 Ga0105246_10025701 3300011119 Unclassified 3840
213 Ga0105246_10100745 3300011119 Bacteria 2102
214 Ga0157374_10031219 3300013296 Bacteria 4841
215 Ga0157374_10068853 3300013296 Bacteria 3331
216 Ga0157374_10316302 3300013296 Unclassified 1546
217 Ga0157378_10012837 3300013297 Bacteria 7332
218 Ga0157378_10204303 3300013297 Bacteria 1870
219 Ga0163162_10102799 3300013306 Bacteria 2951
220 Ga0163163_10093896 3300014325 Unclassified 3017
221 Ga0157380_10083413 3300014326 Bacteria 2618
222 Ga0157380_10718684 3300014326 Bacteria 1006
223 Ga0157379_10006385 3300014968 Bacteria 10155
224 Ga0157379_10015553 3300014968 Bacteria 6679
225 Ga0157376_10065522 3300014969 Bacteria 3068
226 Ga0157376_10083136 3300014969 Bacteria 2753
227 Ga0207697_10016320 3300025315 Unclassified 3058
228 Ga0207682_10055090 3300025893 Bacteria 1653
229 Ga0207642_10056193 3300025899 Unclassified 1804
230 Ga0207642_10056326 3300025899 Bacteria 1803
231 Ga0207710_10084677 3300025900 Bacteria 1476
232 Ga0207688_10107579 3300025901 Bacteria 1616
233 Ga0207680_10003857 3300025903 Bacteria 7060
234 Ga0207680_10028581 3300025903 Bacteria 3121
235 Ga0207647_10011629 3300025904 Bacteria 6163
236 Ga0207645_10001628 3300025907 Bacteria 18323
237 Ga0207645_10051557 3300025907 Bacteria 2629
238 Ga0207643_10045794 3300025908 Unclassified 2471
239 Ga0207654_10058141 3300025911 Unclassified 2250
240 Ga0207695_10214877 3300025913 Unclassified 1832
241 Ga0207660_10479118 3300025917 Bacteria 1008
242 Ga0207662_10002800 3300025918 Bacteria 8813
243 Ga0207662_10003765 3300025918 Bacteria 7868
244 Ga0207662_10004611 3300025918 Bacteria 7267
245 Ga0207646_10525863 3300025922 Unclassified 1065
246 Ga0207681_10017646 3300025923 Bacteria 4484
247 Ga0207681_10096976 3300025923 Unclassified 2118
248 Ga0207681_10126896 3300025923 Bacteria 1880
249 Ga0207650_10041831 3300025925 Unclassified 3360
250 Ga0207650_10073879 3300025925 Bacteria 2569
251 Ga0207650_10495108 3300025925 Unclassified 1021
252 Ga0207659_10002714 3300025926 Bacteria 10552
253 Ga0207659_10256822 3300025926 Bacteria 1420
254 Ga0207687_10007227 3300025927 Bacteria 7323
255 Ga0207687_10023582 3300025927 Bacteria 4104
256 Ga0207644_10019943 3300025931 Bacteria 4553
257 Ga0207644_10029579 3300025931 Bacteria 3801
258 Ga0207644_10135838 3300025931 Bacteria 1888
259 Ga0207706_10022700 3300025933 Bacteria 5632
260 Ga0207706_10039849 3300025933 Bacteria 4165
261 Ga0207706_10107020 3300025933 Unclassified 2461
262 Ga0207706_10179303 3300025933 Bacteria 1861
263 Ga0207706_10234181 3300025933 Unclassified 1606
264 Ga0207686_10005954 3300025934 Bacteria 6548
265 Ga0207686_10007196 3300025934 Bacteria 5993
266 Ga0207686_10042680 3300025934 Bacteria 2774
267 Ga0207686_10138185 3300025934 Bacteria 1680
268 Ga0207686_10155218 3300025934 Bacteria 1598
269 Ga0207686_10273589 3300025934 Bacteria 1243
270 Ga0207686_10414451 3300025934 Bacteria 1029
271 Ga0207709_10022402 3300025935 Bacteria 3583
272 Ga0207709_10087742 3300025935 Bacteria 2023
273 Ga0207709_10103160 3300025935 Bacteria 1890
274 Ga0207709_10502157 3300025935 Bacteria 947
275 Ga0207670_10079432 3300025936 Bacteria 2290
276 Ga0207670_10108355 3300025936 Unclassified 1997
277 Ga0207669_10270285 3300025937 Bacteria 1276
278 Ga0207704_10004236 3300025938 Bacteria 6555
279 Ga0207704_10127038 3300025938 Bacteria 1758
280 Ga0207704_10424674 3300025938 Bacteria 1055
281 Ga0207691_10078745 3300025940 Bacteria 2966
282 Ga0207691_10133311 3300025940 Unclassified 2193
283 Ga0207691_10191282 3300025940 Bacteria 1785
284 Ga0207711_10006204 3300025941 Bacteria 10097
285 Ga0207711_10013457 3300025941 Bacteria 6797
286 Ga0207711_10034966 3300025941 Bacteria 4257
287 Ga0207711_10040464 3300025941 Unclassified 3966
288 Ga0207711_10058198 3300025941 Bacteria 3325
289 Ga0207711_10193608 3300025941 Unclassified 1854
290 Ga0207711_10461627 3300025941 Bacteria 1182
291 Ga0207711_10536170 3300025941 Unclassified 1092
292 Ga0207711_10699977 3300025941 Unclassified 945
293 Ga0207689_10036670 3300025942 Bacteria 4070
294 Ga0207689_10104016 3300025942 Bacteria 2333
295 Ga0207661_10025470 3300025944 Bacteria 4496
296 Ga0207661_10119148 3300025944 Bacteria 2245
297 Ga0207679_10003988 3300025945 Bacteria 9167
298 Ga0207679_10341917 3300025945 Bacteria 1302
299 Ga0207651_10066175 3300025960 Unclassified 2538
300 Ga0207712_10089246 3300025961 Bacteria 2266
301 Ga0207712_10091413 3300025961 Bacteria 2242
302 Ga0207712_10112759 3300025961 Unclassified 2043
303 Ga0207712_10196770 3300025961 Bacteria 1595
304 Ga0207640_10007129 3300025981 Bacteria 6160
305 Ga0207640_10082407 3300025981 Bacteria 2203
306 Ga0207640_10088045 3300025981 Unclassified 2143
307 Ga0207658_10060760 3300025986 Unclassified 2821
308 Ga0207658_10143655 3300025986 Bacteria 1935
309 Ga0207658_10214000 3300025986 Bacteria 1617
310 Ga0207677_10011530 3300026023 Bacteria 5046
311 Ga0207677_10155833 3300026023 Bacteria 1768
312 Ga0207677_10557341 3300026023 Bacteria 1000
313 Ga0207703_10055226 3300026035 Unclassified 3231
314 Ga0207703_10248714 3300026035 Bacteria 1601
315 Ga0207639_10333740 3300026041 Bacteria 1350
316 Ga0207678_10021408 3300026067 Bacteria 5669
317 Ga0207708_10006874 3300026075 Bacteria 8417
318 Ga0207708_10028975 3300026075 Bacteria 4193
319 Ga0207708_10067889 3300026075 Unclassified 2728
320 Ga0207708_10077922 3300026075 Bacteria 2544
321 Ga0207641_10000693 3300026088 Bacteria 36308
322 Ga0207648_10002915 3300026089 Bacteria 18109
