F451397
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 475 | 222 | 475 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0097009|Ga0451576_0097009_1061_2032 |
| Length | 312 |
| Sequence | MNLNTDKQRLRPCRAGAAATISNTFTVIRNRTANFFSMAAGPHPRRARSLTPRLGFAWPRLGVAAGAALSVELKVDLSKERAGRPPATFEPMVGTWVVARDGADNVIMVDGRPWVASKDNPTKLLIESARRLYGTSNEELMDNAKQFAYFPVAVLKGVDNFTNGTISVKFKTLSGDADRASGILFNVKPNGDWLAIRYNDTENNVALWEFHNGMRRNMRFSDRAKKFMLDRAAWHELKMTVKDADFKAWLDGELALEYTLGSMPGPGRNGAPPNPDLIPANNPVLQPPVKGKIGLWAKTDSTSYFKDYVVIQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 148 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 149 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 150 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 151 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 152 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 153 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 154 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 156 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 158 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 164 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 166 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 167 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 202 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 206 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 207 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 211 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 212 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 213 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 214 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.74 |
| Nodule | 0 |
| Rhizoplane | 5.26 |
| Rhizosphere | 92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10075118 | 3300005290 | Bacteria | 3930 |
| 2 | Ga0065715_10014812 | 3300005293 | Bacteria | 1962 |
| 3 | Ga0065715_10097179 | 3300005293 | Unclassified | 3733 |
| 4 | Ga0065715_10196078 | 3300005293 | Unclassified | 1387 |
| 5 | Ga0065707_10164547 | 3300005295 | Bacteria | 1533 |
| 6 | Ga0070683_100003650 | 3300005329 | Bacteria | 12541 |
| 7 | Ga0070683_100121570 | 3300005329 | Bacteria | 2467 |
| 8 | Ga0070690_100008523 | 3300005330 | Bacteria | 5910 |
| 9 | Ga0070690_100443036 | 3300005330 | Bacteria | 961 |
| 10 | Ga0070670_100138580 | 3300005331 | Unclassified | 2103 |
| 11 | Ga0070670_100170001 | 3300005331 | Bacteria | 1890 |
| 12 | Ga0068869_100097247 | 3300005334 | Bacteria | 2222 |
| 13 | Ga0068869_100575321 | 3300005334 | Unclassified | 949 |
| 14 | Ga0070666_10040356 | 3300005335 | Bacteria | 3115 |
| 15 | Ga0070666_10080090 | 3300005335 | Bacteria | 2231 |
| 16 | Ga0070666_10357519 | 3300005335 | Unclassified | 1046 |
| 17 | Ga0068868_100025293 | 3300005338 | Bacteria | 4514 |
| 18 | Ga0068868_100077063 | 3300005338 | Unclassified | 2667 |
| 19 | Ga0070689_100069469 | 3300005340 | Bacteria | 2748 |
| 20 | Ga0070689_100103407 | 3300005340 | Bacteria | 2257 |
| 21 | Ga0070687_100023972 | 3300005343 | Bacteria | 2906 |
| 22 | Ga0070687_100034838 | 3300005343 | Bacteria | 2495 |
| 23 | Ga0070668_100036929 | 3300005347 | Bacteria | 3729 |
| 24 | Ga0070669_100001923 | 3300005353 | Bacteria | 14987 |
| 25 | Ga0070669_100012922 | 3300005353 | Bacteria | 5929 |
| 26 | Ga0070675_100000035 | 3300005354 | Bacteria | 86571 |
| 27 | Ga0070675_100027461 | 3300005354 | Bacteria | 4572 |
| 28 | Ga0070671_100292011 | 3300005355 | Bacteria | 1387 |
| 29 | Ga0070674_100050306 | 3300005356 | Bacteria | 2868 |
| 30 | Ga0070674_100240670 | 3300005356 | Unclassified | 1417 |
| 31 | Ga0070673_100000622 | 3300005364 | Bacteria | 19404 |
| 32 | Ga0070673_100054923 | 3300005364 | Bacteria | 3136 |
| 33 | Ga0070673_100128469 | 3300005364 | Unclassified | 2123 |
| 34 | Ga0070688_100225206 | 3300005365 | Bacteria | 1324 |
| 35 | Ga0070688_100433167 | 3300005365 | Bacteria | 980 |
| 36 | Ga0070688_100444000 | 3300005365 | Bacteria | 969 |
| 37 | Ga0070659_100067474 | 3300005366 | Unclassified | 2837 |
| 38 | Ga0070667_100079686 | 3300005367 | Unclassified | 2800 |
| 39 | Ga0070667_100411622 | 3300005367 | Bacteria | 1232 |
| 40 | Ga0070703_10100443 | 3300005406 | Bacteria | 1019 |
| 41 | Ga0070705_100004497 | 3300005440 | Bacteria | 6792 |
| 42 | Ga0070705_100038659 | 3300005440 | Bacteria | 2702 |
| 43 | Ga0070700_100027517 | 3300005441 | Unclassified | 3372 |
| 44 | Ga0070700_100378823 | 3300005441 | Bacteria | 1057 |
| 45 | Ga0070694_100016942 | 3300005444 | Unclassified | 4596 |
| 46 | Ga0070708_100129291 | 3300005445 | Bacteria | 2337 |
| 47 | Ga0070708_100373777 | 3300005445 | Unclassified | 1344 |
| 48 | Ga0070663_100517995 | 3300005455 | Bacteria | 993 |
| 49 | Ga0070678_100019928 | 3300005456 | Bacteria | 4388 |
| 50 | Ga0070662_100044549 | 3300005457 | Unclassified | 3179 |
| 51 | Ga0070662_100050861 | 3300005457 | Unclassified | 2990 |
| 52 | Ga0070662_100214103 | 3300005457 | Bacteria | 1535 |
| 53 | Ga0070662_100222749 | 3300005457 | Bacteria | 1506 |
| 54 | Ga0070681_10287328 | 3300005458 | Unclassified | 1555 |
| 55 | Ga0068867_100017428 | 3300005459 | Bacteria | 5103 |
| 56 | Ga0068867_100039012 | 3300005459 | Bacteria | 3461 |
| 57 | Ga0070685_10033291 | 3300005466 | Bacteria | 2894 |
| 58 | Ga0070707_100374783 | 3300005468 | Unclassified | 1383 |
| 59 | Ga0070698_100022268 | 3300005471 | Bacteria | 6630 |
| 60 | Ga0070699_100079654 | 3300005518 | Bacteria | 2854 |
| 61 | Ga0070679_100109673 | 3300005530 | Unclassified | 2746 |
| 62 | Ga0070684_100042700 | 3300005535 | Unclassified | 3915 |
| 63 | Ga0070684_100084281 | 3300005535 | Bacteria | 2817 |
| 64 | Ga0070697_100009337 | 3300005536 | Bacteria | 7668 |
| 65 | Ga0068853_100702050 | 3300005539 | Unclassified | 965 |
| 66 | Ga0070672_100022989 | 3300005543 | Bacteria | 4589 |
| 67 | Ga0070672_100029481 | 3300005543 | Bacteria | 4115 |
| 68 | Ga0070672_100173322 | 3300005543 | Bacteria | 1795 |
| 69 | Ga0070686_100004795 | 3300005544 | Bacteria | 7463 |
| 70 | Ga0070686_100105002 | 3300005544 | Bacteria | 1915 |
| 71 | Ga0070686_100198800 | 3300005544 | Bacteria | 1435 |
| 72 | Ga0070695_100006389 | 3300005545 | Bacteria | 6966 |
| 73 | Ga0070695_100033551 | 3300005545 | Bacteria | 3212 |
| 74 | Ga0070696_100013653 | 3300005546 | Bacteria | 5452 |
| 75 | Ga0070696_100049120 | 3300005546 | Bacteria | 2930 |
| 76 | Ga0070696_100195965 | 3300005546 | Bacteria | 1506 |
| 77 | Ga0070693_100034428 | 3300005547 | Bacteria | 2803 |
| 78 | Ga0070665_100003072 | 3300005548 | Bacteria | 17981 |
| 79 | Ga0070665_100005258 | 3300005548 | Bacteria | 13380 |
| 80 | Ga0070704_100015912 | 3300005549 | Bacteria | 4738 |
| 81 | Ga0070704_100028491 | 3300005549 | Bacteria | 3716 |
| 82 | Ga0070704_100226090 | 3300005549 | Bacteria | 1524 |
| 83 | Ga0070664_100002291 | 3300005564 | Bacteria | 15388 |
| 84 | Ga0070664_100172133 | 3300005564 | Bacteria | 1921 |
| 85 | Ga0070664_100377675 | 3300005564 | Bacteria | 1293 |
| 86 | Ga0070664_100631539 | 3300005564 | Unclassified | 995 |
| 87 | Ga0068857_100040867 | 3300005577 | Bacteria | 4112 |
| 88 | Ga0068854_100003187 | 3300005578 | Bacteria | 10242 |
| 89 | Ga0068854_100070524 | 3300005578 | Unclassified | 2554 |
| 90 | Ga0068854_100293610 | 3300005578 | Bacteria | 1312 |
| 91 | Ga0070702_100069897 | 3300005615 | Bacteria | 2070 |
| 92 | Ga0070702_100128796 | 3300005615 | Bacteria | 1595 |
| 93 | Ga0068852_100042166 | 3300005616 | Unclassified | 3862 |
| 94 | Ga0068852_100310211 | 3300005616 | Bacteria | 1529 |
| 95 | Ga0068859_100043788 | 3300005617 | Bacteria | 4498 |
| 96 | Ga0068859_100225859 | 3300005617 | Bacteria | 1960 |
| 97 | Ga0068859_100269437 | 3300005617 | Bacteria | 1795 |
| 98 | Ga0068859_100367227 | 3300005617 | Bacteria | 1534 |
| 99 | Ga0068864_100009264 | 3300005618 | Bacteria | 8118 |
| 100 | Ga0068864_100141775 | 3300005618 | Bacteria | 2168 |
| 101 | Ga0068864_100368653 | 3300005618 | Unclassified | 1359 |
| 102 | Ga0068866_10006194 | 3300005718 | Bacteria | 4980 |
| 103 | Ga0068866_10037352 | 3300005718 | Unclassified | 2385 |
| 104 | Ga0068866_10043565 | 3300005718 | Bacteria | 2241 |
| 105 | Ga0068866_10053970 | 3300005718 | Bacteria | 2057 |
| 106 | Ga0068861_100180064 | 3300005719 | Bacteria | 1759 |
| 107 | Ga0068861_100219097 | 3300005719 | Bacteria | 1607 |
| 108 | Ga0068861_100293192 | 3300005719 | Bacteria | 1406 |
| 109 | Ga0068861_100330890 | 3300005719 | Bacteria | 1330 |