323 Ga0207648_10004443 3300026089 Bacteria 14388
324 Ga0207648_10017686 3300026089 Bacteria 6476
325 Ga0207648_10088767 3300026089 Unclassified 2700
326 Ga0207676_10010229 3300026095 Bacteria 6675
327 Ga0207674_10037019 3300026116 Bacteria 5078
328 Ga0207675_100007011 3300026118 Bacteria 10656
329 Ga0207675_100039381 3300026118 Bacteria 4411
330 Ga0207675_100072562 3300026118 Bacteria 3220
331 Ga0207675_100132997 3300026118 Bacteria 2359
332 Ga0207675_100175798 3300026118 Bacteria 2048
333 Ga0207675_100210789 3300026118 Bacteria 1868
334 Ga0207675_100395823 3300026118 Unclassified 1360
335 Ga0207683_10119908 3300026121 Bacteria 2361
336 Ga0207683_10235362 3300026121 Bacteria 1670
337 Ga0207683_10731656 3300026121 Bacteria 918
338 Ga0207428_10000633 3300027907 Bacteria 41339
339 Ga0268266_10009514 3300028379 Bacteria 8552
340 Ga0268266_10024028 3300028379 Bacteria 5186
341 Ga0268266_10250286 3300028379 Bacteria 1639
342 Ga0268265_10113941 3300028380 Unclassified 2213
343 Ga0268265_10263943 3300028380 Bacteria 1532
344 Ga0268264_10078681 3300028381 Bacteria 2812
345 Ga0268264_10363534 3300028381 Unclassified 1381
346 Ga0265316_10000607 3300031344 Bacteria 39905
347 Ga0265316_10144218 3300031344 Bacteria 1787
348 Ga0373930_0008891 3300034816 Bacteria 1766
349 Ga0373948_0004725 3300034817 Bacteria 2171
350 Ga0373950_0008277 3300034818 Bacteria 1632
351 Ga0373958_0002536 3300034819 Bacteria 2568
352 Ga0373938_0003286 3300034957 Bacteria 2638
353 Ga0373928_0001588 3300035084 Bacteria 4405
354 Ga0373940_0001508 3300035088 Bacteria 4237
355 Ga0373940_0017661 3300035088 Unclassified 1781
356 Ga0373951_0000926 3300035091 Bacteria 7905
357 Ga0373952_0003455 3300035092 Bacteria 2850
358 Ga0373932_0002799 3300035112 Bacteria 4321
359 Ga0373939_0001094 3300035114 Bacteria 6653
360 Ga0373941_0000733 3300035115 Bacteria 6732
361 Ga0373954_0165748 3300035118 Bacteria 1082
362 Ga0373960_0000149 3300035121 Bacteria 11782
363 Ga0373960_0023357 3300035121 Bacteria 1665
364 Ga0373942_0001584 3300035207 Bacteria 5834
365 Ga0373961_0003281 3300035241 Bacteria 4027
366 Ga0373962_0005503 3300035242 Bacteria 3062
367 Ga0373962_0034876 3300035242 Bacteria 1395
368 Ga0373931_0018864 3300035691 Bacteria 3434
369 Ga0439446_0020341 3300042156 Bacteria 1869
370 Ga0451576_0008981 3300045051 Bacteria 11649
371 Ga0451576_0077393 3300045051 Bacteria 3462
372 Ga0451576_0097009 3300045051 Unclassified 3066
373 Ga0495592_0085374 3300046454 Bacteria 2276
374 Ga0495638_0006801 3300046460 Bacteria 8258
375 Ga0495653_0288341 3300046463 Bacteria 1075
376 Ga0495664_0000466 3300046477 Bacteria 19988
377 Ga0495608_0042573 3300046511 Bacteria 3037
378 Ga0495618_0134121 3300046514 Unclassified 1584
379 Ga0495628_0002337 3300046516 Bacteria 17123
380 Ga0495628_0133753 3300046516 Unclassified 1896
381 Ga0495630_0055999 3300046517 Bacteria 2954
382 Ga0495630_0424544 3300046517 Unclassified 1019
383 Ga0495652_0039495 3300046529 Bacteria 4081
384 Ga0495640_0069803 3300046533 Unclassified 2363
385 Ga0495640_0129358 3300046533 Bacteria 1635
386 Ga0495587_0005341 3300046536 Bacteria 8403
387 Ga0495645_0000735 3300046543 Bacteria 22370
388 Ga0495645_0001439 3300046543 Bacteria 16061
389 Ga0495667_0053027 3300046559 Bacteria 2671
390 Ga0495657_0198194 3300046675 Bacteria 1225
391 Ga0495599_0000577 3300046678 Bacteria 20939
392 Ga0495599_0275446 3300046678 Unclassified 1020
393 Ga0495623_0032331 3300046679 Bacteria 3363
394 Ga0495646_0037023 3300046680 Bacteria 3020
395 Ga0495658_0255966 3300046683 Bacteria 1102
396 Ga0495669_0078974 3300046684 Bacteria 1508
397 Ga0495600_0096733 3300046809 Unclassified 1925
398 Ga0495604_0056821 3300047317 Bacteria 3010
399 Ga0495674_0009886 3300047319 Bacteria 9054
400 Ga0495680_0009774 3300047322 Bacteria 8603
401 Ga0495680_0251739 3300047322 Unclassified 1252
402 Ga0495675_0033240 3300047444 Bacteria 3292
403 Ga0495677_0213713 3300047445 Bacteria 751
404 Ga0495684_0298562 3300047471 Bacteria 1157
405 Ga0495602_0030049 3300048088 Bacteria 5162
406 Ga0496102_0049115 3300048905 Bacteria 3838
407 Ga0496102_0063861 3300048905 Bacteria 3372
408 Ga0496102_0372077 3300048905 Bacteria 1345
409 Ga0496103_0051267 3300048906 Bacteria 2554
410 Ga0496103_0118012 3300048906 Unclassified 1689
411 Ga0496104_0000830 3300048907 Bacteria 26651
412 Ga0496104_0050211 3300048907 Bacteria 3936
413 Ga0496105_0043166 3300048908 Unclassified 3718
414 Ga0496106_0119619 3300048909 Unclassified 2058
415 Ga0496108_0001041 3300048911 Bacteria 21629
416 Ga0496108_0001495 3300048911 Bacteria 18489
417 Ga0496109_0024111 3300048912 Bacteria 5405
418 Ga0496109_0026080 3300048912 Bacteria 5209
419 Ga0496109_0206970 3300048912 Bacteria 1845
420 Ga0496109_0536011 3300048912 Unclassified 1104
421 Ga0496109_0676768 3300048912 Bacteria 969
422 Ga0496110_0002605 3300048913 Bacteria 13566
423 Ga0496111_0097987 3300048914 Unclassified 2153
424 Ga0496111_0173323 3300048914 Bacteria 1603
425 Ga0496112_0000626 3300048915 Bacteria 24545
426 Ga0496112_0326146 3300048915 Bacteria 1479
427 Ga0496113_0209641 3300048916 Unclassified 1551
428 Ga0496114_0127574 3300048917 Unclassified 2194
429 Ga0496114_0624259 3300048917 Unclassified 949
430 Ga0496115_0405460 3300048918 Unclassified 1106
431 Ga0501067_0163034 3300049583 Bacteria 1241
432 Ga0501069_0346461 3300049585 Unclassified 875
433 Ga0501073_0087502 3300049589 Archaea 2166
434 nmdc:mga03683_118550_c1 3300050489 Bacteria 1175
435 nmdc:mga0k408_9200_c1 3300050493 Bacteria 5320
436 nmdc:mga06z11_13767_c1 3300050494 Bacteria 3563
437 nmdc:mga06z11_18597_c1 3300050494 Unclassified 3177
438 nmdc:mga07m45_259388_c1 3300050496 Bacteria 1011
439 nmdc:mga05p37_133099_c1 3300050507 Bacteria 3050
440 nmdc:mga05p37_184839_c1 3300050507 Bacteria 2534
441 nmdc:mga09592_120938_c1 3300050508 Bacteria 2249
442 nmdc:mga09592_198257_c1 3300050508 Bacteria 1738
443 nmdc:mga08y16_244904_c1 3300050511 Unclassified 1853
444 nmdc:mga08y16_29425_c1 3300050511 Bacteria 5787
445 nmdc:mga08y16_418164_c1 3300050511 Bacteria 1370
446 nmdc:mga08y16_4466_c1 3300050511 Bacteria 14618
447 nmdc:mga08y16_63065_c1 3300050511 Unclassified 3870
448 nmdc:mga0n895_169467_c1 3300050512 Bacteria 2215
449 nmdc:mga0n895_316585_c1 3300050512 Bacteria 1581
450 nmdc:mga0n895_379752_c1 3300050512 Bacteria 1430
451 nmdc:mga0n895_396649_c1 3300050512 Bacteria 1396
452 nmdc:mga0n895_41641_c1 3300050512 Bacteria 4466
453 nmdc:mga0n895_46972_c1 3300050512 Bacteria 4220
454 nmdc:mga0n895_643_c1 3300050512 Bacteria 24319
455 nmdc:mga0n895_66015_c1 3300050512 Unclassified 3583
456 nmdc:mga0n895_69895_c1 3300050512 Bacteria 3479
457 nmdc:mga0n895_72802_c1 3300050512 Bacteria 3410
458 nmdc:mga0n895_73164_c1 3300050512 Unclassified 3402
459 nmdc:mga0n895_86558_c1 3300050512 Bacteria 3130
460 nmdc:mga0rr50_107152_c1 3300050513 Bacteria 2206
461 nmdc:mga0rr50_1155_c1 3300050513 Bacteria 14374
462 nmdc:mga0rr50_128259_c1 3300050513 Bacteria 2028
463 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
464 nmdc:mga08x19_122600_c1 3300050514 Bacteria 1744
465 nmdc:mga08x19_242759_c1 3300050514 Unclassified 1242
466 nmdc:mga08x19_246_c2 3300050514 Bacteria 31844
467 nmdc:mga08x19_399858_c1 3300050514 Bacteria 963
468 nmdc:mga08x19_48893_c1 3300050514 Bacteria 2711
469 nmdc:mga0a205_19221_c1 3300050515 Bacteria 6438
470 nmdc:mga0a205_275227_c1 3300050515 Bacteria 1560
471 nmdc:mga0a205_30475_c1 3300050515 Bacteria 5165
472 nmdc:mga0a205_495101_c1 3300050515 Bacteria 1080
473 nmdc:mga0a205_86621_c1 3300050515 Bacteria 3025
474 Ga0495619_0101907 3300053085 Unclassified 1955
475 Ga0500645_002700 3300053730 Bacteria 7710

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047445 Ga0495677_0213713 Ga0495677_0213713_53_718 203
2 3300046684 Ga0495669_0078974 Ga0495669_0078974_258_1046 223
3 3300046683 Ga0495658_0255966 Ga0495658_0255966_226_1011 228
4 3300005545 Ga0070695_100006389 Ga0070695_1000063898 230
5 3300048914 Ga0496111_0097987 Ga0496111_0097987_1225_1983 231
6 3300050512 nmdc:mga0n895_169467_c1 nmdc:mga0n895_169467_c1_10_768 231
7 3300050512 nmdc:mga0n895_643_c1 nmdc:mga0n895_643_c1_16456_17214 231
8 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_330869_331627 231
9 3300050514 nmdc:mga08x19_246_c2 nmdc:mga08x19_246_c2_8583_9341 231
10 3300009545 Ga0105237_10302508 Ga0105237_103025082 232
11 3300005366 Ga0070659_100067474 Ga0070659_1000674742 233
12 3300005457 Ga0070662_100050861 Ga0070662_1000508612 233
13 3300005530 Ga0070679_100109673 Ga0070679_1001096732 233
14 3300009148 Ga0105243_10040410 Ga0105243_100404103 233
15 3300009176 Ga0105242_10009458 Ga0105242_100094587 233
16 3300048905 Ga0496102_0372077 Ga0496102_0372077_346_1140 233
17 3300048916 Ga0496113_0209641 Ga0496113_0209641_401_1168 233
18 3300050515 nmdc:mga0a205_275227_c1 nmdc:mga0a205_275227_c1_598_1362 233
19 3300035118 Ga0373954_0165748 Ga0373954_0165748_177_944 234
20 3300046463 Ga0495653_0288341 Ga0495653_0288341_181_954 234
21 3300046477 Ga0495664_0000466 Ga0495664_0000466_17063_17836 234
22 3300046511 Ga0495608_0042573 Ga0495608_0042573_204_977 234
23 3300046514 Ga0495618_0134121 Ga0495618_0134121_13_786 234
24 3300046516 Ga0495628_0002337 Ga0495628_0002337_2339_3112 234
25 3300046517 Ga0495630_0055999 Ga0495630_0055999_168_941 234
26 3300046529 Ga0495652_0039495 Ga0495652_0039495_2003_2776 234
27 3300046533 Ga0495640_0129358 Ga0495640_0129358_479_1252 234
28 3300046536 Ga0495587_0005341 Ga0495587_0005341_1800_2573 234
29 3300046543 Ga0495645_0001439 Ga0495645_0001439_13250_14023 234
30 3300046559 Ga0495667_0053027 Ga0495667_0053027_145_918 234
31 3300046678 Ga0495599_0000577 Ga0495599_0000577_6769_7542 234
32 3300046679 Ga0495623_0032331 Ga0495623_0032331_464_1237 234
33 3300046680 Ga0495646_0037023 Ga0495646_0037023_2048_2821 234
34 3300047317 Ga0495604_0056821 Ga0495604_0056821_148_921 234
35 3300047319 Ga0495674_0009886 Ga0495674_0009886_7890_8663 234
36 3300047322 Ga0495680_0009774 Ga0495680_0009774_7774_8547 234
37 3300047444 Ga0495675_0033240 Ga0495675_0033240_442_1215 234
38 3300047471 Ga0495684_0298562 Ga0495684_0298562_38_811 234
39 3300048088 Ga0495602_0030049 Ga0495602_0030049_2783_3556 234
40 3300005295 Ga0065707_10164547 Ga0065707_101645472 235
41 3300005354 Ga0070675_100000035 Ga0070675_10000003510 235
42 3300025926 Ga0207659_10002714 Ga0207659_100027145 235
43 3300048912 Ga0496109_0206970 Ga0496109_0206970_805_1575 235
44 3300049589 Ga0501073_0087502 Ga0501073_0087502_738_1523 235
45 3300005441 Ga0070700_100027517 Ga0070700_1000275173 236
46 3300005548 Ga0070665_100005258 Ga0070665_1000052582 236
47 3300005549 Ga0070704_100226090 Ga0070704_1002260902 236
48 3300006871 Ga0075434_100037852 Ga0075434_1000378525 236
49 3300009177 Ga0105248_10252718 Ga0105248_102527182 236
50 3300009551 Ga0105238_10440374 Ga0105238_104403741 236
51 3300025938 Ga0207704_10424674 Ga0207704_104246742 236
52 3300025941 Ga0207711_10034966 Ga0207711_100349663 236