| 110 | Ga0068870_10105758 | 3300005840 | Bacteria | 1599 |
| 111 | Ga0068870_10116350 | 3300005840 | Unclassified | 1534 |
| 112 | Ga0068863_100007150 | 3300005841 | Bacteria | 10951 |
| 113 | Ga0068863_100232856 | 3300005841 | Bacteria | 1777 |
| 114 | Ga0068863_100239181 | 3300005841 | Bacteria | 1752 |
| 115 | Ga0068858_100004003 | 3300005842 | Bacteria | 14541 |
| 116 | Ga0068858_100061890 | 3300005842 | Unclassified | 3460 |
| 117 | Ga0068858_100075913 | 3300005842 | Bacteria | 3122 |
| 118 | Ga0068858_100198302 | 3300005842 | Bacteria | 1897 |
| 119 | Ga0068858_100228535 | 3300005842 | Bacteria | 1763 |
| 120 | Ga0068858_100473736 | 3300005842 | Unclassified | 1208 |
| 121 | Ga0068862_100141316 | 3300005844 | Unclassified | 2137 |
| 122 | Ga0068862_100743463 | 3300005844 | Unclassified | 954 |
| 123 | Ga0081455_10122211 | 3300005937 | Unclassified | 2050 |
| 124 | Ga0081539_10006314 | 3300005985 | Bacteria | 11447 |
| 125 | Ga0075364_10017132 | 3300006051 | Bacteria | 4521 |
| 126 | Ga0075364_10127930 | 3300006051 | Bacteria | 1704 |
| 127 | Ga0075362_10065365 | 3300006177 | Bacteria | 1652 |
| 128 | Ga0075367_10042545 | 3300006178 | Unclassified | 2659 |
| 129 | Ga0075367_10111239 | 3300006178 | Bacteria | 1681 |
| 130 | Ga0075366_10000836 | 3300006195 | Bacteria | 14794 |
| 131 | Ga0097621_100005757 | 3300006237 | Bacteria | 8746 |
| 132 | Ga0075370_10268703 | 3300006353 | Bacteria | 1012 |
| 133 | Ga0068871_100117682 | 3300006358 | Bacteria | 2241 |
| 134 | Ga0068871_100357558 | 3300006358 | Bacteria | 1293 |
| 135 | Ga0075428_100001509 | 3300006844 | Bacteria | 24916 |
| 136 | Ga0075428_100083208 | 3300006844 | Bacteria | 3491 |
| 137 | Ga0075428_100360141 | 3300006844 | Bacteria | 1560 |
| 138 | Ga0075431_100042121 | 3300006847 | Unclassified | 4709 |
| 139 | Ga0075433_10031726 | 3300006852 | Bacteria | 4519 |
| 140 | Ga0075433_10163354 | 3300006852 | Bacteria | 1982 |
| 141 | Ga0075433_10279631 | 3300006852 | Bacteria | 1478 |
| 142 | Ga0075434_100000422 | 3300006871 | Bacteria | 31341 |
| 143 | Ga0075434_100030314 | 3300006871 | Bacteria | 5325 |
| 144 | Ga0075434_100037852 | 3300006871 | Bacteria | 4776 |
| 145 | Ga0075434_100043349 | 3300006871 | Bacteria | 4462 |
| 146 | Ga0075434_100124466 | 3300006871 | Unclassified | 2595 |
| 147 | Ga0075429_100213608 | 3300006880 | Bacteria | 1690 |
| 148 | Ga0075429_100275674 | 3300006880 | Bacteria | 1473 |
| 149 | Ga0068865_100006947 | 3300006881 | Bacteria | 6941 |
| 150 | Ga0068865_100066394 | 3300006881 | Bacteria | 2545 |
| 151 | Ga0068865_100153659 | 3300006881 | Bacteria | 1748 |
| 152 | Ga0075436_100005606 | 3300006914 | Bacteria | 8614 |
| 153 | Ga0075436_100028917 | 3300006914 | Bacteria | 3813 |
| 154 | Ga0075436_100034402 | 3300006914 | Unclassified | 3494 |
| 155 | Ga0075436_100225478 | 3300006914 | Bacteria | 1330 |
| 156 | Ga0075436_100264625 | 3300006914 | Unclassified | 1227 |
| 157 | Ga0097620_100043786 | 3300006931 | Bacteria | 4498 |
| 158 | Ga0097620_100225866 | 3300006931 | Bacteria | 1960 |
| 159 | Ga0097620_100269455 | 3300006931 | Bacteria | 1795 |
| 160 | Ga0097620_100367194 | 3300006931 | Bacteria | 1534 |
| 161 | Ga0075435_100000012 | 3300007076 | Bacteria | 108852 |
| 162 | Ga0075435_100001689 | 3300007076 | Bacteria | 14336 |
| 163 | Ga0075435_100014611 | 3300007076 | Bacteria | 5876 |
| 164 | Ga0075435_100032221 | 3300007076 | Bacteria | 4137 |
| 165 | Ga0075435_100046916 | 3300007076 | Bacteria | 3467 |
| 166 | Ga0075435_100080581 | 3300007076 | Unclassified | 2673 |
| 167 | Ga0075435_100081612 | 3300007076 | Bacteria | 2656 |
| 168 | Ga0075435_100110374 | 3300007076 | Bacteria | 2287 |
| 169 | Ga0105240_10127726 | 3300009093 | Unclassified | 3053 |
| 170 | Ga0105240_10272501 | 3300009093 | Bacteria | 1948 |
| 171 | Ga0105240_10304819 | 3300009093 | Unclassified | 1821 |
| 172 | Ga0111539_10001106 | 3300009094 | Bacteria | 35560 |
| 173 | Ga0111539_10014453 | 3300009094 | Bacteria | 9851 |
| 174 | Ga0111539_10080316 | 3300009094 | Unclassified | 3836 |
| 175 | Ga0111539_10385478 | 3300009094 | Bacteria | 1632 |
| 176 | Ga0105245_10011294 | 3300009098 | Bacteria | 7777 |
| 177 | Ga0105245_10026213 | 3300009098 | Bacteria | 5130 |
| 178 | Ga0105247_10007815 | 3300009101 | Bacteria | 6544 |
| 179 | Ga0114129_10011555 | 3300009147 | Bacteria | 12573 |
| 180 | Ga0114129_10038577 | 3300009147 | Bacteria | 6737 |
| 181 | Ga0114129_10079563 | 3300009147 | Unclassified | 4557 |
| 182 | Ga0114129_10115639 | 3300009147 | Bacteria | 3697 |
| 183 | Ga0114129_10184214 | 3300009147 | Bacteria | 2839 |
| 184 | Ga0114129_10461916 | 3300009147 | Unclassified | 1664 |
| 185 | Ga0114129_10737329 | 3300009147 | Bacteria | 1262 |
| 186 | Ga0105243_10040410 | 3300009148 | Unclassified | 3643 |
| 187 | Ga0105243_10633840 | 3300009148 | Bacteria | 1034 |
| 188 | Ga0105241_10038797 | 3300009174 | Unclassified | 3591 |
| 189 | Ga0105241_10201121 | 3300009174 | Bacteria | 1664 |
| 190 | Ga0105241_10398963 | 3300009174 | Bacteria | 1206 |
| 191 | Ga0105242_10002061 | 3300009176 | Bacteria | 15837 |
| 192 | Ga0105242_10008568 | 3300009176 | Bacteria | 7852 |
| 193 | Ga0105242_10009458 | 3300009176 | Bacteria | 7469 |
| 194 | Ga0105242_10012650 | 3300009176 | Bacteria | 6498 |
| 195 | Ga0105242_10080506 | 3300009176 | Bacteria | 2722 |
| 196 | Ga0105248_10062352 | 3300009177 | Bacteria | 4187 |
| 197 | Ga0105248_10069002 | 3300009177 | Unclassified | 3969 |
| 198 | Ga0105248_10071665 | 3300009177 | Bacteria | 3893 |
| 199 | Ga0105248_10137271 | 3300009177 | Bacteria | 2759 |
| 200 | Ga0105248_10149704 | 3300009177 | Unclassified | 2633 |
| 201 | Ga0105248_10252718 | 3300009177 | Unclassified | 1984 |
| 202 | Ga0105248_10437229 | 3300009177 | Bacteria | 1474 |
| 203 | Ga0105248_10455494 | 3300009177 | Bacteria | 1442 |
| 204 | Ga0105248_10487126 | 3300009177 | Unclassified | 1390 |
| 205 | Ga0105248_10533484 | 3300009177 | Bacteria | 1324 |
| 206 | Ga0105237_10034258 | 3300009545 | Bacteria | 5142 |
| 207 | Ga0105237_10302508 | 3300009545 | Bacteria | 1603 |
| 208 | Ga0105238_10440374 | 3300009551 | Bacteria | 1299 |
| 209 | Ga0105249_10043328 | 3300009553 | Bacteria | 4093 |
| 210 | Ga0105249_10270995 | 3300009553 | Bacteria | 1691 |
| 211 | Ga0105249_10496057 | 3300009553 | Bacteria | 1266 |
| 212 | Ga0105246_10025701 | 3300011119 | Unclassified | 3840 |
| 213 | Ga0105246_10100745 | 3300011119 | Bacteria | 2102 |
| 214 | Ga0157374_10031219 | 3300013296 | Bacteria | 4841 |
| 215 | Ga0157374_10068853 | 3300013296 | Bacteria | 3331 |
| 216 | Ga0157374_10316302 | 3300013296 | Unclassified | 1546 |
| 217 | Ga0157378_10012837 | 3300013297 | Bacteria | 7332 |
| 218 | Ga0157378_10204303 | 3300013297 | Bacteria | 1870 |
| 219 | Ga0163162_10102799 | 3300013306 | Bacteria | 2951 |
| 220 | Ga0163163_10093896 | 3300014325 | Unclassified | 3017 |
| 221 | Ga0157380_10083413 | 3300014326 | Bacteria | 2618 |
| 222 | Ga0157380_10718684 | 3300014326 | Bacteria | 1006 |
| 223 | Ga0157379_10006385 | 3300014968 | Bacteria | 10155 |
| 224 | Ga0157379_10015553 | 3300014968 | Bacteria | 6679 |
| 225 | Ga0157376_10065522 | 3300014969 | Bacteria | 3068 |
| 226 | Ga0157376_10083136 | 3300014969 | Bacteria | 2753 |
| 227 | Ga0207697_10016320 | 3300025315 | Unclassified | 3058 |
| 228 | Ga0207682_10055090 | 3300025893 | Bacteria | 1653 |
| 229 | Ga0207642_10056193 | 3300025899 | Unclassified | 1804 |
| 230 | Ga0207642_10056326 | 3300025899 | Bacteria | 1803 |
| 231 | Ga0207710_10084677 | 3300025900 | Bacteria | 1476 |
| 232 | Ga0207688_10107579 | 3300025901 | Bacteria | 1616 |
| 233 | Ga0207680_10003857 | 3300025903 | Bacteria | 7060 |
| 234 | Ga0207680_10028581 | 3300025903 | Bacteria | 3121 |
| 235 | Ga0207647_10011629 | 3300025904 | Bacteria | 6163 |
| 236 | Ga0207645_10001628 | 3300025907 | Bacteria | 18323 |
| 237 | Ga0207645_10051557 | 3300025907 | Bacteria | 2629 |
| 238 | Ga0207643_10045794 | 3300025908 | Unclassified | 2471 |
| 239 | Ga0207654_10058141 | 3300025911 | Unclassified | 2250 |
| 240 | Ga0207695_10214877 | 3300025913 | Unclassified | 1832 |
| 241 | Ga0207660_10479118 | 3300025917 | Bacteria | 1008 |
| 242 | Ga0207662_10002800 | 3300025918 | Bacteria | 8813 |
| 243 | Ga0207662_10003765 | 3300025918 | Bacteria | 7868 |
| 244 | Ga0207662_10004611 | 3300025918 | Bacteria | 7267 |
| 245 | Ga0207646_10525863 | 3300025922 | Unclassified | 1065 |
| 246 | Ga0207681_10017646 | 3300025923 | Bacteria | 4484 |
| 247 | Ga0207681_10096976 | 3300025923 | Unclassified | 2118 |