53 3300025942 Ga0207689_10104016 Ga0207689_101040162 236
54 3300026075 Ga0207708_10067889 Ga0207708_100678893 236
55 3300026121 Ga0207683_10731656 Ga0207683_107316561 236
56 3300028379 Ga0268266_10024028 Ga0268266_100240286 236
57 3300050508 nmdc:mga09592_198257_c1 nmdc:mga09592_198257_c1_138_926 236
58 3300006871 Ga0075434_100030314 Ga0075434_1000303145 237
59 3300009094 Ga0111539_10080316 Ga0111539_100803162 237
60 3300009147 Ga0114129_10079563 Ga0114129_100795632 237
61 3300009177 Ga0105248_10487126 Ga0105248_104871262 237
62 3300028379 Ga0268266_10250286 Ga0268266_102502862 237
63 3300035242 Ga0373962_0034876 Ga0373962_0034876_385_1161 237
64 3300050511 nmdc:mga08y16_63065_c1 nmdc:mga08y16_63065_c1_528_1304 237
65 3300050512 nmdc:mga0n895_46972_c1 nmdc:mga0n895_46972_c1_2363_3145 237
66 3300013296 Ga0157374_10316302 Ga0157374_103163022 238
67 3300005331 Ga0070670_100138580 Ga0070670_1001385801 239
68 3300005353 Ga0070669_100001923 Ga0070669_1000019237 239
69 3300005445 Ga0070708_100129291 Ga0070708_1001292912 239
70 3300005471 Ga0070698_100022268 Ga0070698_1000222682 239
71 3300005543 Ga0070672_100029481 Ga0070672_1000294812 239
72 3300006914 Ga0075436_100034402 Ga0075436_1000344022 239
73 3300006914 Ga0075436_100264625 Ga0075436_1002646252 239
74 3300007076 Ga0075435_100080581 Ga0075435_1000805812 239
75 3300009094 Ga0111539_10014453 Ga0111539_100144535 239
76 3300009147 Ga0114129_10461916 Ga0114129_104619162 239
77 3300025925 Ga0207650_10073879 Ga0207650_100738792 239
78 3300026116 Ga0207674_10037019 Ga0207674_100370193 239
79 3300031344 Ga0265316_10000607 Ga0265316_1000060720 239
80 3300035088 Ga0373940_0017661 Ga0373940_0017661_511_1293 239
81 3300050511 nmdc:mga08y16_29425_c1 nmdc:mga08y16_29425_c1_3535_4317 239
82 3300050512 nmdc:mga0n895_66015_c1 nmdc:mga0n895_66015_c1_1504_2286 239
83 3300050514 nmdc:mga08x19_242759_c1 nmdc:mga08x19_242759_c1_274_1056 239
84 3300050515 nmdc:mga0a205_19221_c1 nmdc:mga0a205_19221_c1_1645_2427 239
85 3300050515 nmdc:mga0a205_30475_c1 nmdc:mga0a205_30475_c1_2002_2784 239
86 3300005330 Ga0070690_100008523 Ga0070690_1000085232 240
87 3300005355 Ga0070671_100292011 Ga0070671_1002920112 240
88 3300005445 Ga0070708_100373777 Ga0070708_1003737771 240
89 3300005457 Ga0070662_100044549 Ga0070662_1000445493 240
90 3300005539 Ga0068853_100702050 Ga0068853_1007020501 240
91 3300005543 Ga0070672_100022989 Ga0070672_1000229892 240
92 3300005544 Ga0070686_100004795 Ga0070686_1000047954 240
93 3300005544 Ga0070686_100105002 Ga0070686_1001050022 240
94 3300005578 Ga0068854_100003187 Ga0068854_1000031873 240
95 3300005617 Ga0068859_100043788 Ga0068859_1000437883 240
96 3300005617 Ga0068859_100269437 Ga0068859_1002694372 240
97 3300005719 Ga0068861_100293192 Ga0068861_1002931922 240
98 3300005841 Ga0068863_100007150 Ga0068863_1000071508 240
99 3300006852 Ga0075433_10163354 Ga0075433_101633542 240
100 3300006871 Ga0075434_100000422 Ga0075434_10000042210 240
101 3300006914 Ga0075436_100005606 Ga0075436_1000056065 240
102 3300006931 Ga0097620_100043786 Ga0097620_1000437862 240
103 3300006931 Ga0097620_100269455 Ga0097620_1002694552 240
104 3300007076 Ga0075435_100000012 Ga0075435_1000000128 240
105 3300007076 Ga0075435_100014611 Ga0075435_1000146112 240
106 3300009093 Ga0105240_10127726 Ga0105240_101277262 240
107 3300009147 Ga0114129_10038577 Ga0114129_100385774 240
108 3300009174 Ga0105241_10038797 Ga0105241_100387972 240
109 3300009177 Ga0105248_10071665 Ga0105248_100716652 240
110 3300009177 Ga0105248_10149704 Ga0105248_101497042 240
111 3300009177 Ga0105248_10437229 Ga0105248_104372291 240
112 3300009177 Ga0105248_10533484 Ga0105248_105334842 240
113 3300009553 Ga0105249_10496057 Ga0105249_104960572 240
114 3300013306 Ga0163162_10102799 Ga0163162_101027992 240
115 3300014968 Ga0157379_10006385 Ga0157379_100063859 240
116 3300025903 Ga0207680_10028581 Ga0207680_100285813 240
117 3300025907 Ga0207645_10051557 Ga0207645_100515572 240
118 3300025911 Ga0207654_10058141 Ga0207654_100581412 240
119 3300025918 Ga0207662_10004611 Ga0207662_100046114 240
120 3300025923 Ga0207681_10096976 Ga0207681_100969762 240
121 3300025931 Ga0207644_10029579 Ga0207644_100295792 240
122 3300025931 Ga0207644_10135838 Ga0207644_101358382 240
123 3300025933 Ga0207706_10039849 Ga0207706_100398492 240
124 3300025934 Ga0207686_10273589 Ga0207686_102735892 240
125 3300025936 Ga0207670_10079432 Ga0207670_100794322 240
126 3300025941 Ga0207711_10013457 Ga0207711_100134572 240
127 3300025941 Ga0207711_10536170 Ga0207711_105361702 240
128 3300025941 Ga0207711_10699977 Ga0207711_106999771 240
129 3300025981 Ga0207640_10007129 Ga0207640_100071292 240
130 3300025981 Ga0207640_10088045 Ga0207640_100880451 240
131 3300026035 Ga0207703_10248714 Ga0207703_102487142 240
132 3300026041 Ga0207639_10333740 Ga0207639_103337401 240
133 3300026088 Ga0207641_10000693 Ga0207641_1000069313 240
134 3300026118 Ga0207675_100007011 Ga0207675_1000070112 240
135 3300026118 Ga0207675_100039381 Ga0207675_1000393813 240
136 3300028381 Ga0268264_10078681 Ga0268264_100786812 240
137 3300034816 Ga0373930_0008891 Ga0373930_0008891_786_1571 240
138 3300034817 Ga0373948_0004725 Ga0373948_0004725_594_1379 240
139 3300034818 Ga0373950_0008277 Ga0373950_0008277_195_980 240
140 3300034819 Ga0373958_0002536 Ga0373958_0002536_1415_2200 240
141 3300034957 Ga0373938_0003286 Ga0373938_0003286_606_1391 240
142 3300035084 Ga0373928_0001588 Ga0373928_0001588_481_1266 240
143 3300035088 Ga0373940_0001508 Ga0373940_0001508_3017_3802 240
144 3300035091 Ga0373951_0000926 Ga0373951_0000926_5910_6695 240
145 3300035092 Ga0373952_0003455 Ga0373952_0003455_2052_2837 240
146 3300035112 Ga0373932_0002799 Ga0373932_0002799_518_1303 240
147 3300035114 Ga0373939_0001094 Ga0373939_0001094_5826_6611 240
148 3300035115 Ga0373941_0000733 Ga0373941_0000733_3163_3948 240
149 3300035121 Ga0373960_0000149 Ga0373960_0000149_6228_7013 240
150 3300035121 Ga0373960_0023357 Ga0373960_0023357_830_1615 240
151 3300035207 Ga0373942_0001584 Ga0373942_0001584_369_1154 240
152 3300035241 Ga0373961_0003281 Ga0373961_0003281_3031_3816 240
153 3300035242 Ga0373962_0005503 Ga0373962_0005503_115_900 240
154 3300035691 Ga0373931_0018864 Ga0373931_0018864_2310_3095 240
155 3300042156 Ga0439446_0020341 Ga0439446_0020341_234_1019 240
156 3300045051 Ga0451576_0008981 Ga0451576_0008981_2145_2930 240
157 3300045051 Ga0451576_0077393 Ga0451576_0077393_1487_2278 240
158 3300045051 Ga0451576_0097009 Ga0451576_0097009_1061_2032 240
159 3300048905 Ga0496102_0063861 Ga0496102_0063861_1818_2603 240
160 3300048906 Ga0496103_0118012 Ga0496103_0118012_118_903 240
161 3300049585 Ga0501069_0346461 Ga0501069_0346461_52_855 240
162 3300050512 nmdc:mga0n895_73164_c1 nmdc:mga0n895_73164_c1_378_1163 240
163 3300050513 nmdc:mga0rr50_1155_c1 nmdc:mga0rr50_1155_c1_7996_8781 240
164 3300005334 Ga0068869_100575321 Ga0068869_1005753211 241
165 3300005347 Ga0070668_100036929 Ga0070668_1000369292 241
166 3300005353 Ga0070669_100012922 Ga0070669_1000129224 241
167 3300005356 Ga0070674_100050306 Ga0070674_1000503063 241
168 3300005440 Ga0070705_100004497 Ga0070705_1000044973 241
169 3300005441 Ga0070700_100378823 Ga0070700_1003788232 241
170 3300005459 Ga0068867_100039012 Ga0068867_1000390122 241
171 3300005545 Ga0070695_100033551 Ga0070695_1000335512 241
172 3300005546 Ga0070696_100013653 Ga0070696_1000136533 241
173 3300005549 Ga0070704_100028491 Ga0070704_1000284912 241
174 3300005564 Ga0070664_100631539 Ga0070664_1006315392 241
175 3300005578 Ga0068854_100293610 Ga0068854_1002936102 241
176 3300005615 Ga0070702_100069897 Ga0070702_1000698972 241
177 3300005617 Ga0068859_100367227 Ga0068859_1003672271 241
178 3300005718 Ga0068866_10006194 Ga0068866_100061942 241
179 3300005719 Ga0068861_100330890 Ga0068861_1003308902 241
180 3300006844 Ga0075428_100360141 Ga0075428_1003601412 241
181 3300006931 Ga0097620_100367194 Ga0097620_1003671941 241
182 3300007076 Ga0075435_100046916 Ga0075435_1000469162 241
183 3300009147 Ga0114129_10011555 Ga0114129_100115556 241
184 3300009176 Ga0105242_10012650 Ga0105242_100126502 241
185 3300009553 Ga0105249_10043328 Ga0105249_100433281 241
186 3300013297 Ga0157378_10012837 Ga0157378_100128372 241
187 3300014326 Ga0157380_10083413 Ga0157380_100834132 241
188 3300025907 Ga0207645_10001628 Ga0207645_1000162819 241
189 3300025917 Ga0207660_10479118 Ga0207660_104791182 241
190 3300025923 Ga0207681_10017646 Ga0207681_100176464 241
191 3300025933 Ga0207706_10234181 Ga0207706_102341812 241
192 3300025934 Ga0207686_10138185 Ga0207686_101381852 241
193 3300025935 Ga0207709_10103160 Ga0207709_101031602 241
194 3300026075 Ga0207708_10028975 Ga0207708_100289752 241
195 3300026089 Ga0207648_10004443 Ga0207648_1000444312 241
196 3300026118 Ga0207675_100210789 Ga0207675_1002107892 241
197 3300026118 Ga0207675_100395823 Ga0207675_1003958231 241
198 3300028380 Ga0268265_10113941 Ga0268265_101139412 241
199 3300028381 Ga0268264_10363534 Ga0268264_103635342 241
200 3300046460 Ga0495638_0006801 Ga0495638_0006801_2006_2800 241
201 3300050512 nmdc:mga0n895_316585_c1 nmdc:mga0n895_316585_c1_776_1564 241
202 3300050514 nmdc:mga08x19_399858_c1 nmdc:mga08x19_399858_c1_133_921 241
203 3300053085 Ga0495619_0101907 Ga0495619_0101907_509_1312 241
204 3300005329 Ga0070683_100121570 Ga0070683_1001215703 242
205 3300005330 Ga0070690_100443036 Ga0070690_1004430362 242
206 3300005335 Ga0070666_10357519 Ga0070666_103575192 242
207 3300005338 Ga0068868_100077063 Ga0068868_1000770632 242
208 3300005364 Ga0070673_100128469 Ga0070673_1001284691 242
209 3300005365 Ga0070688_100433167 Ga0070688_1004331671 242
210 3300005518 Ga0070699_100079654 Ga0070699_1000796542 242
211 3300005535 Ga0070684_100084281 Ga0070684_1000842812 242
212 3300005543 Ga0070672_100173322 Ga0070672_1001733222 242
213 3300005577 Ga0068857_100040867 Ga0068857_1000408672 242
214 3300005718 Ga0068866_10037352 Ga0068866_100373522 242
215 3300005718 Ga0068866_10053970 Ga0068866_100539702 242
216 3300005840 Ga0068870_10116350 Ga0068870_101163502 242
217 3300005842 Ga0068858_100198302 Ga0068858_1001983022 242
218 3300005842 Ga0068858_100473736 Ga0068858_1004737362 242
219 3300005844 Ga0068862_100141316 Ga0068862_1001413162 242
220 3300005844 Ga0068862_100743463 Ga0068862_1007434632 242
221 3300005937 Ga0081455_10122211 Ga0081455_101222112 242
222 3300006237 Ga0097621_100005757 Ga0097621_1000057572 242
223 3300006358 Ga0068871_100117682 Ga0068871_1001176822 242
224 3300006852 Ga0075433_10031726 Ga0075433_100317262 242
225 3300006871 Ga0075434_100124466 Ga0075434_1001244662 242
226 3300006880 Ga0075429_100275674 Ga0075429_1002756742 242
227 3300006881 Ga0068865_100006947 Ga0068865_1000069472 242
228 3300009093 Ga0105240_10304819 Ga0105240_103048192 242
229 3300009147 Ga0114129_10737329 Ga0114129_107373292 242
230 3300009176 Ga0105242_10008568 Ga0105242_100085686 242
231 3300009177 Ga0105248_10137271 Ga0105248_101372712 242