| 248 | Ga0207681_10126896 | 3300025923 | Bacteria | 1880 |
| 249 | Ga0207650_10041831 | 3300025925 | Unclassified | 3360 |
| 250 | Ga0207650_10073879 | 3300025925 | Bacteria | 2569 |
| 251 | Ga0207650_10495108 | 3300025925 | Unclassified | 1021 |
| 252 | Ga0207659_10002714 | 3300025926 | Bacteria | 10552 |
| 253 | Ga0207659_10256822 | 3300025926 | Bacteria | 1420 |
| 254 | Ga0207687_10007227 | 3300025927 | Bacteria | 7323 |
| 255 | Ga0207687_10023582 | 3300025927 | Bacteria | 4104 |
| 256 | Ga0207644_10019943 | 3300025931 | Bacteria | 4553 |
| 257 | Ga0207644_10029579 | 3300025931 | Bacteria | 3801 |
| 258 | Ga0207644_10135838 | 3300025931 | Bacteria | 1888 |
| 259 | Ga0207706_10022700 | 3300025933 | Bacteria | 5632 |
| 260 | Ga0207706_10039849 | 3300025933 | Bacteria | 4165 |
| 261 | Ga0207706_10107020 | 3300025933 | Unclassified | 2461 |
| 262 | Ga0207706_10179303 | 3300025933 | Bacteria | 1861 |
| 263 | Ga0207706_10234181 | 3300025933 | Unclassified | 1606 |
| 264 | Ga0207686_10005954 | 3300025934 | Bacteria | 6548 |
| 265 | Ga0207686_10007196 | 3300025934 | Bacteria | 5993 |
| 266 | Ga0207686_10042680 | 3300025934 | Bacteria | 2774 |
| 267 | Ga0207686_10138185 | 3300025934 | Bacteria | 1680 |
| 268 | Ga0207686_10155218 | 3300025934 | Bacteria | 1598 |
| 269 | Ga0207686_10273589 | 3300025934 | Bacteria | 1243 |
| 270 | Ga0207686_10414451 | 3300025934 | Bacteria | 1029 |
| 271 | Ga0207709_10022402 | 3300025935 | Bacteria | 3583 |
| 272 | Ga0207709_10087742 | 3300025935 | Bacteria | 2023 |
| 273 | Ga0207709_10103160 | 3300025935 | Bacteria | 1890 |
| 274 | Ga0207709_10502157 | 3300025935 | Bacteria | 947 |
| 275 | Ga0207670_10079432 | 3300025936 | Bacteria | 2290 |
| 276 | Ga0207670_10108355 | 3300025936 | Unclassified | 1997 |
| 277 | Ga0207669_10270285 | 3300025937 | Bacteria | 1276 |
| 278 | Ga0207704_10004236 | 3300025938 | Bacteria | 6555 |
| 279 | Ga0207704_10127038 | 3300025938 | Bacteria | 1758 |
| 280 | Ga0207704_10424674 | 3300025938 | Bacteria | 1055 |
| 281 | Ga0207691_10078745 | 3300025940 | Bacteria | 2966 |
| 282 | Ga0207691_10133311 | 3300025940 | Unclassified | 2193 |
| 283 | Ga0207691_10191282 | 3300025940 | Bacteria | 1785 |
| 284 | Ga0207711_10006204 | 3300025941 | Bacteria | 10097 |
| 285 | Ga0207711_10013457 | 3300025941 | Bacteria | 6797 |
| 286 | Ga0207711_10034966 | 3300025941 | Bacteria | 4257 |
| 287 | Ga0207711_10040464 | 3300025941 | Unclassified | 3966 |
| 288 | Ga0207711_10058198 | 3300025941 | Bacteria | 3325 |
| 289 | Ga0207711_10193608 | 3300025941 | Unclassified | 1854 |
| 290 | Ga0207711_10461627 | 3300025941 | Bacteria | 1182 |
| 291 | Ga0207711_10536170 | 3300025941 | Unclassified | 1092 |
| 292 | Ga0207711_10699977 | 3300025941 | Unclassified | 945 |
| 293 | Ga0207689_10036670 | 3300025942 | Bacteria | 4070 |
| 294 | Ga0207689_10104016 | 3300025942 | Bacteria | 2333 |
| 295 | Ga0207661_10025470 | 3300025944 | Bacteria | 4496 |
| 296 | Ga0207661_10119148 | 3300025944 | Bacteria | 2245 |
| 297 | Ga0207679_10003988 | 3300025945 | Bacteria | 9167 |
| 298 | Ga0207679_10341917 | 3300025945 | Bacteria | 1302 |
| 299 | Ga0207651_10066175 | 3300025960 | Unclassified | 2538 |
| 300 | Ga0207712_10089246 | 3300025961 | Bacteria | 2266 |
| 301 | Ga0207712_10091413 | 3300025961 | Bacteria | 2242 |
| 302 | Ga0207712_10112759 | 3300025961 | Unclassified | 2043 |
| 303 | Ga0207712_10196770 | 3300025961 | Bacteria | 1595 |
| 304 | Ga0207640_10007129 | 3300025981 | Bacteria | 6160 |
| 305 | Ga0207640_10082407 | 3300025981 | Bacteria | 2203 |
| 306 | Ga0207640_10088045 | 3300025981 | Unclassified | 2143 |
| 307 | Ga0207658_10060760 | 3300025986 | Unclassified | 2821 |
| 308 | Ga0207658_10143655 | 3300025986 | Bacteria | 1935 |
| 309 | Ga0207658_10214000 | 3300025986 | Bacteria | 1617 |
| 310 | Ga0207677_10011530 | 3300026023 | Bacteria | 5046 |
| 311 | Ga0207677_10155833 | 3300026023 | Bacteria | 1768 |
| 312 | Ga0207677_10557341 | 3300026023 | Bacteria | 1000 |
| 313 | Ga0207703_10055226 | 3300026035 | Unclassified | 3231 |
| 314 | Ga0207703_10248714 | 3300026035 | Bacteria | 1601 |
| 315 | Ga0207639_10333740 | 3300026041 | Bacteria | 1350 |
| 316 | Ga0207678_10021408 | 3300026067 | Bacteria | 5669 |
| 317 | Ga0207708_10006874 | 3300026075 | Bacteria | 8417 |
| 318 | Ga0207708_10028975 | 3300026075 | Bacteria | 4193 |
| 319 | Ga0207708_10067889 | 3300026075 | Unclassified | 2728 |
| 320 | Ga0207708_10077922 | 3300026075 | Bacteria | 2544 |
| 321 | Ga0207641_10000693 | 3300026088 | Bacteria | 36308 |
| 322 | Ga0207648_10002915 | 3300026089 | Bacteria | 18109 |
| 323 | Ga0207648_10004443 | 3300026089 | Bacteria | 14388 |
| 324 | Ga0207648_10017686 | 3300026089 | Bacteria | 6476 |
| 325 | Ga0207648_10088767 | 3300026089 | Unclassified | 2700 |
| 326 | Ga0207676_10010229 | 3300026095 | Bacteria | 6675 |
| 327 | Ga0207674_10037019 | 3300026116 | Bacteria | 5078 |
| 328 | Ga0207675_100007011 | 3300026118 | Bacteria | 10656 |
| 329 | Ga0207675_100039381 | 3300026118 | Bacteria | 4411 |
| 330 | Ga0207675_100072562 | 3300026118 | Bacteria | 3220 |
| 331 | Ga0207675_100132997 | 3300026118 | Bacteria | 2359 |
| 332 | Ga0207675_100175798 | 3300026118 | Bacteria | 2048 |
| 333 | Ga0207675_100210789 | 3300026118 | Bacteria | 1868 |
| 334 | Ga0207675_100395823 | 3300026118 | Unclassified | 1360 |
| 335 | Ga0207683_10119908 | 3300026121 | Bacteria | 2361 |
| 336 | Ga0207683_10235362 | 3300026121 | Bacteria | 1670 |
| 337 | Ga0207683_10731656 | 3300026121 | Bacteria | 918 |
| 338 | Ga0207428_10000633 | 3300027907 | Bacteria | 41339 |
| 339 | Ga0268266_10009514 | 3300028379 | Bacteria | 8552 |
| 340 | Ga0268266_10024028 | 3300028379 | Bacteria | 5186 |
| 341 | Ga0268266_10250286 | 3300028379 | Bacteria | 1639 |
| 342 | Ga0268265_10113941 | 3300028380 | Unclassified | 2213 |
| 343 | Ga0268265_10263943 | 3300028380 | Bacteria | 1532 |
| 344 | Ga0268264_10078681 | 3300028381 | Bacteria | 2812 |
| 345 | Ga0268264_10363534 | 3300028381 | Unclassified | 1381 |
| 346 | Ga0265316_10000607 | 3300031344 | Bacteria | 39905 |
| 347 | Ga0265316_10144218 | 3300031344 | Bacteria | 1787 |
| 348 | Ga0373930_0008891 | 3300034816 | Bacteria | 1766 |
| 349 | Ga0373948_0004725 | 3300034817 | Bacteria | 2171 |
| 350 | Ga0373950_0008277 | 3300034818 | Bacteria | 1632 |
| 351 | Ga0373958_0002536 | 3300034819 | Bacteria | 2568 |
| 352 | Ga0373938_0003286 | 3300034957 | Bacteria | 2638 |
| 353 | Ga0373928_0001588 | 3300035084 | Bacteria | 4405 |
| 354 | Ga0373940_0001508 | 3300035088 | Bacteria | 4237 |
| 355 | Ga0373940_0017661 | 3300035088 | Unclassified | 1781 |
| 356 | Ga0373951_0000926 | 3300035091 | Bacteria | 7905 |
| 357 | Ga0373952_0003455 | 3300035092 | Bacteria | 2850 |
| 358 | Ga0373932_0002799 | 3300035112 | Bacteria | 4321 |
| 359 | Ga0373939_0001094 | 3300035114 | Bacteria | 6653 |
| 360 | Ga0373941_0000733 | 3300035115 | Bacteria | 6732 |
| 361 | Ga0373954_0165748 | 3300035118 | Bacteria | 1082 |
| 362 | Ga0373960_0000149 | 3300035121 | Bacteria | 11782 |
| 363 | Ga0373960_0023357 | 3300035121 | Bacteria | 1665 |
| 364 | Ga0373942_0001584 | 3300035207 | Bacteria | 5834 |
| 365 | Ga0373961_0003281 | 3300035241 | Bacteria | 4027 |
| 366 | Ga0373962_0005503 | 3300035242 | Bacteria | 3062 |
| 367 | Ga0373962_0034876 | 3300035242 | Bacteria | 1395 |
| 368 | Ga0373931_0018864 | 3300035691 | Bacteria | 3434 |
| 369 | Ga0439446_0020341 | 3300042156 | Bacteria | 1869 |
| 370 | Ga0451576_0008981 | 3300045051 | Bacteria | 11649 |
| 371 | Ga0451576_0077393 | 3300045051 | Bacteria | 3462 |
| 372 | Ga0451576_0097009 | 3300045051 | Unclassified | 3066 |
| 373 | Ga0495592_0085374 | 3300046454 | Bacteria | 2276 |
| 374 | Ga0495638_0006801 | 3300046460 | Bacteria | 8258 |
| 375 | Ga0495653_0288341 | 3300046463 | Bacteria | 1075 |
| 376 | Ga0495664_0000466 | 3300046477 | Bacteria | 19988 |
| 377 | Ga0495608_0042573 | 3300046511 | Bacteria | 3037 |
| 378 | Ga0495618_0134121 | 3300046514 | Unclassified | 1584 |
| 379 | Ga0495628_0002337 | 3300046516 | Bacteria | 17123 |
| 380 | Ga0495628_0133753 | 3300046516 | Unclassified | 1896 |
| 381 | Ga0495630_0055999 | 3300046517 | Bacteria | 2954 |
| 382 | Ga0495630_0424544 | 3300046517 | Unclassified | 1019 |
| 383 | Ga0495652_0039495 | 3300046529 | Bacteria | 4081 |
| 384 | Ga0495640_0069803 | 3300046533 | Unclassified | 2363 |
| 385 | Ga0495640_0129358 | 3300046533 | Bacteria | 1635 |