232 3300011119 Ga0105246_10025701 Ga0105246_100257015 242
233 3300013297 Ga0157378_10204303 Ga0157378_102043032 242
234 3300014325 Ga0163163_10093896 Ga0163163_100938962 242
235 3300014969 Ga0157376_10065522 Ga0157376_100655223 242
236 3300025893 Ga0207682_10055090 Ga0207682_100550902 242
237 3300025899 Ga0207642_10056193 Ga0207642_100561932 242
238 3300025899 Ga0207642_10056326 Ga0207642_100563261 242
239 3300025901 Ga0207688_10107579 Ga0207688_101075792 242
240 3300025908 Ga0207643_10045794 Ga0207643_100457943 242
241 3300025913 Ga0207695_10214877 Ga0207695_102148772 242
242 3300025925 Ga0207650_10495108 Ga0207650_104951082 242
243 3300025933 Ga0207706_10022700 Ga0207706_100227002 242
244 3300025934 Ga0207686_10007196 Ga0207686_100071966 242
245 3300025934 Ga0207686_10042680 Ga0207686_100426802 242
246 3300025936 Ga0207670_10108355 Ga0207670_101083552 242
247 3300025938 Ga0207704_10004236 Ga0207704_100042362 242
248 3300025940 Ga0207691_10133311 Ga0207691_101333112 242
249 3300025940 Ga0207691_10191282 Ga0207691_101912822 242
250 3300025941 Ga0207711_10193608 Ga0207711_101936082 242
251 3300025944 Ga0207661_10119148 Ga0207661_101191483 242
252 3300025960 Ga0207651_10066175 Ga0207651_100661753 242
253 3300025961 Ga0207712_10089246 Ga0207712_100892462 242
254 3300025961 Ga0207712_10112759 Ga0207712_101127592 242
255 3300026089 Ga0207648_10088767 Ga0207648_100887673 242
256 3300028380 Ga0268265_10263943 Ga0268265_102639431 242
257 3300046517 Ga0495630_0424544 Ga0495630_0424544_190_1005 242
258 3300046678 Ga0495599_0275446 Ga0495599_0275446_37_834 242
259 3300048912 Ga0496109_0676768 Ga0496109_0676768_12_809 242
260 3300048917 Ga0496114_0127574 Ga0496114_0127574_187_1020 242
261 3300050507 nmdc:mga05p37_184839_c1 nmdc:mga05p37_184839_c1_1716_2516 242
262 3300050508 nmdc:mga09592_120938_c1 nmdc:mga09592_120938_c1_1180_1986 242
263 3300050511 nmdc:mga08y16_244904_c1 nmdc:mga08y16_244904_c1_247_1053 242
264 3300005293 Ga0065715_10014812 Ga0065715_100148122 243
265 3300005293 Ga0065715_10097179 Ga0065715_100971792 243
266 3300005293 Ga0065715_10196078 Ga0065715_101960782 243
267 3300005329 Ga0070683_100003650 Ga0070683_1000036502 243
268 3300005335 Ga0070666_10040356 Ga0070666_100403563 243
269 3300005335 Ga0070666_10080090 Ga0070666_100800902 243
270 3300005338 Ga0068868_100025293 Ga0068868_1000252932 243
271 3300005340 Ga0070689_100069469 Ga0070689_1000694692 243
272 3300005343 Ga0070687_100023972 Ga0070687_1000239722 243
273 3300005356 Ga0070674_100240670 Ga0070674_1002406702 243
274 3300005364 Ga0070673_100000622 Ga0070673_10000062212 243
275 3300005367 Ga0070667_100079686 Ga0070667_1000796862 243
276 3300005367 Ga0070667_100411622 Ga0070667_1004116222 243
277 3300005406 Ga0070703_10100443 Ga0070703_101004431 243
278 3300005440 Ga0070705_100038659 Ga0070705_1000386593 243
279 3300005455 Ga0070663_100517995 Ga0070663_1005179952 243
280 3300005457 Ga0070662_100214103 Ga0070662_1002141032 243
281 3300005458 Ga0070681_10287328 Ga0070681_102873282 243
282 3300005459 Ga0068867_100017428 Ga0068867_1000174283 243
283 3300005468 Ga0070707_100374783 Ga0070707_1003747832 243
284 3300005535 Ga0070684_100042700 Ga0070684_1000427002 243
285 3300005544 Ga0070686_100198800 Ga0070686_1001988002 243
286 3300005547 Ga0070693_100034428 Ga0070693_1000344282 243
287 3300005548 Ga0070665_100003072 Ga0070665_1000030722 243
288 3300005549 Ga0070704_100015912 Ga0070704_1000159123 243
289 3300005564 Ga0070664_100002291 Ga0070664_10000229116 243
290 3300005564 Ga0070664_100172133 Ga0070664_1001721332 243
291 3300005564 Ga0070664_100377675 Ga0070664_1003776752 243
292 3300005578 Ga0068854_100070524 Ga0068854_1000705242 243
293 3300005615 Ga0070702_100128796 Ga0070702_1001287962 243
294 3300005616 Ga0068852_100042166 Ga0068852_1000421662 243
295 3300005616 Ga0068852_100310211 Ga0068852_1003102112 243
296 3300005618 Ga0068864_100009264 Ga0068864_1000092644 243
297 3300005618 Ga0068864_100368653 Ga0068864_1003686532 243
298 3300005719 Ga0068861_100180064 Ga0068861_1001800642 243
299 3300005841 Ga0068863_100232856 Ga0068863_1002328562 243
300 3300005842 Ga0068858_100004003 Ga0068858_1000040032 243
301 3300005842 Ga0068858_100061890 Ga0068858_1000618903 243
302 3300005842 Ga0068858_100228535 Ga0068858_1002285352 243
303 3300006178 Ga0075367_10042545 Ga0075367_100425452 243
304 3300006353 Ga0075370_10268703 Ga0075370_102687032 243
305 3300006844 Ga0075428_100001509 Ga0075428_1000015095 243
306 3300006847 Ga0075431_100042121 Ga0075431_1000421211 243
307 3300006871 Ga0075434_100043349 Ga0075434_1000433492 243
308 3300006881 Ga0068865_100066394 Ga0068865_1000663942 243
309 3300006914 Ga0075436_100028917 Ga0075436_1000289172 243
310 3300007076 Ga0075435_100001689 Ga0075435_10000168910 243
311 3300009093 Ga0105240_10272501 Ga0105240_102725012 243
312 3300009094 Ga0111539_10385478 Ga0111539_103854781 243
313 3300009098 Ga0105245_10026213 Ga0105245_100262134 243
314 3300009101 Ga0105247_10007815 Ga0105247_100078152 243
315 3300009148 Ga0105243_10633840 Ga0105243_106338402 243
316 3300009174 Ga0105241_10201121 Ga0105241_102011212 243
317 3300009176 Ga0105242_10002061 Ga0105242_1000206111 243
318 3300009177 Ga0105248_10062352 Ga0105248_100623522 243
319 3300009177 Ga0105248_10069002 Ga0105248_100690022 243
320 3300009545 Ga0105237_10034258 Ga0105237_100342582 243
321 3300011119 Ga0105246_10100745 Ga0105246_101007451 243
322 3300013296 Ga0157374_10031219 Ga0157374_100312195 243