| 386 | Ga0495587_0005341 | 3300046536 | Bacteria | 8403 |
| 387 | Ga0495645_0000735 | 3300046543 | Bacteria | 22370 |
| 388 | Ga0495645_0001439 | 3300046543 | Bacteria | 16061 |
| 389 | Ga0495667_0053027 | 3300046559 | Bacteria | 2671 |
| 390 | Ga0495657_0198194 | 3300046675 | Bacteria | 1225 |
| 391 | Ga0495599_0000577 | 3300046678 | Bacteria | 20939 |
| 392 | Ga0495599_0275446 | 3300046678 | Unclassified | 1020 |
| 393 | Ga0495623_0032331 | 3300046679 | Bacteria | 3363 |
| 394 | Ga0495646_0037023 | 3300046680 | Bacteria | 3020 |
| 395 | Ga0495658_0255966 | 3300046683 | Bacteria | 1102 |
| 396 | Ga0495669_0078974 | 3300046684 | Bacteria | 1508 |
| 397 | Ga0495600_0096733 | 3300046809 | Unclassified | 1925 |
| 398 | Ga0495604_0056821 | 3300047317 | Bacteria | 3010 |
| 399 | Ga0495674_0009886 | 3300047319 | Bacteria | 9054 |
| 400 | Ga0495680_0009774 | 3300047322 | Bacteria | 8603 |
| 401 | Ga0495680_0251739 | 3300047322 | Unclassified | 1252 |
| 402 | Ga0495675_0033240 | 3300047444 | Bacteria | 3292 |
| 403 | Ga0495677_0213713 | 3300047445 | Bacteria | 751 |
| 404 | Ga0495684_0298562 | 3300047471 | Bacteria | 1157 |
| 405 | Ga0495602_0030049 | 3300048088 | Bacteria | 5162 |
| 406 | Ga0496102_0049115 | 3300048905 | Bacteria | 3838 |
| 407 | Ga0496102_0063861 | 3300048905 | Bacteria | 3372 |
| 408 | Ga0496102_0372077 | 3300048905 | Bacteria | 1345 |
| 409 | Ga0496103_0051267 | 3300048906 | Bacteria | 2554 |
| 410 | Ga0496103_0118012 | 3300048906 | Unclassified | 1689 |
| 411 | Ga0496104_0000830 | 3300048907 | Bacteria | 26651 |
| 412 | Ga0496104_0050211 | 3300048907 | Bacteria | 3936 |
| 413 | Ga0496105_0043166 | 3300048908 | Unclassified | 3718 |
| 414 | Ga0496106_0119619 | 3300048909 | Unclassified | 2058 |
| 415 | Ga0496108_0001041 | 3300048911 | Bacteria | 21629 |
| 416 | Ga0496108_0001495 | 3300048911 | Bacteria | 18489 |
| 417 | Ga0496109_0024111 | 3300048912 | Bacteria | 5405 |
| 418 | Ga0496109_0026080 | 3300048912 | Bacteria | 5209 |
| 419 | Ga0496109_0206970 | 3300048912 | Bacteria | 1845 |
| 420 | Ga0496109_0536011 | 3300048912 | Unclassified | 1104 |
| 421 | Ga0496109_0676768 | 3300048912 | Bacteria | 969 |
| 422 | Ga0496110_0002605 | 3300048913 | Bacteria | 13566 |
| 423 | Ga0496111_0097987 | 3300048914 | Unclassified | 2153 |
| 424 | Ga0496111_0173323 | 3300048914 | Bacteria | 1603 |
| 425 | Ga0496112_0000626 | 3300048915 | Bacteria | 24545 |
| 426 | Ga0496112_0326146 | 3300048915 | Bacteria | 1479 |
| 427 | Ga0496113_0209641 | 3300048916 | Unclassified | 1551 |
| 428 | Ga0496114_0127574 | 3300048917 | Unclassified | 2194 |
| 429 | Ga0496114_0624259 | 3300048917 | Unclassified | 949 |
| 430 | Ga0496115_0405460 | 3300048918 | Unclassified | 1106 |
| 431 | Ga0501067_0163034 | 3300049583 | Bacteria | 1241 |
| 432 | Ga0501069_0346461 | 3300049585 | Unclassified | 875 |
| 433 | Ga0501073_0087502 | 3300049589 | Archaea | 2166 |
| 434 | nmdc:mga03683_118550_c1 | 3300050489 | Bacteria | 1175 |
| 435 | nmdc:mga0k408_9200_c1 | 3300050493 | Bacteria | 5320 |
| 436 | nmdc:mga06z11_13767_c1 | 3300050494 | Bacteria | 3563 |
| 437 | nmdc:mga06z11_18597_c1 | 3300050494 | Unclassified | 3177 |
| 438 | nmdc:mga07m45_259388_c1 | 3300050496 | Bacteria | 1011 |
| 439 | nmdc:mga05p37_133099_c1 | 3300050507 | Bacteria | 3050 |
| 440 | nmdc:mga05p37_184839_c1 | 3300050507 | Bacteria | 2534 |
| 441 | nmdc:mga09592_120938_c1 | 3300050508 | Bacteria | 2249 |
| 442 | nmdc:mga09592_198257_c1 | 3300050508 | Bacteria | 1738 |
| 443 | nmdc:mga08y16_244904_c1 | 3300050511 | Unclassified | 1853 |
| 444 | nmdc:mga08y16_29425_c1 | 3300050511 | Bacteria | 5787 |
| 445 | nmdc:mga08y16_418164_c1 | 3300050511 | Bacteria | 1370 |
| 446 | nmdc:mga08y16_4466_c1 | 3300050511 | Bacteria | 14618 |
| 447 | nmdc:mga08y16_63065_c1 | 3300050511 | Unclassified | 3870 |
| 448 | nmdc:mga0n895_169467_c1 | 3300050512 | Bacteria | 2215 |
| 449 | nmdc:mga0n895_316585_c1 | 3300050512 | Bacteria | 1581 |
| 450 | nmdc:mga0n895_379752_c1 | 3300050512 | Bacteria | 1430 |
| 451 | nmdc:mga0n895_396649_c1 | 3300050512 | Bacteria | 1396 |
| 452 | nmdc:mga0n895_41641_c1 | 3300050512 | Bacteria | 4466 |
| 453 | nmdc:mga0n895_46972_c1 | 3300050512 | Bacteria | 4220 |
| 454 | nmdc:mga0n895_643_c1 | 3300050512 | Bacteria | 24319 |
| 455 | nmdc:mga0n895_66015_c1 | 3300050512 | Unclassified | 3583 |
| 456 | nmdc:mga0n895_69895_c1 | 3300050512 | Bacteria | 3479 |
| 457 | nmdc:mga0n895_72802_c1 | 3300050512 | Bacteria | 3410 |
| 458 | nmdc:mga0n895_73164_c1 | 3300050512 | Unclassified | 3402 |
| 459 | nmdc:mga0n895_86558_c1 | 3300050512 | Bacteria | 3130 |
| 460 | nmdc:mga0rr50_107152_c1 | 3300050513 | Bacteria | 2206 |
| 461 | nmdc:mga0rr50_1155_c1 | 3300050513 | Bacteria | 14374 |
| 462 | nmdc:mga0rr50_128259_c1 | 3300050513 | Bacteria | 2028 |
| 463 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 464 | nmdc:mga08x19_122600_c1 | 3300050514 | Bacteria | 1744 |
| 465 | nmdc:mga08x19_242759_c1 | 3300050514 | Unclassified | 1242 |
| 466 | nmdc:mga08x19_246_c2 | 3300050514 | Bacteria | 31844 |
| 467 | nmdc:mga08x19_399858_c1 | 3300050514 | Bacteria | 963 |
| 468 | nmdc:mga08x19_48893_c1 | 3300050514 | Bacteria | 2711 |
| 469 | nmdc:mga0a205_19221_c1 | 3300050515 | Bacteria | 6438 |
| 470 | nmdc:mga0a205_275227_c1 | 3300050515 | Bacteria | 1560 |
| 471 | nmdc:mga0a205_30475_c1 | 3300050515 | Bacteria | 5165 |
| 472 | nmdc:mga0a205_495101_c1 | 3300050515 | Bacteria | 1080 |
| 473 | nmdc:mga0a205_86621_c1 | 3300050515 | Bacteria | 3025 |
| 474 | Ga0495619_0101907 | 3300053085 | Unclassified | 1955 |
| 475 | Ga0500645_002700 | 3300053730 | Bacteria | 7710 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047445 | Ga0495677_0213713 | Ga0495677_0213713_53_718 | 203 |
| 2 | 3300046684 | Ga0495669_0078974 | Ga0495669_0078974_258_1046 | 223 |
| 3 | 3300046683 | Ga0495658_0255966 | Ga0495658_0255966_226_1011 | 228 |
| 4 | 3300005545 | Ga0070695_100006389 | Ga0070695_1000063898 | 230 |
| 5 | 3300048914 | Ga0496111_0097987 | Ga0496111_0097987_1225_1983 | 231 |
| 6 | 3300050512 | nmdc:mga0n895_169467_c1 | nmdc:mga0n895_169467_c1_10_768 | 231 |
| 7 | 3300050512 | nmdc:mga0n895_643_c1 | nmdc:mga0n895_643_c1_16456_17214 | 231 |
| 8 | 3300050513 | nmdc:mga0rr50_1_c1 | nmdc:mga0rr50_1_c1_330869_331627 | 231 |
| 9 | 3300050514 | nmdc:mga08x19_246_c2 | nmdc:mga08x19_246_c2_8583_9341 | 231 |
| 10 | 3300009545 | Ga0105237_10302508 | Ga0105237_103025082 | 232 |
| 11 | 3300005366 | Ga0070659_100067474 | Ga0070659_1000674742 | 233 |
| 12 | 3300005457 | Ga0070662_100050861 | Ga0070662_1000508612 | 233 |
| 13 | 3300005530 | Ga0070679_100109673 | Ga0070679_1001096732 | 233 |
| 14 | 3300009148 | Ga0105243_10040410 | Ga0105243_100404103 | 233 |
| 15 | 3300009176 | Ga0105242_10009458 | Ga0105242_100094587 | 233 |
| 16 | 3300048905 | Ga0496102_0372077 | Ga0496102_0372077_346_1140 | 233 |
| 17 | 3300048916 | Ga0496113_0209641 | Ga0496113_0209641_401_1168 | 233 |
| 18 | 3300050515 | nmdc:mga0a205_275227_c1 | nmdc:mga0a205_275227_c1_598_1362 | 233 |
| 19 | 3300035118 | Ga0373954_0165748 | Ga0373954_0165748_177_944 | 234 |
| 20 | 3300046463 | Ga0495653_0288341 | Ga0495653_0288341_181_954 | 234 |
| 21 | 3300046477 | Ga0495664_0000466 | Ga0495664_0000466_17063_17836 | 234 |
| 22 | 3300046511 | Ga0495608_0042573 | Ga0495608_0042573_204_977 | 234 |
| 23 | 3300046514 | Ga0495618_0134121 | Ga0495618_0134121_13_786 | 234 |
| 24 | 3300046516 | Ga0495628_0002337 | Ga0495628_0002337_2339_3112 | 234 |
| 25 | 3300046517 | Ga0495630_0055999 | Ga0495630_0055999_168_941 | 234 |
| 26 | 3300046529 | Ga0495652_0039495 | Ga0495652_0039495_2003_2776 | 234 |
| 27 | 3300046533 | Ga0495640_0129358 | Ga0495640_0129358_479_1252 | 234 |
| 28 | 3300046536 | Ga0495587_0005341 | Ga0495587_0005341_1800_2573 | 234 |
| 29 | 3300046543 | Ga0495645_0001439 | Ga0495645_0001439_13250_14023 | 234 |
| 30 | 3300046559 | Ga0495667_0053027 | Ga0495667_0053027_145_918 | 234 |
| 31 | 3300046678 | Ga0495599_0000577 | Ga0495599_0000577_6769_7542 | 234 |
| 32 | 3300046679 | Ga0495623_0032331 | Ga0495623_0032331_464_1237 | 234 |
| 33 | 3300046680 | Ga0495646_0037023 | Ga0495646_0037023_2048_2821 | 234 |
| 34 | 3300047317 | Ga0495604_0056821 | Ga0495604_0056821_148_921 | 234 |
| 35 | 3300047319 | Ga0495674_0009886 | Ga0495674_0009886_7890_8663 | 234 |
| 36 | 3300047322 | Ga0495680_0009774 | Ga0495680_0009774_7774_8547 | 234 |
| 37 | 3300047444 | Ga0495675_0033240 | Ga0495675_0033240_442_1215 | 234 |
| 38 | 3300047471 | Ga0495684_0298562 | Ga0495684_0298562_38_811 | 234 |
| 39 | 3300048088 | Ga0495602_0030049 | Ga0495602_0030049_2783_3556 | 234 |
| 40 | 3300005295 | Ga0065707_10164547 | Ga0065707_101645472 | 235 |
| 41 | 3300005354 | Ga0070675_100000035 | Ga0070675_10000003510 | 235 |
| 42 | 3300025926 | Ga0207659_10002714 | Ga0207659_100027145 | 235 |
| 43 | 3300048912 | Ga0496109_0206970 | Ga0496109_0206970_805_1575 | 235 |
| 44 | 3300049589 | Ga0501073_0087502 | Ga0501073_0087502_738_1523 | 235 |
| 45 | 3300005441 | Ga0070700_100027517 | Ga0070700_1000275173 | 236 |
| 46 | 3300005548 | Ga0070665_100005258 | Ga0070665_1000052582 | 236 |
| 47 | 3300005549 | Ga0070704_100226090 | Ga0070704_1002260902 | 236 |
| 48 | 3300006871 | Ga0075434_100037852 | Ga0075434_1000378525 | 236 |
| 49 | 3300009177 | Ga0105248_10252718 | Ga0105248_102527182 | 236 |
| 50 | 3300009551 | Ga0105238_10440374 | Ga0105238_104403741 | 236 |
| 51 | 3300025938 | Ga0207704_10424674 | Ga0207704_104246742 | 236 |
| 52 | 3300025941 | Ga0207711_10034966 | Ga0207711_100349663 | 236 |
| 53 | 3300025942 | Ga0207689_10104016 | Ga0207689_101040162 | 236 |
| 54 | 3300026075 | Ga0207708_10067889 | Ga0207708_100678893 | 236 |
| 55 | 3300026121 | Ga0207683_10731656 | Ga0207683_107316561 | 236 |
| 56 | 3300028379 | Ga0268266_10024028 | Ga0268266_100240286 | 236 |
| 57 | 3300050508 | nmdc:mga09592_198257_c1 | nmdc:mga09592_198257_c1_138_926 | 236 |
| 58 | 3300006871 | Ga0075434_100030314 | Ga0075434_1000303145 | 237 |
| 59 | 3300009094 | Ga0111539_10080316 | Ga0111539_100803162 | 237 |
| 60 | 3300009147 | Ga0114129_10079563 | Ga0114129_100795632 | 237 |
| 61 | 3300009177 | Ga0105248_10487126 | Ga0105248_104871262 | 237 |
| 62 | 3300028379 | Ga0268266_10250286 | Ga0268266_102502862 | 237 |
| 63 | 3300035242 | Ga0373962_0034876 | Ga0373962_0034876_385_1161 | 237 |
| 64 | 3300050511 | nmdc:mga08y16_63065_c1 | nmdc:mga08y16_63065_c1_528_1304 | 237 |
| 65 | 3300050512 | nmdc:mga0n895_46972_c1 | nmdc:mga0n895_46972_c1_2363_3145 | 237 |
| 66 | 3300013296 | Ga0157374_10316302 | Ga0157374_103163022 | 238 |
| 67 | 3300005331 | Ga0070670_100138580 | Ga0070670_1001385801 | 239 |
| 68 | 3300005353 | Ga0070669_100001923 | Ga0070669_1000019237 | 239 |
| 69 | 3300005445 | Ga0070708_100129291 | Ga0070708_1001292912 | 239 |
| 70 | 3300005471 | Ga0070698_100022268 | Ga0070698_1000222682 | 239 |
| 71 | 3300005543 | Ga0070672_100029481 | Ga0070672_1000294812 | 239 |
| 72 | 3300006914 | Ga0075436_100034402 | Ga0075436_1000344022 | 239 |
| 73 | 3300006914 | Ga0075436_100264625 | Ga0075436_1002646252 | 239 |
| 74 | 3300007076 | Ga0075435_100080581 | Ga0075435_1000805812 | 239 |
| 75 | 3300009094 | Ga0111539_10014453 | Ga0111539_100144535 | 239 |
| 76 | 3300009147 | Ga0114129_10461916 | Ga0114129_104619162 | 239 |
| 77 | 3300025925 | Ga0207650_10073879 | Ga0207650_100738792 | 239 |
| 78 | 3300026116 | Ga0207674_10037019 | Ga0207674_100370193 | 239 |
| 79 | 3300031344 | Ga0265316_10000607 | Ga0265316_1000060720 | 239 |
| 80 | 3300035088 | Ga0373940_0017661 | Ga0373940_0017661_511_1293 | 239 |
| 81 | 3300050511 | nmdc:mga08y16_29425_c1 | nmdc:mga08y16_29425_c1_3535_4317 | 239 |
| 82 | 3300050512 | nmdc:mga0n895_66015_c1 | nmdc:mga0n895_66015_c1_1504_2286 | 239 |
| 83 | 3300050514 | nmdc:mga08x19_242759_c1 | nmdc:mga08x19_242759_c1_274_1056 | 239 |
| 84 | 3300050515 | nmdc:mga0a205_19221_c1 | nmdc:mga0a205_19221_c1_1645_2427 | 239 |
| 85 | 3300050515 | nmdc:mga0a205_30475_c1 | nmdc:mga0a205_30475_c1_2002_2784 | 239 |
| 86 | 3300005330 | Ga0070690_100008523 | Ga0070690_1000085232 | 240 |
| 87 | 3300005355 | Ga0070671_100292011 | Ga0070671_1002920112 | 240 |
| 88 | 3300005445 | Ga0070708_100373777 | Ga0070708_1003737771 | 240 |
| 89 | 3300005457 | Ga0070662_100044549 | Ga0070662_1000445493 | 240 |
| 90 | 3300005539 | Ga0068853_100702050 | Ga0068853_1007020501 | 240 |
| 91 | 3300005543 | Ga0070672_100022989 | Ga0070672_1000229892 | 240 |
| 92 | 3300005544 | Ga0070686_100004795 | Ga0070686_1000047954 | 240 |
| 93 | 3300005544 | Ga0070686_100105002 | Ga0070686_1001050022 | 240 |
| 94 | 3300005578 | Ga0068854_100003187 | Ga0068854_1000031873 | 240 |
| 95 | 3300005617 | Ga0068859_100043788 | Ga0068859_1000437883 | 240 |
| 96 | 3300005617 | Ga0068859_100269437 | Ga0068859_1002694372 | 240 |
| 97 | 3300005719 | Ga0068861_100293192 | Ga0068861_1002931922 | 240 |
| 98 | 3300005841 | Ga0068863_100007150 | Ga0068863_1000071508 | 240 |
| 99 | 3300006852 | Ga0075433_10163354 | Ga0075433_101633542 | 240 |
| 100 | 3300006871 | Ga0075434_100000422 | Ga0075434_10000042210 | 240 |
| 101 | 3300006914 | Ga0075436_100005606 | Ga0075436_1000056065 | 240 |
| 102 | 3300006931 | Ga0097620_100043786 | Ga0097620_1000437862 | 240 |
| 103 | 3300006931 | Ga0097620_100269455 | Ga0097620_1002694552 | 240 |
| 104 | 3300007076 | Ga0075435_100000012 | Ga0075435_1000000128 | 240 |
| 105 | 3300007076 | Ga0075435_100014611 | Ga0075435_1000146112 | 240 |
| 106 | 3300009093 | Ga0105240_10127726 | Ga0105240_101277262 | 240 |
| 107 | 3300009147 | Ga0114129_10038577 | Ga0114129_100385774 | 240 |
| 108 | 3300009174 | Ga0105241_10038797 | Ga0105241_100387972 | 240 |
| 109 | 3300009177 | Ga0105248_10071665 | Ga0105248_100716652 | 240 |
| 110 | 3300009177 | Ga0105248_10149704 | Ga0105248_101497042 | 240 |
| 111 | 3300009177 | Ga0105248_10437229 | Ga0105248_104372291 | 240 |
| 112 | 3300009177 | Ga0105248_10533484 | Ga0105248_105334842 | 240 |
| 113 | 3300009553 | Ga0105249_10496057 | Ga0105249_104960572 | 240 |
| 114 | 3300013306 | Ga0163162_10102799 | Ga0163162_101027992 | 240 |
| 115 | 3300014968 | Ga0157379_10006385 | Ga0157379_100063859 | 240 |
| 116 | 3300025903 | Ga0207680_10028581 | Ga0207680_100285813 | 240 |
| 117 | 3300025907 | Ga0207645_10051557 | Ga0207645_100515572 | 240 |
| 118 | 3300025911 | Ga0207654_10058141 | Ga0207654_100581412 | 240 |
| 119 | 3300025918 | Ga0207662_10004611 | Ga0207662_100046114 | 240 |
| 120 | 3300025923 | Ga0207681_10096976 | Ga0207681_100969762 | 240 |
| 121 | 3300025931 | Ga0207644_10029579 | Ga0207644_100295792 | 240 |
| 122 | 3300025931 | Ga0207644_10135838 | Ga0207644_101358382 | 240 |
| 123 | 3300025933 | Ga0207706_10039849 | Ga0207706_100398492 | 240 |
| 124 | 3300025934 | Ga0207686_10273589 | Ga0207686_102735892 | 240 |
| 125 | 3300025936 | Ga0207670_10079432 | Ga0207670_100794322 | 240 |
| 126 | 3300025941 | Ga0207711_10013457 | Ga0207711_100134572 | 240 |
| 127 | 3300025941 | Ga0207711_10536170 | Ga0207711_105361702 | 240 |
| 128 | 3300025941 | Ga0207711_10699977 | Ga0207711_106999771 | 240 |
| 129 | 3300025981 | Ga0207640_10007129 | Ga0207640_100071292 | 240 |
| 130 | 3300025981 | Ga0207640_10088045 | Ga0207640_100880451 | 240 |
| 131 | 3300026035 | Ga0207703_10248714 | Ga0207703_102487142 | 240 |
| 132 | 3300026041 | Ga0207639_10333740 | Ga0207639_103337401 | 240 |
| 133 | 3300026088 | Ga0207641_10000693 | Ga0207641_1000069313 | 240 |
| 134 | 3300026118 | Ga0207675_100007011 | Ga0207675_1000070112 | 240 |
| 135 | 3300026118 | Ga0207675_100039381 | Ga0207675_1000393813 | 240 |
| 136 | 3300028381 | Ga0268264_10078681 | Ga0268264_100786812 | 240 |
| 137 | 3300034816 | Ga0373930_0008891 | Ga0373930_0008891_786_1571 | 240 |
| 138 | 3300034817 | Ga0373948_0004725 | Ga0373948_0004725_594_1379 | 240 |
| 139 | 3300034818 | Ga0373950_0008277 | Ga0373950_0008277_195_980 | 240 |
| 140 | 3300034819 | Ga0373958_0002536 | Ga0373958_0002536_1415_2200 | 240 |
| 141 | 3300034957 | Ga0373938_0003286 | Ga0373938_0003286_606_1391 | 240 |
| 142 | 3300035084 | Ga0373928_0001588 | Ga0373928_0001588_481_1266 | 240 |
| 143 | 3300035088 | Ga0373940_0001508 | Ga0373940_0001508_3017_3802 | 240 |
| 144 | 3300035091 | Ga0373951_0000926 | Ga0373951_0000926_5910_6695 | 240 |
| 145 | 3300035092 | Ga0373952_0003455 | Ga0373952_0003455_2052_2837 | 240 |
| 146 | 3300035112 | Ga0373932_0002799 | Ga0373932_0002799_518_1303 | 240 |
| 147 | 3300035114 | Ga0373939_0001094 | Ga0373939_0001094_5826_6611 | 240 |
| 148 | 3300035115 | Ga0373941_0000733 | Ga0373941_0000733_3163_3948 | 240 |
| 149 | 3300035121 | Ga0373960_0000149 | Ga0373960_0000149_6228_7013 | 240 |
| 150 | 3300035121 | Ga0373960_0023357 | Ga0373960_0023357_830_1615 | 240 |
| 151 | 3300035207 | Ga0373942_0001584 | Ga0373942_0001584_369_1154 | 240 |
| 152 | 3300035241 | Ga0373961_0003281 | Ga0373961_0003281_3031_3816 | 240 |
| 153 | 3300035242 | Ga0373962_0005503 | Ga0373962_0005503_115_900 | 240 |