323 3300013296 Ga0157374_10068853 Ga0157374_100688532 243
324 3300014968 Ga0157379_10015553 Ga0157379_100155532 243
325 3300014969 Ga0157376_10083136 Ga0157376_100831362 243
326 3300025315 Ga0207697_10016320 Ga0207697_100163204 243
327 3300025900 Ga0207710_10084677 Ga0207710_100846771 243
328 3300025903 Ga0207680_10003857 Ga0207680_100038577 243
329 3300025904 Ga0207647_10011629 Ga0207647_100116293 243
330 3300025918 Ga0207662_10003765 Ga0207662_100037654 243
331 3300025923 Ga0207681_10126896 Ga0207681_101268962 243
332 3300025926 Ga0207659_10256822 Ga0207659_102568222 243
333 3300025927 Ga0207687_10023582 Ga0207687_100235822 243
334 3300025931 Ga0207644_10019943 Ga0207644_100199433 243
335 3300025933 Ga0207706_10107020 Ga0207706_101070202 243
336 3300025934 Ga0207686_10005954 Ga0207686_100059544 243
337 3300025934 Ga0207686_10414451 Ga0207686_104144512 243
338 3300025935 Ga0207709_10022402 Ga0207709_100224022 243
339 3300025938 Ga0207704_10127038 Ga0207704_101270382 243
340 3300025941 Ga0207711_10006204 Ga0207711_100062045 243
341 3300025941 Ga0207711_10040464 Ga0207711_100404642 243
342 3300025941 Ga0207711_10058198 Ga0207711_100581982 243
343 3300025944 Ga0207661_10025470 Ga0207661_100254702 243
344 3300025945 Ga0207679_10003988 Ga0207679_100039885 243
345 3300025945 Ga0207679_10341917 Ga0207679_103419172 243
346 3300025961 Ga0207712_10196770 Ga0207712_101967702 243
347 3300025981 Ga0207640_10082407 Ga0207640_100824072 243
348 3300025986 Ga0207658_10060760 Ga0207658_100607602 243
349 3300025986 Ga0207658_10214000 Ga0207658_102140002 243
350 3300026023 Ga0207677_10011530 Ga0207677_100115302 243
351 3300026023 Ga0207677_10557341 Ga0207677_105573411 243
352 3300026035 Ga0207703_10055226 Ga0207703_100552263 243
353 3300026075 Ga0207708_10006874 Ga0207708_100068746 243
354 3300026089 Ga0207648_10017686 Ga0207648_100176864 243
355 3300026095 Ga0207676_10010229 Ga0207676_100102292 243
356 3300026118 Ga0207675_100072562 Ga0207675_1000725623 243
357 3300026118 Ga0207675_100175798 Ga0207675_1001757982 243
358 3300026121 Ga0207683_10235362 Ga0207683_102353622 243
359 3300028379 Ga0268266_10009514 Ga0268266_100095143 243
360 3300031344 Ga0265316_10144218 Ga0265316_101442182 243
361 3300046454 Ga0495592_0085374 Ga0495592_0085374_438_1244 243
362 3300046675 Ga0495657_0198194 Ga0495657_0198194_161_970 243
363 3300048905 Ga0496102_0049115 Ga0496102_0049115_263_1057 243
364 3300048906 Ga0496103_0051267 Ga0496103_0051267_694_1500 243
365 3300048907 Ga0496104_0000830 Ga0496104_0000830_5526_6320 243
366 3300048907 Ga0496104_0050211 Ga0496104_0050211_2949_3767 243
367 3300048908 Ga0496105_0043166 Ga0496105_0043166_1710_2504 243
368 3300048909 Ga0496106_0119619 Ga0496106_0119619_762_1556 243
369 3300048911 Ga0496108_0001041 Ga0496108_0001041_8973_9767 243
370 3300048911 Ga0496108_0001495 Ga0496108_0001495_6697_7515 243
371 3300048912 Ga0496109_0024111 Ga0496109_0024111_3381_4175 243
372 3300048912 Ga0496109_0026080 Ga0496109_0026080_1162_1980 243
373 3300048912 Ga0496109_0536011 Ga0496109_0536011_83_877 243
374 3300048913 Ga0496110_0002605 Ga0496110_0002605_2995_3789 243
375 3300048914 Ga0496111_0173323 Ga0496111_0173323_58_852 243
376 3300048915 Ga0496112_0000626 Ga0496112_0000626_5115_5909 243
377 3300048915 Ga0496112_0326146 Ga0496112_0326146_150_968 243
378 3300048918 Ga0496115_0405460 Ga0496115_0405460_185_991 243
379 3300049583 Ga0501067_0163034 Ga0501067_0163034_201_1001 243
380 3300050494 nmdc:mga06z11_18597_c1 nmdc:mga06z11_18597_c1_1099_1887 243
381 3300050496 nmdc:mga07m45_259388_c1 nmdc:mga07m45_259388_c1_100_939 243
382 3300050511 nmdc:mga08y16_418164_c1 nmdc:mga08y16_418164_c1_275_1096 243
383 3300050512 nmdc:mga0n895_379752_c1 nmdc:mga0n895_379752_c1_372_1166 243
384 3300050512 nmdc:mga0n895_72802_c1 nmdc:mga0n895_72802_c1_530_1330 243
385 3300050514 nmdc:mga08x19_48893_c1 nmdc:mga08x19_48893_c1_592_1410 243
386 3300053730 Ga0500645_002700 Ga0500645_002700_3948_4736 243
387 3300005331 Ga0070670_100170001 Ga0070670_1001700012 244
388 3300005334 Ga0068869_100097247 Ga0068869_1000972472 244
389 3300005340 Ga0070689_100103407 Ga0070689_1001034072 244
390 3300005343 Ga0070687_100034838 Ga0070687_1000348382 244
391 3300005354 Ga0070675_100027461 Ga0070675_1000274612 244
392 3300005364 Ga0070673_100054923 Ga0070673_1000549233 244
393 3300005365 Ga0070688_100225206 Ga0070688_1002252062 244
394 3300005365 Ga0070688_100444000 Ga0070688_1004440001 244
395 3300005456 Ga0070678_100019928 Ga0070678_1000199282 244
396 3300005457 Ga0070662_100222749 Ga0070662_1002227492 244
397 3300005466 Ga0070685_10033291 Ga0070685_100332912 244
398 3300005536 Ga0070697_100009337 Ga0070697_1000093372 244
399 3300005546 Ga0070696_100195965 Ga0070696_1001959651 244
400 3300005617 Ga0068859_100225859 Ga0068859_1002258592 244
401 3300005618 Ga0068864_100141775 Ga0068864_1001417752 244
402 3300005718 Ga0068866_10043565 Ga0068866_100435652 244
403 3300005719 Ga0068861_100219097 Ga0068861_1002190972 244
404 3300005840 Ga0068870_10105758 Ga0068870_101057582 244
405 3300005841 Ga0068863_100239181 Ga0068863_1002391812 244
406 3300005842 Ga0068858_100075913 Ga0068858_1000759133 244
407 3300005985 Ga0081539_10006314 Ga0081539_100063148 244
408 3300006051 Ga0075364_10017132 Ga0075364_100171322 244
409 3300006177 Ga0075362_10065365 Ga0075362_100653652 244
410 3300006178 Ga0075367_10111239 Ga0075367_101112392 244
411 3300006195 Ga0075366_10000836 Ga0075366_1000083613 244
412 3300006358 Ga0068871_100357558 Ga0068871_1003575581 244
413 3300006844 Ga0075428_100083208 Ga0075428_1000832082 244
414 3300006852 Ga0075433_10279631 Ga0075433_102796312 244
415 3300006880 Ga0075429_100213608 Ga0075429_1002136082 244
416 3300006881 Ga0068865_100153659 Ga0068865_1001536592 244
417 3300006914 Ga0075436_100225478 Ga0075436_1002254782 244
418 3300006931 Ga0097620_100225866 Ga0097620_1002258662 244
419 3300007076 Ga0075435_100081612 Ga0075435_1000816121 244
420 3300007076 Ga0075435_100110374 Ga0075435_1001103742 244
421 3300009094 Ga0111539_10001106 Ga0111539_100011065 244
422 3300009174 Ga0105241_10398963 Ga0105241_103989632 244
423 3300009176 Ga0105242_10080506 Ga0105242_100805061 244
424 3300009177 Ga0105248_10455494 Ga0105248_104554942 244
425 3300009553 Ga0105249_10270995 Ga0105249_102709952 244
426 3300014326 Ga0157380_10718684 Ga0157380_107186842 244
427 3300025918 Ga0207662_10002800 Ga0207662_100028002 244
428 3300025925 Ga0207650_10041831 Ga0207650_100418312 244
429 3300025933 Ga0207706_10179303 Ga0207706_101793032 244
430 3300025934 Ga0207686_10155218 Ga0207686_101552182 244
431 3300025935 Ga0207709_10087742 Ga0207709_100877422 244
432 3300025935 Ga0207709_10502157 Ga0207709_105021572 244
433 3300025937 Ga0207669_10270285 Ga0207669_102702851 244
434 3300025940 Ga0207691_10078745 Ga0207691_100787452 244
435 3300025941 Ga0207711_10461627 Ga0207711_104616272 244
436 3300025942 Ga0207689_10036670 Ga0207689_100366704 244
437 3300025961 Ga0207712_10091413 Ga0207712_100914132 244
438 3300025986 Ga0207658_10143655 Ga0207658_101436551 244
439 3300026023 Ga0207677_10155833 Ga0207677_101558332 244
440 3300026067 Ga0207678_10021408 Ga0207678_100214083 244
441 3300026075 Ga0207708_10077922 Ga0207708_100779223 244
442 3300026089 Ga0207648_10002915 Ga0207648_1000291512 244
443 3300026118 Ga0207675_100132997 Ga0207675_1001329972 244
444 3300026121 Ga0207683_10119908 Ga0207683_101199082 244
445 3300027907 Ga0207428_10000633 Ga0207428_100006333 244
446 3300046516 Ga0495628_0133753 Ga0495628_0133753_481_1335 244
447 3300046533 Ga0495640_0069803 Ga0495640_0069803_758_1612 244
448 3300046543 Ga0495645_0000735 Ga0495645_0000735_18443_19297 244
449 3300046809 Ga0495600_0096733 Ga0495600_0096733_100_954 244
450 3300047322 Ga0495680_0251739 Ga0495680_0251739_37_891 244
451 3300048917 Ga0496114_0624259 Ga0496114_0624259_23_877 244
452 3300050489 nmdc:mga03683_118550_c1 nmdc:mga03683_118550_c1_289_1089 244
453 3300050493 nmdc:mga0k408_9200_c1 nmdc:mga0k408_9200_c1_2376_3176 244
454 3300050494 nmdc:mga06z11_13767_c1 nmdc:mga06z11_13767_c1_155_955 244
455 3300050511 nmdc:mga08y16_4466_c1 nmdc:mga08y16_4466_c1_3212_4012 244
456 3300050512 nmdc:mga0n895_41641_c1 nmdc:mga0n895_41641_c1_3587_4387 244
457 3300050512 nmdc:mga0n895_69895_c1 nmdc:mga0n895_69895_c1_1717_2517 244
458 3300050512 nmdc:mga0n895_86558_c1 nmdc:mga0n895_86558_c1_1188_2045 244
459 3300050513 nmdc:mga0rr50_107152_c1 nmdc:mga0rr50_107152_c1_187_987 244
460 3300050513 nmdc:mga0rr50_128259_c1 nmdc:mga0rr50_128259_c1_179_1036 244
461 3300050514 nmdc:mga08x19_122600_c1 nmdc:mga08x19_122600_c1_413_1270 244
462 3300050515 nmdc:mga0a205_86621_c1 nmdc:mga0a205_86621_c1_185_985 244
463 3300005444 Ga0070694_100016942 Ga0070694_1000169422 245
464 3300005546 Ga0070696_100049120 Ga0070696_1000491202 245
465 3300009147 Ga0114129_10184214 Ga0114129_101842142 245
466 3300025922 Ga0207646_10525863 Ga0207646_105258631 245
467 3300009098 Ga0105245_10011294 Ga0105245_100112944 246
468 3300025927 Ga0207687_10007227 Ga0207687_100072273 246
469 3300006051 Ga0075364_10127930 Ga0075364_101279301 247
470 3300007076 Ga0075435_100032221 Ga0075435_1000322214 247
471 3300009147 Ga0114129_10115639 Ga0114129_101156394 247
472 3300050507 nmdc:mga05p37_133099_c1 nmdc:mga05p37_133099_c1_1916_2749 247
473 3300050512 nmdc:mga0n895_396649_c1 nmdc:mga0n895_396649_c1_236_1048 247
474 3300050515 nmdc:mga0a205_495101_c1 nmdc:mga0a205_495101_c1_33_845 247
475 3300005290 Ga0065712_10075118 Ga0065712_100751182 256

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.8317 49 254
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.7943 49 254
5nxb-assembly1.cif.gz_B mouse galactocerebrosidase in complex with saposin a 0.7569 33 256
6y6s-assembly1.cif.gz_A mouse galactocerebrosidase complexed with galacto-noeurostegine gns at ph 6.8 0.7417 33 256
2yro-assembly1.cif.gz_A solution structure of the c-terminal gal-bind lectin protein from human galectin-8 0.7369 102 252
ID Description Score Start End Superfamily
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8317 49 254 2.60.120.560
af_A0A5K1K8Q0_451_608_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7959 57 251 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7943 49 254 2.60.120.560
af_Q58355_45_220_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7866 34 251 2.60.120.560
af_Q58355_45_220_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7741 34 251 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A2V8QIQ4-F1-model_v4 Uncharacterized protein 0.9581 88 254
AF-A0A2V8QIQ4-F1-model_v4 Uncharacterized protein 0.9448 88 254
AF-A0A536CZE6-F1-model_v4 LamG domain-containing protein 0.9182 90 256 GO:0016787
AF-A0A2V7S4B8-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9065 93 256
AF-A0A2V8EYJ6-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9013 26 256

Feature Viewer

pLDDT pTM Quality
83.35 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map