| 154 | 3300035691 | Ga0373931_0018864 | Ga0373931_0018864_2310_3095 | 240 |
| 155 | 3300042156 | Ga0439446_0020341 | Ga0439446_0020341_234_1019 | 240 |
| 156 | 3300045051 | Ga0451576_0008981 | Ga0451576_0008981_2145_2930 | 240 |
| 157 | 3300045051 | Ga0451576_0077393 | Ga0451576_0077393_1487_2278 | 240 |
| 158 | 3300045051 | Ga0451576_0097009 | Ga0451576_0097009_1061_2032 | 240 |
| 159 | 3300048905 | Ga0496102_0063861 | Ga0496102_0063861_1818_2603 | 240 |
| 160 | 3300048906 | Ga0496103_0118012 | Ga0496103_0118012_118_903 | 240 |
| 161 | 3300049585 | Ga0501069_0346461 | Ga0501069_0346461_52_855 | 240 |
| 162 | 3300050512 | nmdc:mga0n895_73164_c1 | nmdc:mga0n895_73164_c1_378_1163 | 240 |
| 163 | 3300050513 | nmdc:mga0rr50_1155_c1 | nmdc:mga0rr50_1155_c1_7996_8781 | 240 |
| 164 | 3300005334 | Ga0068869_100575321 | Ga0068869_1005753211 | 241 |
| 165 | 3300005347 | Ga0070668_100036929 | Ga0070668_1000369292 | 241 |
| 166 | 3300005353 | Ga0070669_100012922 | Ga0070669_1000129224 | 241 |
| 167 | 3300005356 | Ga0070674_100050306 | Ga0070674_1000503063 | 241 |
| 168 | 3300005440 | Ga0070705_100004497 | Ga0070705_1000044973 | 241 |
| 169 | 3300005441 | Ga0070700_100378823 | Ga0070700_1003788232 | 241 |
| 170 | 3300005459 | Ga0068867_100039012 | Ga0068867_1000390122 | 241 |
| 171 | 3300005545 | Ga0070695_100033551 | Ga0070695_1000335512 | 241 |
| 172 | 3300005546 | Ga0070696_100013653 | Ga0070696_1000136533 | 241 |
| 173 | 3300005549 | Ga0070704_100028491 | Ga0070704_1000284912 | 241 |
| 174 | 3300005564 | Ga0070664_100631539 | Ga0070664_1006315392 | 241 |
| 175 | 3300005578 | Ga0068854_100293610 | Ga0068854_1002936102 | 241 |
| 176 | 3300005615 | Ga0070702_100069897 | Ga0070702_1000698972 | 241 |
| 177 | 3300005617 | Ga0068859_100367227 | Ga0068859_1003672271 | 241 |
| 178 | 3300005718 | Ga0068866_10006194 | Ga0068866_100061942 | 241 |
| 179 | 3300005719 | Ga0068861_100330890 | Ga0068861_1003308902 | 241 |
| 180 | 3300006844 | Ga0075428_100360141 | Ga0075428_1003601412 | 241 |
| 181 | 3300006931 | Ga0097620_100367194 | Ga0097620_1003671941 | 241 |
| 182 | 3300007076 | Ga0075435_100046916 | Ga0075435_1000469162 | 241 |
| 183 | 3300009147 | Ga0114129_10011555 | Ga0114129_100115556 | 241 |
| 184 | 3300009176 | Ga0105242_10012650 | Ga0105242_100126502 | 241 |
| 185 | 3300009553 | Ga0105249_10043328 | Ga0105249_100433281 | 241 |
| 186 | 3300013297 | Ga0157378_10012837 | Ga0157378_100128372 | 241 |
| 187 | 3300014326 | Ga0157380_10083413 | Ga0157380_100834132 | 241 |
| 188 | 3300025907 | Ga0207645_10001628 | Ga0207645_1000162819 | 241 |
| 189 | 3300025917 | Ga0207660_10479118 | Ga0207660_104791182 | 241 |
| 190 | 3300025923 | Ga0207681_10017646 | Ga0207681_100176464 | 241 |
| 191 | 3300025933 | Ga0207706_10234181 | Ga0207706_102341812 | 241 |
| 192 | 3300025934 | Ga0207686_10138185 | Ga0207686_101381852 | 241 |
| 193 | 3300025935 | Ga0207709_10103160 | Ga0207709_101031602 | 241 |
| 194 | 3300026075 | Ga0207708_10028975 | Ga0207708_100289752 | 241 |
| 195 | 3300026089 | Ga0207648_10004443 | Ga0207648_1000444312 | 241 |
| 196 | 3300026118 | Ga0207675_100210789 | Ga0207675_1002107892 | 241 |
| 197 | 3300026118 | Ga0207675_100395823 | Ga0207675_1003958231 | 241 |
| 198 | 3300028380 | Ga0268265_10113941 | Ga0268265_101139412 | 241 |
| 199 | 3300028381 | Ga0268264_10363534 | Ga0268264_103635342 | 241 |
| 200 | 3300046460 | Ga0495638_0006801 | Ga0495638_0006801_2006_2800 | 241 |
| 201 | 3300050512 | nmdc:mga0n895_316585_c1 | nmdc:mga0n895_316585_c1_776_1564 | 241 |
| 202 | 3300050514 | nmdc:mga08x19_399858_c1 | nmdc:mga08x19_399858_c1_133_921 | 241 |
| 203 | 3300053085 | Ga0495619_0101907 | Ga0495619_0101907_509_1312 | 241 |
| 204 | 3300005329 | Ga0070683_100121570 | Ga0070683_1001215703 | 242 |
| 205 | 3300005330 | Ga0070690_100443036 | Ga0070690_1004430362 | 242 |
| 206 | 3300005335 | Ga0070666_10357519 | Ga0070666_103575192 | 242 |
| 207 | 3300005338 | Ga0068868_100077063 | Ga0068868_1000770632 | 242 |
| 208 | 3300005364 | Ga0070673_100128469 | Ga0070673_1001284691 | 242 |
| 209 | 3300005365 | Ga0070688_100433167 | Ga0070688_1004331671 | 242 |
| 210 | 3300005518 | Ga0070699_100079654 | Ga0070699_1000796542 | 242 |
| 211 | 3300005535 | Ga0070684_100084281 | Ga0070684_1000842812 | 242 |
| 212 | 3300005543 | Ga0070672_100173322 | Ga0070672_1001733222 | 242 |
| 213 | 3300005577 | Ga0068857_100040867 | Ga0068857_1000408672 | 242 |
| 214 | 3300005718 | Ga0068866_10037352 | Ga0068866_100373522 | 242 |
| 215 | 3300005718 | Ga0068866_10053970 | Ga0068866_100539702 | 242 |
| 216 | 3300005840 | Ga0068870_10116350 | Ga0068870_101163502 | 242 |
| 217 | 3300005842 | Ga0068858_100198302 | Ga0068858_1001983022 | 242 |
| 218 | 3300005842 | Ga0068858_100473736 | Ga0068858_1004737362 | 242 |
| 219 | 3300005844 | Ga0068862_100141316 | Ga0068862_1001413162 | 242 |
| 220 | 3300005844 | Ga0068862_100743463 | Ga0068862_1007434632 | 242 |
| 221 | 3300005937 | Ga0081455_10122211 | Ga0081455_101222112 | 242 |
| 222 | 3300006237 | Ga0097621_100005757 | Ga0097621_1000057572 | 242 |
| 223 | 3300006358 | Ga0068871_100117682 | Ga0068871_1001176822 | 242 |
| 224 | 3300006852 | Ga0075433_10031726 | Ga0075433_100317262 | 242 |
| 225 | 3300006871 | Ga0075434_100124466 | Ga0075434_1001244662 | 242 |
| 226 | 3300006880 | Ga0075429_100275674 | Ga0075429_1002756742 | 242 |
| 227 | 3300006881 | Ga0068865_100006947 | Ga0068865_1000069472 | 242 |
| 228 | 3300009093 | Ga0105240_10304819 | Ga0105240_103048192 | 242 |
| 229 | 3300009147 | Ga0114129_10737329 | Ga0114129_107373292 | 242 |
| 230 | 3300009176 | Ga0105242_10008568 | Ga0105242_100085686 | 242 |
| 231 | 3300009177 | Ga0105248_10137271 | Ga0105248_101372712 | 242 |
| 232 | 3300011119 | Ga0105246_10025701 | Ga0105246_100257015 | 242 |
| 233 | 3300013297 | Ga0157378_10204303 | Ga0157378_102043032 | 242 |
| 234 | 3300014325 | Ga0163163_10093896 | Ga0163163_100938962 | 242 |
| 235 | 3300014969 | Ga0157376_10065522 | Ga0157376_100655223 | 242 |
| 236 | 3300025893 | Ga0207682_10055090 | Ga0207682_100550902 | 242 |
| 237 | 3300025899 | Ga0207642_10056193 | Ga0207642_100561932 | 242 |
| 238 | 3300025899 | Ga0207642_10056326 | Ga0207642_100563261 | 242 |
| 239 | 3300025901 | Ga0207688_10107579 | Ga0207688_101075792 | 242 |
| 240 | 3300025908 | Ga0207643_10045794 | Ga0207643_100457943 | 242 |
| 241 | 3300025913 | Ga0207695_10214877 | Ga0207695_102148772 | 242 |
| 242 | 3300025925 | Ga0207650_10495108 | Ga0207650_104951082 | 242 |
| 243 | 3300025933 | Ga0207706_10022700 | Ga0207706_100227002 | 242 |
| 244 | 3300025934 | Ga0207686_10007196 | Ga0207686_100071966 | 242 |
| 245 | 3300025934 | Ga0207686_10042680 | Ga0207686_100426802 | 242 |
| 246 | 3300025936 | Ga0207670_10108355 | Ga0207670_101083552 | 242 |
| 247 | 3300025938 | Ga0207704_10004236 | Ga0207704_100042362 | 242 |
| 248 | 3300025940 | Ga0207691_10133311 | Ga0207691_101333112 | 242 |
| 249 | 3300025940 | Ga0207691_10191282 | Ga0207691_101912822 | 242 |
| 250 | 3300025941 | Ga0207711_10193608 | Ga0207711_101936082 | 242 |
| 251 | 3300025944 | Ga0207661_10119148 | Ga0207661_101191483 | 242 |
| 252 | 3300025960 | Ga0207651_10066175 | Ga0207651_100661753 | 242 |
| 253 | 3300025961 | Ga0207712_10089246 | Ga0207712_100892462 | 242 |
| 254 | 3300025961 | Ga0207712_10112759 | Ga0207712_101127592 | 242 |
| 255 | 3300026089 | Ga0207648_10088767 | Ga0207648_100887673 | 242 |
| 256 | 3300028380 | Ga0268265_10263943 | Ga0268265_102639431 | 242 |
| 257 | 3300046517 | Ga0495630_0424544 | Ga0495630_0424544_190_1005 | 242 |
| 258 | 3300046678 | Ga0495599_0275446 | Ga0495599_0275446_37_834 | 242 |
| 259 | 3300048912 | Ga0496109_0676768 | Ga0496109_0676768_12_809 | 242 |
| 260 | 3300048917 | Ga0496114_0127574 | Ga0496114_0127574_187_1020 | 242 |
| 261 | 3300050507 | nmdc:mga05p37_184839_c1 | nmdc:mga05p37_184839_c1_1716_2516 | 242 |
| 262 | 3300050508 | nmdc:mga09592_120938_c1 | nmdc:mga09592_120938_c1_1180_1986 | 242 |
| 263 | 3300050511 | nmdc:mga08y16_244904_c1 | nmdc:mga08y16_244904_c1_247_1053 | 242 |
| 264 | 3300005293 | Ga0065715_10014812 | Ga0065715_100148122 | 243 |
| 265 | 3300005293 | Ga0065715_10097179 | Ga0065715_100971792 | 243 |
| 266 | 3300005293 | Ga0065715_10196078 | Ga0065715_101960782 | 243 |
| 267 | 3300005329 | Ga0070683_100003650 | Ga0070683_1000036502 | 243 |
| 268 | 3300005335 | Ga0070666_10040356 | Ga0070666_100403563 | 243 |
| 269 | 3300005335 | Ga0070666_10080090 | Ga0070666_100800902 | 243 |
| 270 | 3300005338 | Ga0068868_100025293 | Ga0068868_1000252932 | 243 |
| 271 | 3300005340 | Ga0070689_100069469 | Ga0070689_1000694692 | 243 |
| 272 | 3300005343 | Ga0070687_100023972 | Ga0070687_1000239722 | 243 |
| 273 | 3300005356 | Ga0070674_100240670 | Ga0070674_1002406702 | 243 |
| 274 | 3300005364 | Ga0070673_100000622 | Ga0070673_10000062212 | 243 |
| 275 | 3300005367 | Ga0070667_100079686 | Ga0070667_1000796862 | 243 |
| 276 | 3300005367 | Ga0070667_100411622 | Ga0070667_1004116222 | 243 |
| 277 | 3300005406 | Ga0070703_10100443 | Ga0070703_101004431 | 243 |
| 278 | 3300005440 | Ga0070705_100038659 | Ga0070705_1000386593 | 243 |
| 279 | 3300005455 | Ga0070663_100517995 | Ga0070663_1005179952 | 243 |
| 280 | 3300005457 | Ga0070662_100214103 | Ga0070662_1002141032 | 243 |
| 281 | 3300005458 | Ga0070681_10287328 | Ga0070681_102873282 | 243 |
| 282 | 3300005459 | Ga0068867_100017428 | Ga0068867_1000174283 | 243 |
| 283 | 3300005468 | Ga0070707_100374783 | Ga0070707_1003747832 | 243 |
| 284 | 3300005535 | Ga0070684_100042700 | Ga0070684_1000427002 | 243 |
| 285 | 3300005544 | Ga0070686_100198800 | Ga0070686_1001988002 | 243 |
| 286 | 3300005547 | Ga0070693_100034428 | Ga0070693_1000344282 | 243 |
| 287 | 3300005548 | Ga0070665_100003072 | Ga0070665_1000030722 | 243 |
| 288 | 3300005549 | Ga0070704_100015912 | Ga0070704_1000159123 | 243 |
| 289 | 3300005564 | Ga0070664_100002291 | Ga0070664_10000229116 | 243 |
| 290 | 3300005564 | Ga0070664_100172133 | Ga0070664_1001721332 | 243 |
| 291 | 3300005564 | Ga0070664_100377675 | Ga0070664_1003776752 | 243 |
| 292 | 3300005578 | Ga0068854_100070524 | Ga0068854_1000705242 | 243 |
| 293 | 3300005615 | Ga0070702_100128796 | Ga0070702_1001287962 | 243 |
| 294 | 3300005616 | Ga0068852_100042166 | Ga0068852_1000421662 | 243 |
| 295 | 3300005616 | Ga0068852_100310211 | Ga0068852_1003102112 | 243 |
| 296 | 3300005618 | Ga0068864_100009264 | Ga0068864_1000092644 | 243 |
| 297 | 3300005618 | Ga0068864_100368653 | Ga0068864_1003686532 | 243 |
| 298 | 3300005719 | Ga0068861_100180064 | Ga0068861_1001800642 | 243 |
| 299 | 3300005841 | Ga0068863_100232856 | Ga0068863_1002328562 | 243 |
| 300 | 3300005842 | Ga0068858_100004003 | Ga0068858_1000040032 | 243 |
| 301 | 3300005842 | Ga0068858_100061890 | Ga0068858_1000618903 | 243 |
| 302 | 3300005842 | Ga0068858_100228535 | Ga0068858_1002285352 | 243 |
| 303 | 3300006178 | Ga0075367_10042545 | Ga0075367_100425452 | 243 |
| 304 | 3300006353 | Ga0075370_10268703 | Ga0075370_102687032 | 243 |
| 305 | 3300006844 | Ga0075428_100001509 | Ga0075428_1000015095 | 243 |
| 306 | 3300006847 | Ga0075431_100042121 | Ga0075431_1000421211 | 243 |
| 307 | 3300006871 | Ga0075434_100043349 | Ga0075434_1000433492 | 243 |
| 308 | 3300006881 | Ga0068865_100066394 | Ga0068865_1000663942 | 243 |
| 309 | 3300006914 | Ga0075436_100028917 | Ga0075436_1000289172 | 243 |
| 310 | 3300007076 | Ga0075435_100001689 | Ga0075435_10000168910 | 243 |
| 311 | 3300009093 | Ga0105240_10272501 | Ga0105240_102725012 | 243 |
| 312 | 3300009094 | Ga0111539_10385478 | Ga0111539_103854781 | 243 |
| 313 | 3300009098 | Ga0105245_10026213 | Ga0105245_100262134 | 243 |
| 314 | 3300009101 | Ga0105247_10007815 | Ga0105247_100078152 | 243 |
| 315 | 3300009148 | Ga0105243_10633840 | Ga0105243_106338402 | 243 |
| 316 | 3300009174 | Ga0105241_10201121 | Ga0105241_102011212 | 243 |
| 317 | 3300009176 | Ga0105242_10002061 | Ga0105242_1000206111 | 243 |
| 318 | 3300009177 | Ga0105248_10062352 | Ga0105248_100623522 | 243 |
| 319 | 3300009177 | Ga0105248_10069002 | Ga0105248_100690022 | 243 |
| 320 | 3300009545 | Ga0105237_10034258 | Ga0105237_100342582 | 243 |
| 321 | 3300011119 | Ga0105246_10100745 | Ga0105246_101007451 | 243 |
| 322 | 3300013296 | Ga0157374_10031219 | Ga0157374_100312195 | 243 |
| 323 | 3300013296 | Ga0157374_10068853 | Ga0157374_100688532 | 243 |
| 324 | 3300014968 | Ga0157379_10015553 | Ga0157379_100155532 | 243 |
| 325 | 3300014969 | Ga0157376_10083136 | Ga0157376_100831362 | 243 |
| 326 | 3300025315 | Ga0207697_10016320 | Ga0207697_100163204 | 243 |
| 327 | 3300025900 | Ga0207710_10084677 | Ga0207710_100846771 | 243 |
| 328 | 3300025903 | Ga0207680_10003857 | Ga0207680_100038577 | 243 |
| 329 | 3300025904 | Ga0207647_10011629 | Ga0207647_100116293 | 243 |
| 330 | 3300025918 | Ga0207662_10003765 | Ga0207662_100037654 | 243 |
| 331 | 3300025923 | Ga0207681_10126896 | Ga0207681_101268962 | 243 |
| 332 | 3300025926 | Ga0207659_10256822 | Ga0207659_102568222 | 243 |
| 333 | 3300025927 | Ga0207687_10023582 | Ga0207687_100235822 | 243 |
| 334 | 3300025931 | Ga0207644_10019943 | Ga0207644_100199433 | 243 |
| 335 | 3300025933 | Ga0207706_10107020 | Ga0207706_101070202 | 243 |
| 336 | 3300025934 | Ga0207686_10005954 | Ga0207686_100059544 | 243 |
| 337 | 3300025934 | Ga0207686_10414451 | Ga0207686_104144512 | 243 |
| 338 | 3300025935 | Ga0207709_10022402 | Ga0207709_100224022 | 243 |
| 339 | 3300025938 | Ga0207704_10127038 | Ga0207704_101270382 | 243 |
| 340 | 3300025941 | Ga0207711_10006204 | Ga0207711_100062045 | 243 |
| 341 | 3300025941 | Ga0207711_10040464 | Ga0207711_100404642 | 243 |
| 342 | 3300025941 | Ga0207711_10058198 | Ga0207711_100581982 | 243 |
| 343 | 3300025944 | Ga0207661_10025470 | Ga0207661_100254702 | 243 |
| 344 | 3300025945 | Ga0207679_10003988 | Ga0207679_100039885 | 243 |
| 345 | 3300025945 | Ga0207679_10341917 | Ga0207679_103419172 | 243 |
| 346 | 3300025961 | Ga0207712_10196770 | Ga0207712_101967702 | 243 |
| 347 | 3300025981 | Ga0207640_10082407 | Ga0207640_100824072 | 243 |
| 348 | 3300025986 | Ga0207658_10060760 | Ga0207658_100607602 | 243 |
| 349 | 3300025986 | Ga0207658_10214000 | Ga0207658_102140002 | 243 |
| 350 | 3300026023 | Ga0207677_10011530 | Ga0207677_100115302 | 243 |
| 351 | 3300026023 | Ga0207677_10557341 | Ga0207677_105573411 | 243 |
| 352 | 3300026035 | Ga0207703_10055226 | Ga0207703_100552263 | 243 |
| 353 | 3300026075 | Ga0207708_10006874 | Ga0207708_100068746 | 243 |
| 354 | 3300026089 | Ga0207648_10017686 | Ga0207648_100176864 | 243 |
| 355 | 3300026095 | Ga0207676_10010229 | Ga0207676_100102292 | 243 |
| 356 | 3300026118 | Ga0207675_100072562 | Ga0207675_1000725623 | 243 |
| 357 | 3300026118 | Ga0207675_100175798 | Ga0207675_1001757982 | 243 |
| 358 | 3300026121 | Ga0207683_10235362 | Ga0207683_102353622 | 243 |
| 359 | 3300028379 | Ga0268266_10009514 | Ga0268266_100095143 | 243 |
| 360 | 3300031344 | Ga0265316_10144218 | Ga0265316_101442182 | 243 |
| 361 | 3300046454 | Ga0495592_0085374 | Ga0495592_0085374_438_1244 | 243 |
| 362 | 3300046675 | Ga0495657_0198194 | Ga0495657_0198194_161_970 | 243 |
| 363 | 3300048905 | Ga0496102_0049115 | Ga0496102_0049115_263_1057 | 243 |
| 364 | 3300048906 | Ga0496103_0051267 | Ga0496103_0051267_694_1500 | 243 |
| 365 | 3300048907 | Ga0496104_0000830 | Ga0496104_0000830_5526_6320 | 243 |
| 366 | 3300048907 | Ga0496104_0050211 | Ga0496104_0050211_2949_3767 | 243 |
| 367 | 3300048908 | Ga0496105_0043166 | Ga0496105_0043166_1710_2504 | 243 |
| 368 | 3300048909 | Ga0496106_0119619 | Ga0496106_0119619_762_1556 | 243 |
| 369 | 3300048911 | Ga0496108_0001041 | Ga0496108_0001041_8973_9767 | 243 |
| 370 | 3300048911 | Ga0496108_0001495 | Ga0496108_0001495_6697_7515 | 243 |
| 371 | 3300048912 | Ga0496109_0024111 | Ga0496109_0024111_3381_4175 | 243 |
| 372 | 3300048912 | Ga0496109_0026080 | Ga0496109_0026080_1162_1980 | 243 |
| 373 | 3300048912 | Ga0496109_0536011 | Ga0496109_0536011_83_877 | 243 |
| 374 | 3300048913 | Ga0496110_0002605 | Ga0496110_0002605_2995_3789 | 243 |
| 375 | 3300048914 | Ga0496111_0173323 | Ga0496111_0173323_58_852 | 243 |
| 376 | 3300048915 | Ga0496112_0000626 | Ga0496112_0000626_5115_5909 | 243 |
| 377 | 3300048915 | Ga0496112_0326146 | Ga0496112_0326146_150_968 | 243 |
| 378 | 3300048918 | Ga0496115_0405460 | Ga0496115_0405460_185_991 | 243 |
| 379 | 3300049583 | Ga0501067_0163034 | Ga0501067_0163034_201_1001 | 243 |
| 380 | 3300050494 | nmdc:mga06z11_18597_c1 | nmdc:mga06z11_18597_c1_1099_1887 | 243 |
| 381 | 3300050496 | nmdc:mga07m45_259388_c1 | nmdc:mga07m45_259388_c1_100_939 | 243 |
| 382 | 3300050511 | nmdc:mga08y16_418164_c1 | nmdc:mga08y16_418164_c1_275_1096 | 243 |
| 383 | 3300050512 | nmdc:mga0n895_379752_c1 | nmdc:mga0n895_379752_c1_372_1166 | 243 |
| 384 | 3300050512 | nmdc:mga0n895_72802_c1 | nmdc:mga0n895_72802_c1_530_1330 | 243 |
| 385 | 3300050514 | nmdc:mga08x19_48893_c1 | nmdc:mga08x19_48893_c1_592_1410 | 243 |
| 386 | 3300053730 | Ga0500645_002700 | Ga0500645_002700_3948_4736 | 243 |
| 387 | 3300005331 | Ga0070670_100170001 | Ga0070670_1001700012 | 244 |
| 388 | 3300005334 | Ga0068869_100097247 | Ga0068869_1000972472 | 244 |
| 389 | 3300005340 | Ga0070689_100103407 | Ga0070689_1001034072 | 244 |
| 390 | 3300005343 | Ga0070687_100034838 | Ga0070687_1000348382 | 244 |
| 391 | 3300005354 | Ga0070675_100027461 | Ga0070675_1000274612 | 244 |
| 392 | 3300005364 | Ga0070673_100054923 | Ga0070673_1000549233 | 244 |
| 393 | 3300005365 | Ga0070688_100225206 | Ga0070688_1002252062 | 244 |
| 394 | 3300005365 | Ga0070688_100444000 | Ga0070688_1004440001 | 244 |
| 395 | 3300005456 | Ga0070678_100019928 | Ga0070678_1000199282 | 244 |
| 396 | 3300005457 | Ga0070662_100222749 | Ga0070662_1002227492 | 244 |
| 397 | 3300005466 | Ga0070685_10033291 | Ga0070685_100332912 | 244 |
| 398 | 3300005536 | Ga0070697_100009337 | Ga0070697_1000093372 | 244 |
| 399 | 3300005546 | Ga0070696_100195965 | Ga0070696_1001959651 | 244 |
| 400 | 3300005617 | Ga0068859_100225859 | Ga0068859_1002258592 | 244 |
| 401 | 3300005618 | Ga0068864_100141775 | Ga0068864_1001417752 | 244 |
| 402 | 3300005718 | Ga0068866_10043565 | Ga0068866_100435652 | 244 |
| 403 | 3300005719 | Ga0068861_100219097 | Ga0068861_1002190972 | 244 |
| 404 | 3300005840 | Ga0068870_10105758 | Ga0068870_101057582 | 244 |
| 405 | 3300005841 | Ga0068863_100239181 | Ga0068863_1002391812 | 244 |
| 406 | 3300005842 | Ga0068858_100075913 | Ga0068858_1000759133 | 244 |
| 407 | 3300005985 | Ga0081539_10006314 | Ga0081539_100063148 | 244 |
| 408 | 3300006051 | Ga0075364_10017132 | Ga0075364_100171322 | 244 |
| 409 | 3300006177 | Ga0075362_10065365 | Ga0075362_100653652 | 244 |
| 410 | 3300006178 | Ga0075367_10111239 | Ga0075367_101112392 | 244 |
| 411 | 3300006195 | Ga0075366_10000836 | Ga0075366_1000083613 | 244 |
| 412 | 3300006358 | Ga0068871_100357558 | Ga0068871_1003575581 | 244 |
| 413 | 3300006844 | Ga0075428_100083208 | Ga0075428_1000832082 | 244 |
| 414 | 3300006852 | Ga0075433_10279631 | Ga0075433_102796312 | 244 |
| 415 | 3300006880 | Ga0075429_100213608 | Ga0075429_1002136082 | 244 |
| 416 | 3300006881 | Ga0068865_100153659 | Ga0068865_1001536592 | 244 |
| 417 | 3300006914 | Ga0075436_100225478 | Ga0075436_1002254782 | 244 |
| 418 | 3300006931 | Ga0097620_100225866 | Ga0097620_1002258662 | 244 |
| 419 | 3300007076 | Ga0075435_100081612 | Ga0075435_1000816121 | 244 |
| 420 | 3300007076 | Ga0075435_100110374 | Ga0075435_1001103742 | 244 |
| 421 | 3300009094 | Ga0111539_10001106 | Ga0111539_100011065 | 244 |
| 422 | 3300009174 | Ga0105241_10398963 | Ga0105241_103989632 | 244 |
| 423 | 3300009176 | Ga0105242_10080506 | Ga0105242_100805061 | 244 |
| 424 | 3300009177 | Ga0105248_10455494 | Ga0105248_104554942 | 244 |
| 425 | 3300009553 | Ga0105249_10270995 | Ga0105249_102709952 | 244 |
| 426 | 3300014326 | Ga0157380_10718684 | Ga0157380_107186842 | 244 |
| 427 | 3300025918 | Ga0207662_10002800 | Ga0207662_100028002 | 244 |
| 428 | 3300025925 | Ga0207650_10041831 | Ga0207650_100418312 | 244 |
| 429 | 3300025933 | Ga0207706_10179303 | Ga0207706_101793032 | 244 |
| 430 | 3300025934 | Ga0207686_10155218 | Ga0207686_101552182 | 244 |
| 431 | 3300025935 | Ga0207709_10087742 | Ga0207709_100877422 | 244 |
| 432 | 3300025935 | Ga0207709_10502157 | Ga0207709_105021572 | 244 |
| 433 | 3300025937 | Ga0207669_10270285 | Ga0207669_102702851 | 244 |
| 434 | 3300025940 | Ga0207691_10078745 | Ga0207691_100787452 | 244 |
| 435 | 3300025941 | Ga0207711_10461627 | Ga0207711_104616272 | 244 |
| 436 | 3300025942 | Ga0207689_10036670 | Ga0207689_100366704 | 244 |
| 437 | 3300025961 | Ga0207712_10091413 | Ga0207712_100914132 | 244 |
| 438 | 3300025986 | Ga0207658_10143655 | Ga0207658_101436551 | 244 |
| 439 | 3300026023 | Ga0207677_10155833 | Ga0207677_101558332 | 244 |
| 440 | 3300026067 | Ga0207678_10021408 | Ga0207678_100214083 | 244 |
| 441 | 3300026075 | Ga0207708_10077922 | Ga0207708_100779223 | 244 |
| 442 | 3300026089 | Ga0207648_10002915 | Ga0207648_1000291512 | 244 |
| 443 | 3300026118 | Ga0207675_100132997 | Ga0207675_1001329972 | 244 |
| 444 | 3300026121 | Ga0207683_10119908 | Ga0207683_101199082 | 244 |
| 445 | 3300027907 | Ga0207428_10000633 | Ga0207428_100006333 | 244 |
| 446 | 3300046516 | Ga0495628_0133753 | Ga0495628_0133753_481_1335 | 244 |
| 447 | 3300046533 | Ga0495640_0069803 | Ga0495640_0069803_758_1612 | 244 |
| 448 | 3300046543 | Ga0495645_0000735 | Ga0495645_0000735_18443_19297 | 244 |
| 449 | 3300046809 | Ga0495600_0096733 | Ga0495600_0096733_100_954 | 244 |
| 450 | 3300047322 | Ga0495680_0251739 | Ga0495680_0251739_37_891 | 244 |
| 451 | 3300048917 | Ga0496114_0624259 | Ga0496114_0624259_23_877 | 244 |
| 452 | 3300050489 | nmdc:mga03683_118550_c1 | nmdc:mga03683_118550_c1_289_1089 | 244 |
| 453 | 3300050493 | nmdc:mga0k408_9200_c1 | nmdc:mga0k408_9200_c1_2376_3176 | 244 |
| 454 | 3300050494 | nmdc:mga06z11_13767_c1 | nmdc:mga06z11_13767_c1_155_955 | 244 |
| 455 | 3300050511 | nmdc:mga08y16_4466_c1 | nmdc:mga08y16_4466_c1_3212_4012 | 244 |
| 456 | 3300050512 | nmdc:mga0n895_41641_c1 | nmdc:mga0n895_41641_c1_3587_4387 | 244 |
| 457 | 3300050512 | nmdc:mga0n895_69895_c1 | nmdc:mga0n895_69895_c1_1717_2517 | 244 |
| 458 | 3300050512 | nmdc:mga0n895_86558_c1 | nmdc:mga0n895_86558_c1_1188_2045 | 244 |
| 459 | 3300050513 | nmdc:mga0rr50_107152_c1 | nmdc:mga0rr50_107152_c1_187_987 | 244 |
| 460 | 3300050513 | nmdc:mga0rr50_128259_c1 | nmdc:mga0rr50_128259_c1_179_1036 | 244 |
| 461 | 3300050514 | nmdc:mga08x19_122600_c1 | nmdc:mga08x19_122600_c1_413_1270 | 244 |
| 462 | 3300050515 | nmdc:mga0a205_86621_c1 | nmdc:mga0a205_86621_c1_185_985 | 244 |
| 463 | 3300005444 | Ga0070694_100016942 | Ga0070694_1000169422 | 245 |
| 464 | 3300005546 | Ga0070696_100049120 | Ga0070696_1000491202 | 245 |
| 465 | 3300009147 | Ga0114129_10184214 | Ga0114129_101842142 | 245 |
| 466 | 3300025922 | Ga0207646_10525863 | Ga0207646_105258631 | 245 |
| 467 | 3300009098 | Ga0105245_10011294 | Ga0105245_100112944 | 246 |
| 468 | 3300025927 | Ga0207687_10007227 | Ga0207687_100072273 | 246 |
| 469 | 3300006051 | Ga0075364_10127930 | Ga0075364_101279301 | 247 |
| 470 | 3300007076 | Ga0075435_100032221 | Ga0075435_1000322214 | 247 |
| 471 | 3300009147 | Ga0114129_10115639 | Ga0114129_101156394 | 247 |
| 472 | 3300050507 | nmdc:mga05p37_133099_c1 | nmdc:mga05p37_133099_c1_1916_2749 | 247 |
| 473 | 3300050512 | nmdc:mga0n895_396649_c1 | nmdc:mga0n895_396649_c1_236_1048 | 247 |
| 474 | 3300050515 | nmdc:mga0a205_495101_c1 | nmdc:mga0a205_495101_c1_33_845 | 247 |
| 475 | 3300005290 | Ga0065712_10075118 | Ga0065712_100751182 | 256 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b1m-assembly3.cif.gz_C | carbohydrate binding module cbm66 from bacillus subtilis | 0.8317 | 49 | 254 |
| 4b1m-assembly3.cif.gz_C | carbohydrate binding module cbm66 from bacillus subtilis | 0.7943 | 49 | 254 |
| 5nxb-assembly1.cif.gz_B | mouse galactocerebrosidase in complex with saposin a | 0.7569 | 33 | 256 |
| 6y6s-assembly1.cif.gz_A | mouse galactocerebrosidase complexed with galacto-noeurostegine gns at ph 6.8 | 0.7417 | 33 | 256 |
| 2yro-assembly1.cif.gz_A | solution structure of the c-terminal gal-bind lectin protein from human galectin-8 | 0.7369 | 102 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b1mC00 | Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 | 0.8317 | 49 | 254 | 2.60.120.560 |
| af_A0A5K1K8Q0_451_608_2.60.120.560 | Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 | 0.7959 | 57 | 251 | 2.60.120.560 |
| 4b1mC00 | Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 | 0.7943 | 49 | 254 | 2.60.120.560 |
| af_Q58355_45_220_2.60.120.560 | Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 | 0.7866 | 34 | 251 | 2.60.120.560 |
| af_Q58355_45_220_2.60.120.560 | Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 | 0.7741 | 34 | 251 | 2.60.120.560 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8QIQ4-F1-model_v4 | Uncharacterized protein | 0.9581 | 88 | 254 |
|
| AF-A0A2V8QIQ4-F1-model_v4 | Uncharacterized protein | 0.9448 | 88 | 254 |
|
| AF-A0A536CZE6-F1-model_v4 | LamG domain-containing protein | 0.9182 | 90 | 256 |
GO:0016787
|
| AF-A0A2V7S4B8-F1-model_v4 | 3-keto-disaccharide hydrolase domain-containing protein | 0.9065 | 93 | 256 |
|
| AF-A0A2V8EYJ6-F1-model_v4 | 3-keto-disaccharide hydrolase domain-containing protein | 0.9013 | 26 | 256 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar