F451545

General Info

Members Datasets Scaffolds Average Seq Length
476 285 474 169

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10001814|Ga0265327_100018148
Length 168
Sequence MKFIDPHHDQWRTVGGEDGPMSHPPIKSYSLLTLGQWHAVREQWPAQGSADYKPVGVILPNDTDIEVLEADTAKLALVVLQFPKWVDGRAYSQAHILRARYRFTGEIRATGEVLVDMMPLLARSGFDAVALRSDQDRAAAERALGFFAARGHYQGDIKVTKPVFGRAA

Samples

Sample ID Description Type Environment
1 2643221660 Methylibium sp. Root1272 Isolate Unclassified
2 2831864461 Roseateles noduli HZ7 Isolate Nodule
3 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
210 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
211 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
212 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
213 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
214 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
215 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
216 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
267 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
268 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
271 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
272 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
275 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
278 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
281 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
282 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
283 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
284 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
285 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0.84
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.84
Nodule 0.63
Rhizoplane 1.47
Rhizosphere 61.34
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1011916 3300002705 Bacteria 1944
2 JGI25156J39149_1013855 3300002705 Bacteria 1691
3 JGI25154J39366_1001787 3300002738 Bacteria 6771
4 JGI25157J39369_1000423 3300002741 Bacteria 27882
5 Ga0006778J45830_1110127 3300003162 Bacteria 1064
6 rootH1_10015183 3300003316 Bacteria 1597
7 rootH1_10041378 3300003316 Bacteria 1902
8 rootH2_10002555 3300003320 Bacteria 1751
9 rootH2_10169528 3300003320 Bacteria 1788
10 rootL2_10000073 3300003322 Bacteria 23640
11 rootL2_10036206 3300003322 Bacteria 1383
12 rootH1_10003718 3300003323 Bacteria 13571
13 rootH1_10026770 3300003323 Bacteria 1255
14 rootH1_10026771 3300003316 Bacteria 4380
15 rootH1_10026771 3300003323 Bacteria 1416
16 rootH1_10045867 3300003323 Bacteria 1838
17 rootH1_10045868 3300003323 Bacteria 2301
18 Ga0055539_1000267 3300003752 Bacteria 31502
19 Ga0055539_1000525 3300003752 Bacteria 11716
20 Ga0055533_1000006 3300003756 Bacteria 635559
21 Ga0055525_1000601 3300003759 Bacteria 15226
22 Ga0055535_1000702 3300003761 Bacteria 25845
23 Ga0055529_1000340 3300003763 Bacteria 52215
24 Ga0055526_1004906 3300003771 Bacteria 7870
25 Ga0055524_1009872 3300003775 Bacteria 3843
26 Ga0055528_1064815 3300003790 Bacteria 677
27 Ga0055531_10019970 3300003794 Bacteria 2676
28 Ga0055543_1003950 3300004625 Bacteria 4185
29 Ga0065165_1000390 3300005262 Bacteria 71262
30 Ga0070658_10097061 3300005327 Bacteria 2433
31 Ga0070658_10295208 3300005327 Bacteria 1381
32 Ga0070658_10328567 3300005327 Bacteria 1306
33 Ga0070676_10640023 3300005328 Bacteria 771
34 Ga0070683_100671548 3300005329 Bacteria 992
35 Ga0070670_100001786 3300005331 Bacteria 17507
36 Ga0070670_100210937 3300005331 Bacteria 1689
37 Ga0070670_100533812 3300005331 Bacteria 1045
38 Ga0070670_100736829 3300005331 Bacteria 888
39 Ga0070677_10039887 3300005333 Bacteria 1845
40 Ga0070677_10182410 3300005333 Bacteria 1001
41 Ga0068869_100105058 3300005334 Bacteria 2141
42 Ga0070666_10240595 3300005335 Bacteria 1280
43 Ga0068868_100199964 3300005338 Bacteria 1665
44 Ga0070660_100142558 3300005339 Bacteria 1923
45 Ga0070660_100837147 3300005339 Bacteria 775
46 Ga0070689_101481545 3300005340 Bacteria 614
47 Ga0070661_100385840 3300005344 Bacteria 1105
48 Ga0070668_101637773 3300005347 Bacteria 590
49 Ga0070669_100048889 3300005353 Bacteria 3087
50 Ga0070675_100007685 3300005354 Bacteria 8344
51 Ga0070671_100013507 3300005355 Bacteria 6584
52 Ga0070671_100019824 3300005355 Bacteria 5479
53 Ga0070671_100060692 3300005355 Bacteria 3148
54 Ga0070674_100004831 3300005356 Bacteria 7724
55 Ga0070673_100011292 3300005364 Bacteria 6090
56 Ga0070673_100020575 3300005364 Bacteria 4760
57 Ga0070688_100266194 3300005365 Bacteria 1226
58 Ga0070659_100167470 3300005366 Bacteria 1798
59 Ga0070659_100183360 3300005366 Bacteria 1718
60 Ga0070659_100919373 3300005366 Bacteria 765
61 Ga0070667_100029603 3300005367 Bacteria 4564
62 Ga0070667_100515321 3300005367 Bacteria 1097
63 Ga0070667_100590155 3300005367 Bacteria 1023
64 Ga0070708_100207663 3300005445 Bacteria 1835
65 Ga0070663_100001001 3300005455 Bacteria 15402
66 Ga0070678_100002432 3300005456 Bacteria 10201
67 Ga0070678_100120155 3300005456 Bacteria 2071
68 Ga0070678_100757317 3300005456 Bacteria 879
69 Ga0070662_100739125 3300005457 Bacteria 834
70 Ga0068867_100000228 3300005459 Bacteria 36773
71 Ga0068867_100003245 3300005459 Bacteria 11462
72 Ga0068867_100021071 3300005459 Bacteria 4649
73 Ga0068867_100107262 3300005459 Bacteria 2141
74 Ga0068867_100132918 3300005459 Bacteria 1936
75 Ga0068867_100313200 3300005459 Bacteria 1298
76 Ga0068867_100413139 3300005459 Bacteria 1141
77 Ga0068867_100677035 3300005459 Bacteria 908
78 Ga0070685_10497497 3300005466 Bacteria 862
79 Ga0070706_100009701 3300005467 Bacteria 8948
80 Ga0070706_100418157 3300005467 Bacteria 1248
81 Ga0070707_100017523 3300005468 Bacteria 6735
82 Ga0070698_100330885 3300005471 Bacteria 1454
83 Ga0070699_101289782 3300005518 Bacteria 670
84 Ga0070679_101491795 3300005530 Bacteria 623
85 Ga0070684_100610654 3300005535 Bacteria 1014
86 Ga0070672_100000447 3300005543 Bacteria 24121
87 Ga0070665_100024775 3300005548 Bacteria 6045
88 Ga0070665_101108138 3300005548 Bacteria 803
89 Ga0068855_100476231 3300005563 Bacteria 1359
90 Ga0068855_100523959 3300005563 Bacteria 1285
91 Ga0070664_100110974 3300005564 Bacteria 2394
92 Ga0070664_100536579 3300005564 Bacteria 1081
93 Ga0068857_100003384 3300005577 Bacteria 13274
94 Ga0068857_100044181 3300005577 Bacteria 3951
95 Ga0068857_100059339 3300005577 Bacteria 3398
96 Ga0068857_100464525 3300005577 Bacteria 1185
97 Ga0068857_101328908 3300005577 Bacteria 698
98 Ga0068854_100176847 3300005578 Bacteria 1664
99 Ga0068854_100213648 3300005578 Bacteria 1523
100 Ga0068856_100001919 3300005614 Bacteria 21672
101 Ga0068852_100166880 3300005616 Bacteria 2060
102 Ga0068852_101073753 3300005616 Bacteria 825
103 Ga0068852_101436971 3300005616 Bacteria 712
104 Ga0068864_100126434 3300005618 Bacteria 2291
105 Ga0068861_100074016 3300005719 Bacteria 2648
106 Ga0068851_10728585 3300005834 Bacteria 612
107 Ga0068863_100935149 3300005841 Bacteria 868
108 Ga0068860_100371627 3300005843 Bacteria 1410
109 Ga0075365_10015895 3300006038 Bacteria 4561
110 Ga0075365_10221757 3300006038 Bacteria 1327
111 Ga0075368_10003121 3300006042 Bacteria 5496
112 Ga0075364_10142406 3300006051 Bacteria 1613
113 Ga0075364_10239470 3300006051 Bacteria 1232
114 Ga0075362_10091752 3300006177 Bacteria 1410
115 Ga0075362_10129360 3300006177 Bacteria 1199
116 Ga0075362_10183687 3300006177 Bacteria 1014
117 Ga0075362_10355605 3300006177 Bacteria 734
118 Ga0075367_10112326 3300006178 Bacteria 1673
119 Ga0075367_10180367 3300006178 Bacteria 1317
120 Ga0075367_10307310 3300006178 Bacteria 998
121 Ga0075369_10020121 3300006186 Bacteria 2731
122 Ga0075369_10160409 3300006186 Bacteria 1031
123 Ga0075366_10010092 3300006195 Bacteria 5292
124 Ga0075366_10012503 3300006195 Bacteria 4815
125 Ga0075366_10018606 3300006195 Bacteria 4013
126 Ga0075366_10149629 3300006195 Bacteria 1413
127 Ga0075366_10167581 3300006195 Bacteria 1332
128 Ga0075366_10186227 3300006195 Bacteria 1261
129 Ga0075366_10212211 3300006195 Bacteria 1178
130 Ga0075366_10219297 3300006195 Bacteria 1159
131 Ga0075366_10267645 3300006195 Bacteria 1044
132 Ga0075366_10306821 3300006195 Bacteria 971
133 Ga0097621_100231666 3300006237 Bacteria 1613
134 Ga0097621_101090090 3300006237 Bacteria 749
135 Ga0075370_10009411 3300006353 Bacteria 5072
136 Ga0075370_10013131 3300006353 Bacteria 4395
137 Ga0075370_10013927 3300006353 Bacteria 4280
138 Ga0075370_10086242 3300006353 Bacteria 1808
139 Ga0075370_10148512 3300006353 Bacteria 1373
140 Ga0075370_10307043 3300006353 Bacteria 944
141 Ga0075370_10332219 3300006353 Bacteria 906
142 Ga0075370_10402648 3300006353 Bacteria 821
143 Ga0075429_100002218 3300006880 Bacteria 16266
144 Ga0068865_100368041 3300006881 Bacteria 1169
145 Ga0099823_1000211 3300006944 Bacteria 32728
146 Ga0105240_10092549 3300009093 Bacteria 3691
147 Ga0105240_10240449 3300009093 Bacteria 2099
148 Ga0105240_10785485 3300009093 Bacteria 1032
149 Ga0111539_10926720 3300009094 Bacteria 1013
150 Ga0105245_10382210 3300009098 Bacteria 1402
151 Ga0105245_10615974 3300009098 Bacteria 1113
152 Ga0114129_10121124 3300009147 Bacteria 3601
153 Ga0105243_10001277 3300009148 Bacteria 22593
154 Ga0105243_10148061 3300009148 Bacteria 2011
155 Ga0105241_10101254 3300009174 Bacteria 2290
156 Ga0105241_10122629 3300009174 Bacteria 2095
157 Ga0105242_10099559 3300009176 Bacteria 2461
158 Ga0105248_10666813 3300009177 Bacteria 1173
159 Ga0105237_10034988 3300009545 Bacteria 5084
160 Ga0105237_10198589 3300009545 Bacteria 2005
161 Ga0105238_10067050 3300009551 Bacteria 3590
162 Ga0105239_10072130 3300010375 Bacteria 3795
163 Ga0105246_10081657 3300011119 Bacteria 2305
164 Ga0105246_10114725 3300011119 Bacteria 1985
165 Ga0157319_1000003 3300012497 Bacteria 397199
166 Ga0157374_10205798 3300013296 Bacteria 1928
167 Ga0157374_10314228 3300013296 Bacteria 1552
168 Ga0163162_10478387 3300013306 Bacteria 1377
169 Ga0157372_10143169 3300013307 Bacteria 2756
170 Ga0157375_10735771 3300013308 Bacteria 1138
171 Ga0157375_10974406 3300013308 Bacteria 989
172 Ga0163163_10222645 3300014325 Bacteria 1936
173 Ga0157380_10263698 3300014326 Bacteria 1566
174 Ga0157377_10000016 3300014745 Bacteria 190613
175 Ga0157379_11313108 3300014968 Bacteria 699
176 Ga0157376_10115189 3300014969 Bacteria 2373
177 Ga0163161_10011249 3300017792 Bacteria 6200
178 Ga0209674_100003 3300025226 Bacteria 2196646
179 Ga0209672_106548 3300025228 Bacteria 1881
180 Ga0209563_100010 3300025230 Bacteria 1337457
181 Ga0209563_115978 3300025230 Bacteria 932
182 Ga0207427_100190 3300025231 Bacteria 61601
183 Ga0209258_100060 3300025242 Bacteria 319881
184 Ga0209258_101561 3300025242 Bacteria 7659
185 Ga0209646_1000376 3300025246 Bacteria 28912
186 Ga0209026_1000179 3300025250 Bacteria 95680
187 Ga0209677_100026 3300025253 Bacteria 382520
188 Ga0209677_100784 3300025253 Bacteria 15983
189 Ga0209677_107536 3300025253 Bacteria 2288
190 Ga0209148_1010057 3300025254 Bacteria 1812
191 Ga0209759_1000196 3300025256 Bacteria 95680
192 Ga0209759_1003221 3300025256 Bacteria 6608
193 Ga0209759_1003576 3300025256 Bacteria 6140
194 Ga0209759_1005886 3300025256 Bacteria 4196
195 Ga0209759_1019941 3300025256 Bacteria 1573
196 Ga0209455_1000093 3300025272 Bacteria 220487
197 Ga0209673_1034259 3300025273 Bacteria 1537
198 Ga0209673_1050517 3300025273 Bacteria 1104
199 Ga0209564_1000051 3300025295 Bacteria 357748
200 Ga0209050_1005005 3300025298 Bacteria 8612
201 Ga0209256_1000675 3300025299 Bacteria 46128
202 Ga0209051_1003055 3300025303 Bacteria 11322
203 Ga0209051_1016986 3300025303 Bacteria 3267
204 Ga0209257_1005336 3300025304 Bacteria 9099
205 Ga0207656_10044454 3300025321 Bacteria 1897
206 Ga0207682_10034010 3300025893 Bacteria 2054
207 Ga0207682_10041355 3300025893 Bacteria 1881
208 Ga0207688_10047704 3300025901 Bacteria 2391
209 Ga0207688_10207409 3300025901 Bacteria 1177
210 Ga0207680_10261044 3300025903 Bacteria 1199
211 Ga0207645_10021528 3300025907 Bacteria 4204
212 Ga0207705_10255094 3300025909 Bacteria 1338
213 Ga0207684_10009174 3300025910 Bacteria 8752
214 Ga0207654_10027444 3300025911 Bacteria 3094
215 Ga0207695_10039555 3300025913 Bacteria 5068
216 Ga0207671_10025887 3300025914 Bacteria 4402
217 Ga0207657_10028816 3300025919 Bacteria 5059
218 Ga0207657_10234138 3300025919 Bacteria 1468
219 Ga0207649_10167693 3300025920 Bacteria 1527
220 Ga0207649_10293852 3300025920 Bacteria 1186
221 Ga0207681_10029245 3300025923 Bacteria 3577
222 Ga0207681_10043404 3300025923 Bacteria 3009
223 Ga0207694_10074907 3300025924 Bacteria 2649
224 Ga0207650_10000783 3300025925 Bacteria 24484
225 Ga0207650_10447239 3300025925 Bacteria 1075
226 Ga0207659_10000307 3300025926 Bacteria 29582
227 Ga0207659_10734972 3300025926 Bacteria 846
228 Ga0207687_10050006 3300025927 Bacteria 2909
229 Ga0207644_10055496 3300025931 Bacteria 2855
230 Ga0207644_10232255 3300025931 Bacteria 1466
231 Ga0207644_10986828 3300025931 Bacteria 707
232 Ga0207690_10080985 3300025932 Bacteria 2267
233 Ga0207690_11097229 3300025932 Bacteria 663
234 Ga0207706_10394857 3300025933 Bacteria 1200
235 Ga0207686_10467042 3300025934 Bacteria 973
236 Ga0207709_10001251 3300025935 Bacteria 18257
237 Ga0207709_10262342 3300025935 Bacteria 1267
238 Ga0207669_10002758 3300025937 Bacteria 7535
239 Ga0207704_10237941 3300025938 Bacteria 1358
240 Ga0207691_10003997 3300025940 Bacteria 14303
241 Ga0207691_10070487 3300025940 Bacteria 3156
242 Ga0207711_10553013 3300025941 Bacteria 1073
243 Ga0207689_10074348 3300025942 Bacteria 2792
244 Ga0207679_10130612 3300025945 Bacteria 2014
245 Ga0207679_10237132 3300025945 Bacteria 1543
246 Ga0207667_10003358 3300025949 Bacteria 19745
247 Ga0207667_11434044 3300025949 Bacteria 663
248 Ga0207651_10031751 3300025960 Bacteria 3381
249 Ga0207651_10032204 3300025960 Bacteria 3364
250 Ga0207668_10194305 3300025972 Bacteria 1611
251 Ga0207668_10925331 3300025972 Bacteria 777
252 Ga0207640_10056317 3300025981 Bacteria 2580
253 Ga0207640_10124302 3300025981 Bacteria 1855
254 Ga0207640_10452058 3300025981 Bacteria 1059
255 Ga0207640_10456509 3300025981 Bacteria 1054
256 Ga0207658_10052703 3300025986 Bacteria 3003
257 Ga0207658_10232903 3300025986 Bacteria 1556
258 Ga0207639_10142367 3300026041 Bacteria 1999
259 Ga0207639_10142983 3300026041 Bacteria 1995
260 Ga0207639_10820593 3300026041 Bacteria 867
261 Ga0207678_10001091 3300026067 Bacteria 24903
262 Ga0207678_10237941 3300026067 Bacteria 1559
263 Ga0207678_10255305 3300026067 Bacteria 1502
264 Ga0207678_10427405 3300026067 Bacteria 1149
265 Ga0207702_10000199 3300026078 Bacteria 70834
266 Ga0207702_10371156 3300026078 Bacteria 1374
267 Ga0207648_10000598 3300026089 Bacteria 40545
268 Ga0207648_10008882 3300026089 Bacteria 9674
269 Ga0207648_10030699 3300026089 Bacteria 4757
270 Ga0207648_10068060 3300026089 Bacteria 3103
271 Ga0207648_10131309 3300026089 Bacteria 2205
272 Ga0207648_10377104 3300026089 Bacteria 1282
273 Ga0207676_10133919 3300026095 Bacteria 2111
274 Ga0207676_11055197 3300026095 Bacteria 802
275 Ga0207674_10006359 3300026116 Bacteria 13907
276 Ga0207674_10057633 3300026116 Bacteria 3937
277 Ga0207674_10242910 3300026116 Bacteria 1748
278 Ga0207674_10741448 3300026116 Bacteria 948
279 Ga0207675_100052849 3300026118 Bacteria 3790
280 Ga0207683_10001684 3300026121 Bacteria 19770
281 Ga0207683_10173488 3300026121 Bacteria 1953
282 Ga0207683_10231379 3300026121 Bacteria 1686
283 Ga0207698_10778213 3300026142 Bacteria 958
284 Ga0209389_1023716 3300027296 Bacteria 5405
285 Ga0209371_1031621 3300027312 Bacteria 1146
286 Ga0209971_1102796 3300027682 Bacteria 700
287 Ga0209813_10001967 3300027866 Bacteria 4645
288 Ga0268266_10084814 3300028379 Bacteria 2767
289 Ga0268266_10313008 3300028379 Bacteria 1467
290 Ga0268264_10367530 3300028381 Bacteria 1374
291 Ga0265336_10000012 3300028666 Bacteria 261478
292 Ga0307517_10000150 3300028786 Bacteria 110446
293 Ga0307517_10148113 3300028786 Bacteria 1621
294 Ga0307517_10229311 3300028786 Bacteria 1117
295 Ga0307517_10339013 3300028786 Bacteria 822
296 Ga0307515_10048427 3300028794 Bacteria 6426
297 Ga0307515_10374035 3300028794 Bacteria 1060
298 Ga0268256_1023218 3300030500 Bacteria 1614
299 Ga0307511_10072563 3300030521 Bacteria 2499
300 Ga0307512_10012395 3300030522 Bacteria 8045
301 Ga0307512_10291968 3300030522 Bacteria 768
302 Ga0265328_10030177 3300031239 Bacteria 2020
303 Ga0265327_10001814 3300031251 Bacteria 25001
304 Ga0307509_10002837 3300031507 Bacteria 27455
305 Ga0307509_10011064 3300031507 Bacteria 10987
306 Ga0307509_10017922 3300031507 Bacteria 8131
307 Ga0307509_10384121 3300031507 Bacteria 1116
308 Ga0307408_100100040 3300031548 Bacteria 2207
309 Ga0307408_100124347 3300031548 Bacteria 2003
310 Ga0307508_10001937 3300031616 Bacteria 22703
311 Ga0307508_10002030 3300031616 Bacteria 21943
312 Ga0307508_10188802 3300031616 Bacteria 1662
313 Ga0307514_10181140 3300031649 Bacteria 1358
314 Ga0307514_10273342 3300031649 Bacteria 975
315 Ga0307516_10002378 3300031730 Bacteria 25205
316 Ga0307516_10266315 3300031730 Bacteria 1402
317 Ga0307516_10562740 3300031730 Bacteria 794
318 Ga0307405_10014843 3300031731 Bacteria 4202
319 Ga0307413_10033011 3300031824 Bacteria 2941
320 Ga0307413_10061552 3300031824 Bacteria 2317
321 Ga0307410_10098224 3300031852 Bacteria 2094
322 Ga0307406_10291521 3300031901 Bacteria 1249
323 Ga0307407_10051492 3300031903 Bacteria 2361
324 Ga0307412_10279276 3300031911 Bacteria 1310
325 Ga0307409_100015073 3300031995 Bacteria 5056
326 Ga0307409_100112176 3300031995 Bacteria 2289
327 Ga0307409_101147565 3300031995 Bacteria 799
328 Ga0307416_100080432 3300032002 Bacteria 2751
329 Ga0307414_10028632 3300032004 Bacteria 3616
330 Ga0307411_10114846 3300032005 Bacteria 1935
331 Ga0307411_10835430 3300032005 Bacteria 814
332 Ga0307411_10989249 3300032005 Bacteria 752
333 Ga0307415_100039530 3300032126 Bacteria 3119
334 Ga0307507_10319028 3300033179 Bacteria 937
335 Ga0307510_10032222 3300033180 Bacteria 5906
336 Ga0307510_10036007 3300033180 Bacteria 5516
337 Ga0307510_10102227 3300033180 Bacteria 2649
338 Ga0307510_10354242 3300033180 Bacteria 917
339 Ga0373959_0001904 3300034820 Bacteria 3332
340 Ga0373938_0034261 3300034957 Bacteria 1102
341 Ga0373928_0046618 3300035084 Bacteria 1012
342 Ga0373934_0015101 3300035086 Bacteria 2927
343 Ga0373960_0037144 3300035121 Bacteria 1391
344 Ga0373931_0023509 3300035691 Bacteria 3112
345 Ga0373937_0847408 3300036401 Bacteria 862
346 Ga0373925_0086709 3300037068 Bacteria 2389
347 Ga0395898_0248339 3300037466 Bacteria 1697
348 Ga0395905_0163392 3300037471 Bacteria 2092
349 Ga0395905_0169731 3300037471 Bacteria 2049
350 Ga0395905_0248303 3300037471 Bacteria 1662
351 Ga0395901_0003991 3300038443 Bacteria 14856
352 Ga0436361_0152229 3300039447 Bacteria 2211
353 Ga0451800_1299428 3300041459 Bacteria 722
354 Ga0451802_1818719 3300041460 Bacteria 863
355 Ga0451807_1905397 3300041486 Bacteria 804
356 Ga0451837_1548583 3300041494 Bacteria 617
357 Ga0451847_0510527 3300041503 Bacteria 919
358 Ga0439441_019829 3300042001 Bacteria 1227
359 Ga0439443_046792 3300042003 Bacteria 750
360 Ga0450888_056834 3300042126 Bacteria 569
361 Ga0450890_004077 3300042127 Bacteria 1917
362 Ga0439458_0017606 3300042157 Bacteria 1634
363 Ga0439459_0004944 3300042438 Bacteria 2169
364 Ga0451577_0052147 3300042876 Bacteria 3652
365 Ga0451577_0433035 3300042876 Bacteria 1194
366 Ga0466963_0411779 3300044694 Bacteria 953
367 Ga0466963_0448302 3300044694 Bacteria 910
368 Ga0466964_0032134 3300044706 Bacteria 2085
369 Ga0453684_0020258 3300044712 Bacteria 10051
370 Ga0453684_0075261 3300044712 Bacteria 4245
371 Ga0451576_1975545 3300045051 Bacteria 601
372 Ga0495592_0005413 3300046454 Bacteria 9423
373 Ga0495592_0339698 3300046454 Bacteria 966
374 Ga0495638_0035681 3300046460 Bacteria 3169
375 Ga0495638_0064276 3300046460 Bacteria 2261
376 Ga0495650_0020058 3300046471 Bacteria 3270
377 Ga0495582_0265260 3300046473 Bacteria 985
378 Ga0495605_0377282 3300046474 Bacteria 592
379 Ga0495583_0001275 3300046506 Bacteria 26345
380 Ga0495606_0003090 3300046507 Bacteria 18134
381 Ga0495608_0852606 3300046511 Bacteria 535
382 Ga0495610_0236135 3300046512 Bacteria 731
383 Ga0495610_0310795 3300046512 Bacteria 605
384 Ga0495618_0332562 3300046514 Bacteria 939
385 Ga0495632_0004080 3300046519 Bacteria 10076
386 Ga0495648_0207484 3300046524 Bacteria 976
387 Ga0495666_0028509 3300046526 Bacteria 2747
388 Ga0495652_1037751 3300046529 Bacteria 535
389 Ga0495621_0000186 3300046539 Bacteria 14274
390 Ga0495621_0013043 3300046539 Bacteria 2605
391 Ga0495668_0075573 3300046616 Bacteria 1850
392 Ga0495668_0129102 3300046616 Bacteria 1384
393 Ga0495625_0031998 3300046660 Bacteria 3907
394 Ga0495625_0059298 3300046660 Bacteria 2716
395 Ga0495625_0283802 3300046660 Bacteria 1064
396 Ga0495669_0052625 3300046684 Bacteria 1830
397 Ga0495624_0094567 3300046690 Bacteria 1842
398 Ga0495671_0040228 3300046692 Bacteria 2358
399 Ga0495649_0003769 3300046694 Bacteria 10057
400 Ga0495649_0008664 3300046694 Bacteria 6107
401 Ga0495589_0086306 3300046794 Bacteria 1524
402 Ga0495660_0072989 3300046810 Bacteria 1816
403 Ga0495683_0283304 3300047323 Bacteria 717
404 Ga0495686_0005311 3300047472 Bacteria 10208
405 Ga0495602_0131355 3300048088 Bacteria 1996
406 Ga0496100_0311308 3300048903 Bacteria 1181
407 Ga0496100_0766972 3300048903 Bacteria 755
408 Ga0496109_0093655 3300048912 Bacteria 2780
409 Ga0496110_0047518 3300048913 Bacteria 3759
410 Ga0501306_016425 3300049127 Bacteria 994
411 Ga0501304_000171 3300049160 Bacteria 2763
412 Ga0501315_004286 3300049531 Bacteria 1485
413 Ga0501039_0295246 3300049575 Bacteria 1274
414 Ga0501257_095970 3300049686 Bacteria 775
415 nmdc:mga03683_22922_c1 3300050489 Bacteria 2426
416 nmdc:mga03683_98030_c1 3300050489 Bacteria 1285
417 nmdc:mga00v17_44553_c1 3300050491 Bacteria 2676
418 nmdc:mga0yw44_322280_c1 3300050492 Bacteria 1038
419 nmdc:mga0k408_1070_c2 3300050493 Bacteria 9350
420 nmdc:mga0k408_121579_c1 3300050493 Bacteria 1546
421 nmdc:mga0k408_1281_c1 3300050493 Bacteria 13618
422 nmdc:mga0k408_140895_c1 3300050493 Bacteria 1435
423 nmdc:mga0k408_1749_c1 3300050493 Bacteria 11633
424 nmdc:mga0k408_200775_c1 3300050493 Bacteria 1190
425 nmdc:mga0k408_267279_c1 3300050493 Bacteria 1021
426 nmdc:mga0k408_299925_c1 3300050493 Bacteria 959
427 nmdc:mga0k408_330_c1 3300050493 Bacteria 25941
428 nmdc:mga0k408_34111_c1 3300050493 Bacteria 2913
429 nmdc:mga0k408_365678_c1 3300050493 Bacteria 860
430 nmdc:mga0k408_422444_c1 3300050493 Bacteria 793
431 nmdc:mga0k408_57281_c1 3300050493 Bacteria 2262
432 nmdc:mga0k408_64903_c1 3300050493 Bacteria 2125
433 nmdc:mga0k408_7031_c1 3300050493 Bacteria 6007
434 nmdc:mga0k408_8999_c1 3300050493 Bacteria 5372
435 nmdc:mga0k408_96421_c1 3300050493 Bacteria 1741
436 nmdc:mga06z11_233954_c1 3300050494 Bacteria 1077
437 nmdc:mga06z11_274049_c1 3300050494 Bacteria 998
438 nmdc:mga06z11_4773_c1 3300050494 Bacteria 5363
439 nmdc:mga06z11_59827_c1 3300050494 Bacteria 1981
440 nmdc:mga04h51_79888_c1 3300050495 Bacteria 1159
441 nmdc:mga07m45_191_c1 3300050496 Bacteria 24330
442 nmdc:mga07m45_20994_c1 3300050496 Bacteria 3552
443 nmdc:mga07m45_214690_c1 3300050496 Bacteria 1119
444 nmdc:mga07m45_3609_c1 3300050496 Bacteria 7474
445 nmdc:mga07m45_38159_c1 3300050496 Bacteria 2681
446 nmdc:mga07m45_56421_c1 3300050496 Bacteria 2220
447 nmdc:mga07m45_6895_c1 3300050496 Bacteria 5778
448 nmdc:mga05p37_60728_c1 3300050507 Bacteria 4653
449 nmdc:mga09592_93741_c1 3300050508 Bacteria 2568
450 nmdc:mga0sz30_10145_c1 3300050516 Bacteria 3603
451 nmdc:mga0sz30_498484_c1 3300050516 Bacteria 548
452 Ga0500635_0000096 3300053080 Bacteria 53378
453 Ga0500643_031271 3300053087 Bacteria 1625
454 Ga0500644_0031695 3300053088 Bacteria 1683
455 Ga0500651_0027673 3300053093 Bacteria 3566
456 Ga0500593_000112 3300053117 Bacteria 31359
457 Ga0500594_0000801 3300053118 Bacteria 6704
458 Ga0500652_143249 3300053131 Bacteria 994
459 Ga0500559_0000069 3300053136 Bacteria 82288
460 Ga0500559_0005362 3300053136 Bacteria 5905
461 Ga0500561_0057483 3300053137 Bacteria 1080
462 Ga0500564_185344 3300053138 Bacteria 865
463 Ga0500568_0032110 3300053139 Bacteria 2160
464 Ga0500590_133961 3300053148 Bacteria 1142
465 Ga0500604_0101367 3300053151 Bacteria 949
466 Ga0500616_0247885 3300053153 Bacteria 762
467 Ga0500619_114382 3300053154 Bacteria 919
468 Ga0500619_153973 3300053154 Bacteria 781
469 Ga0500620_062191 3300053155 Bacteria 1273
470 Ga0500622_0000881 3300053156 Bacteria 25562
471 Ga0500622_0002736 3300053156 Bacteria 12446
472 Ga0500627_0289148 3300053158 Bacteria 718
473 Ga0500636_0094060 3300053177 Bacteria 1713
474 Ga0500661_019784 3300055283 Bacteria 1198

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_1975545 Ga0451576_1975545_23_481 132
2 3300046514 Ga0495618_0332562 Ga0495618_0332562_440_916 136
3 3300046524 Ga0495648_0207484 Ga0495648_0207484_455_931 136
4 3300046529 Ga0495652_1037751 Ga0495652_1037751_28_507 136
5 3300050516 nmdc:mga0sz30_498484_c1 nmdc:mga0sz30_498484_c1_16_492 136
6 3300014326 Ga0157380_10263698 Ga0157380_102636982 142
7 3300041459 Ga0451800_1299428 Ga0451800_1299428_158_655 150
8 3300003316 rootH1_10015183 rootH1_100151832 151
9 3300005445 Ga0070708_100207663 Ga0070708_1002076632 151
10 3300005467 Ga0070706_100009701 Ga0070706_1000097012 151
11 3300005468 Ga0070707_100017523 Ga0070707_1000175232 151
12 3300005471 Ga0070698_100330885 Ga0070698_1003308852 151
13 3300005518 Ga0070699_101289782 Ga0070699_1012897821 151
14 3300042157 Ga0439458_0017606 Ga0439458_0017606_512_985 151
15 iso_pu_bacteria 2831864461 2831866060 151
16 iso_pu_bacteria 2886848708 2886851528 151
17 iso_pu_bacteria 2643221660 2644340030 152
18 3300003316 rootH1_10041378 rootH1_100413783 153
19 3300003320 rootH2_10002555 rootH2_100025553 153
20 3300003322 rootL2_10000073 rootL2_100000732 153
21 3300003323 rootH1_10045867 rootH1_100458672 153
22 3300009147 Ga0114129_10121124 Ga0114129_101211242 154
23 3300047472 Ga0495686_0005311 Ga0495686_0005311_5946_6422 154
24 3300048912 Ga0496109_0093655 Ga0496109_0093655_2135_2620 154
25 3300048913 Ga0496110_0047518 Ga0496110_0047518_2757_3242 154
26 3300050507 nmdc:mga05p37_60728_c1 nmdc:mga05p37_60728_c1_2564_3046 154
27 3300003323 rootH1_10045868 rootH1_100458682 155
28 3300003775 Ga0055524_1009872 Ga0055524_10098722 155
29 3300003790 Ga0055528_1064815 Ga0055528_10648152 155
30 3300003794 Ga0055531_10019970 Ga0055531_100199702 155
31 3300004625 Ga0055543_1003950 Ga0055543_10039502 155
32 3300005262 Ga0065165_1000390 Ga0065165_100039016 155
33 3300005466 Ga0070685_10497497 Ga0070685_104974971 155
34 3300005535 Ga0070684_100610654 Ga0070684_1006106542 155
35 3300006195 Ga0075366_10018606 Ga0075366_100186065 155
36 3300006353 Ga0075370_10013131 Ga0075370_100131314 155
37 3300006944 Ga0099823_1000211 Ga0099823_10002117 155
38 3300012497 Ga0157319_1000003 Ga0157319_1000003293 155
39 3300025273 Ga0209673_1034259 Ga0209673_10342592 155
40 3300025273 Ga0209673_1050517 Ga0209673_10505172 155
41 3300025298 Ga0209050_1005005 Ga0209050_10050055 155
42 3300025299 Ga0209256_1000675 Ga0209256_100067539 155
43 3300025303 Ga0209051_1016986 Ga0209051_10169862 155
44 3300025304 Ga0209257_1005336 Ga0209257_10053367 155
45 3300027296 Ga0209389_1023716 Ga0209389_10237162 155
46 3300027312 Ga0209371_1031621 Ga0209371_10316212 155
47 3300030500 Ga0268256_1023218 Ga0268256_10232182 155
48 3300031548 Ga0307408_100100040 Ga0307408_1001000402 155
49 3300042003 Ga0439443_046792 Ga0439443_046792_13_522 155
50 3300042127 Ga0450890_004077 Ga0450890_004077_436_945 155
51 3300042438 Ga0439459_0004944 Ga0439459_0004944_684_1193 155
52 3300044694 Ga0466963_0448302 Ga0466963_0448302_147_656 155
53 3300044706 Ga0466964_0032134 Ga0466964_0032134_1321_1830 155
54 3300046460 Ga0495638_0064276 Ga0495638_0064276_1371_1871 155
55 3300050493 nmdc:mga0k408_57281_c1 nmdc:mga0k408_57281_c1_262_771 155
56 3300050496 nmdc:mga07m45_3609_c1 nmdc:mga07m45_3609_c1_1877_2386 155
57 3300053117 Ga0500593_000112 Ga0500593_000112_1068_1592 155
58 3300053156 Ga0500622_0002736 Ga0500622_0002736_3208_3717 155
59 3300003162 Ga0006778J45830_1110127 Ga0006778J45830_11101271 156
60 3300005331 Ga0070670_100001786 Ga0070670_10000178611 156
61 3300005331 Ga0070670_100210937 Ga0070670_1002109372 156
62 3300005331 Ga0070670_100533812 Ga0070670_1005338122 156
63 3300005331 Ga0070670_100736829 Ga0070670_1007368291 156
64 3300005333 Ga0070677_10039887 Ga0070677_100398872 156
65 3300005333 Ga0070677_10182410 Ga0070677_101824102 156
66 3300005334 Ga0068869_100105058 Ga0068869_1001050582 156
67 3300005335 Ga0070666_10240595 Ga0070666_102405952 156
68 3300005338 Ga0068868_100199964 Ga0068868_1001999641 156
69 3300005347 Ga0070668_101637773 Ga0070668_1016377731 156
70 3300005353 Ga0070669_100048889 Ga0070669_1000488894 156
71 3300005354 Ga0070675_100007685 Ga0070675_1000076858 156
72 3300005355 Ga0070671_100013507 Ga0070671_1000135074 156
73 3300005355 Ga0070671_100019824 Ga0070671_1000198243 156
74 3300005355 Ga0070671_100060692 Ga0070671_1000606922 156
75 3300005356 Ga0070674_100004831 Ga0070674_1000048314 156
76 3300005364 Ga0070673_100020575 Ga0070673_1000205753 156
77 3300005366 Ga0070659_100919373 Ga0070659_1009193731 156
78 3300005367 Ga0070667_100029603 Ga0070667_1000296032 156
79 3300005367 Ga0070667_100515321 Ga0070667_1005153212 156
80 3300005367 Ga0070667_100590155 Ga0070667_1005901552 156
81 3300005455 Ga0070663_100001001 Ga0070663_10000100114 156
82 3300005456 Ga0070678_100002432 Ga0070678_1000024329 156
83 3300005456 Ga0070678_100120155 Ga0070678_1001201552 156
84 3300005457 Ga0070662_100739125 Ga0070662_1007391251 156
85 3300005459 Ga0068867_100000228 Ga0068867_10000022821 156
86 3300005459 Ga0068867_100003245 Ga0068867_1000032453 156
87 3300005459 Ga0068867_100021071 Ga0068867_1000210713 156
88 3300005459 Ga0068867_100107262 Ga0068867_1001072622 156
89 3300005459 Ga0068867_100313200 Ga0068867_1003132001 156
90 3300005459 Ga0068867_100413139 Ga0068867_1004131391 156
91 3300005467 Ga0070706_100418157 Ga0070706_1004181572 156
92 3300005543 Ga0070672_100000447 Ga0070672_10000044711 156
93 3300005548 Ga0070665_100024775 Ga0070665_1000247755 156
94 3300005548 Ga0070665_101108138 Ga0070665_1011081382 156
95 3300005564 Ga0070664_100110974 Ga0070664_1001109742 156
96 3300005564 Ga0070664_100536579 Ga0070664_1005365792 156
97 3300005577 Ga0068857_100044181 Ga0068857_1000441812 156
98 3300005577 Ga0068857_100059339 Ga0068857_1000593392 156
99 3300005577 Ga0068857_100464525 Ga0068857_1004645252 156
100 3300005577 Ga0068857_101328908 Ga0068857_1013289082 156
101 3300005578 Ga0068854_100176847 Ga0068854_1001768472 156
102 3300005578 Ga0068854_100213648 Ga0068854_1002136482 156
103 3300005616 Ga0068852_101436971 Ga0068852_1014369711 156
104 3300005618 Ga0068864_100126434 Ga0068864_1001264343 156
105 3300006038 Ga0075365_10015895 Ga0075365_100158954 156
106 3300006038 Ga0075365_10221757 Ga0075365_102217572 156
107 3300006042 Ga0075368_10003121 Ga0075368_100031214 156
108 3300006051 Ga0075364_10142406 Ga0075364_101424062 156
109 3300006051 Ga0075364_10239470 Ga0075364_102394702 156
110 3300006177 Ga0075362_10091752 Ga0075362_100917522 156
111 3300006177 Ga0075362_10129360 Ga0075362_101293602 156
112 3300006177 Ga0075362_10183687 Ga0075362_101836872 156
113 3300006177 Ga0075362_10355605 Ga0075362_103556051 156
114 3300006178 Ga0075367_10112326 Ga0075367_101123262 156
115 3300006178 Ga0075367_10180367 Ga0075367_101803672 156
116 3300006178 Ga0075367_10307310 Ga0075367_103073102 156
117 3300006186 Ga0075369_10160409 Ga0075369_101604092 156
118 3300006195 Ga0075366_10149629 Ga0075366_101496292 156
119 3300006195 Ga0075366_10167581 Ga0075366_101675812 156
120 3300006195 Ga0075366_10186227 Ga0075366_101862272 156
121 3300006195 Ga0075366_10212211 Ga0075366_102122111 156
122 3300006195 Ga0075366_10267645 Ga0075366_102676452 156
123 3300006195 Ga0075366_10306821 Ga0075366_103068212 156
124 3300006237 Ga0097621_100231666 Ga0097621_1002316662 156
125 3300006237 Ga0097621_101090090 Ga0097621_1010900901 156
126 3300006353 Ga0075370_10009411 Ga0075370_100094115 156
127 3300006353 Ga0075370_10013927 Ga0075370_100139272 156
128 3300006353 Ga0075370_10086242 Ga0075370_100862423 156
129 3300006353 Ga0075370_10307043 Ga0075370_103070432 156
130 3300006353 Ga0075370_10332219 Ga0075370_103322192 156
131 3300006880 Ga0075429_100002218 Ga0075429_10000221811 156
132 3300006881 Ga0068865_100368041 Ga0068865_1003680412 156
133 3300009093 Ga0105240_10240449 Ga0105240_102404492 156
134 3300009094 Ga0111539_10926720 Ga0111539_109267202 156
135 3300009098 Ga0105245_10382210 Ga0105245_103822102 156
136 3300009098 Ga0105245_10615974 Ga0105245_106159742 156
137 3300009148 Ga0105243_10001277 Ga0105243_100012772 156
138 3300009148 Ga0105243_10148061 Ga0105243_101480612 156
139 3300009174 Ga0105241_10122629 Ga0105241_101226292 156
140 3300009177 Ga0105248_10666813 Ga0105248_106668132 156
141 3300009545 Ga0105237_10034988 Ga0105237_100349884 156
142 3300011119 Ga0105246_10114725 Ga0105246_101147252 156
143 3300013296 Ga0157374_10314228 Ga0157374_103142282 156
144 3300013308 Ga0157375_10974406 Ga0157375_109744062 156
145 3300014325 Ga0163163_10222645 Ga0163163_102226453 156
146 3300014745 Ga0157377_10000016 Ga0157377_1000001610 156
147 3300014969 Ga0157376_10115189 Ga0157376_101151892 156
148 3300017792 Ga0163161_10011249 Ga0163161_100112492 156
149 3300025321 Ga0207656_10044454 Ga0207656_100444543 156
150 3300025893 Ga0207682_10034010 Ga0207682_100340103 156
151 3300025893 Ga0207682_10041355 Ga0207682_100413552 156
152 3300025901 Ga0207688_10047704 Ga0207688_100477043 156
153 3300025901 Ga0207688_10207409 Ga0207688_102074092 156
154 3300025907 Ga0207645_10021528 Ga0207645_100215284 156
155 3300025914 Ga0207671_10025887 Ga0207671_100258873 156
156 3300025920 Ga0207649_10167693 Ga0207649_101676932 156
157 3300025923 Ga0207681_10029245 Ga0207681_100292454 156
158 3300025923 Ga0207681_10043404 Ga0207681_100434042 156
159 3300025925 Ga0207650_10000783 Ga0207650_1000078310 156
160 3300025925 Ga0207650_10447239 Ga0207650_104472392 156
161 3300025926 Ga0207659_10000307 Ga0207659_1000030727 156
162 3300025926 Ga0207659_10734972 Ga0207659_107349722 156
163 3300025927 Ga0207687_10050006 Ga0207687_100500063 156
164 3300025931 Ga0207644_10055496 Ga0207644_100554962 156
165 3300025931 Ga0207644_10232255 Ga0207644_102322552 156
166 3300025933 Ga0207706_10394857 Ga0207706_103948572 156
167 3300025935 Ga0207709_10001251 Ga0207709_100012512 156
168 3300025935 Ga0207709_10262342 Ga0207709_102623422 156
169 3300025937 Ga0207669_10002758 Ga0207669_100027582 156
170 3300025940 Ga0207691_10003997 Ga0207691_1000399710 156
171 3300025940 Ga0207691_10070487 Ga0207691_100704872 156
172 3300025941 Ga0207711_10553013 Ga0207711_105530132 156
173 3300025942 Ga0207689_10074348 Ga0207689_100743483 156
174 3300025945 Ga0207679_10130612 Ga0207679_101306122 156
175 3300025945 Ga0207679_10237132 Ga0207679_102371322 156
176 3300025960 Ga0207651_10032204 Ga0207651_100322043 156
177 3300025972 Ga0207668_10194305 Ga0207668_101943052 156
178 3300025972 Ga0207668_10925331 Ga0207668_109253312 156
179 3300025981 Ga0207640_10056317 Ga0207640_100563172 156
180 3300025981 Ga0207640_10452058 Ga0207640_104520582 156
181 3300025981 Ga0207640_10456509 Ga0207640_104565092 156
182 3300025986 Ga0207658_10052703 Ga0207658_100527032 156
183 3300025986 Ga0207658_10232903 Ga0207658_102329032 156
184 3300026041 Ga0207639_10142367 Ga0207639_101423672 156
185 3300026067 Ga0207678_10001091 Ga0207678_1000109115 156
186 3300026067 Ga0207678_10237941 Ga0207678_102379412 156
187 3300026067 Ga0207678_10255305 Ga0207678_102553052 156
188 3300026089 Ga0207648_10000598 Ga0207648_1000059812 156
189 3300026089 Ga0207648_10008882 Ga0207648_100088827 156
190 3300026089 Ga0207648_10030699 Ga0207648_100306993 156
191 3300026089 Ga0207648_10131309 Ga0207648_101313092 156
192 3300026095 Ga0207676_10133919 Ga0207676_101339192 156
193 3300026095 Ga0207676_11055197 Ga0207676_110551972 156
194 3300026116 Ga0207674_10057633 Ga0207674_100576333 156
195 3300026116 Ga0207674_10242910 Ga0207674_102429102 156
196 3300026116 Ga0207674_10741448 Ga0207674_107414482 156
197 3300026121 Ga0207683_10001684 Ga0207683_100016849 156
198 3300026121 Ga0207683_10173488 Ga0207683_101734883 156
199 3300027682 Ga0209971_1102796 Ga0209971_11027962 156
200 3300027866 Ga0209813_10001967 Ga0209813_100019674 156
201 3300028379 Ga0268266_10084814 Ga0268266_100848142 156
202 3300028379 Ga0268266_10313008 Ga0268266_103130082 156
203 3300028786 Ga0307517_10000150 Ga0307517_1000015075 156
204 3300028786 Ga0307517_10148113 Ga0307517_101481131 156
205 3300028786 Ga0307517_10229311 Ga0307517_102293112 156
206 3300028786 Ga0307517_10339013 Ga0307517_103390132 156
207 3300028794 Ga0307515_10048427 Ga0307515_100484276 156
208 3300028794 Ga0307515_10374035 Ga0307515_103740352 156
209 3300030522 Ga0307512_10012395 Ga0307512_100123952 156
210 3300030522 Ga0307512_10291968 Ga0307512_102919682 156
211 3300031239 Ga0265328_10030177 Ga0265328_100301773 156
212 3300031251 Ga0265327_10001814 Ga0265327_100018148 156
213 3300031507 Ga0307509_10002837 Ga0307509_100028378 156
214 3300031507 Ga0307509_10011064 Ga0307509_100110648 156
215 3300031507 Ga0307509_10017922 Ga0307509_100179224 156
216 3300031507 Ga0307509_10384121 Ga0307509_103841212 156
217 3300031548 Ga0307408_100124347 Ga0307408_1001243472 156
218 3300031616 Ga0307508_10001937 Ga0307508_1000193712 156
219 3300031616 Ga0307508_10002030 Ga0307508_1000203011 156
220 3300031616 Ga0307508_10188802 Ga0307508_101888022 156
221 3300031649 Ga0307514_10181140 Ga0307514_101811402 156
222 3300031649 Ga0307514_10273342 Ga0307514_102733422 156
223 3300031730 Ga0307516_10562740 Ga0307516_105627401 156
224 3300031731 Ga0307405_10014843 Ga0307405_100148432 156
225 3300031824 Ga0307413_10033011 Ga0307413_100330112 156
226 3300031824 Ga0307413_10061552 Ga0307413_100615522 156
227 3300031852 Ga0307410_10098224 Ga0307410_100982242 156
228 3300031901 Ga0307406_10291521 Ga0307406_102915212 156
229 3300031903 Ga0307407_10051492 Ga0307407_100514922 156
230 3300031911 Ga0307412_10279276 Ga0307412_102792762 156
231 3300031995 Ga0307409_100015073 Ga0307409_1000150732 156
232 3300031995 Ga0307409_100112176 Ga0307409_1001121762 156
233 3300031995 Ga0307409_101147565 Ga0307409_1011475651 156
234 3300032002 Ga0307416_100080432 Ga0307416_1000804322 156
235 3300032004 Ga0307414_10028632 Ga0307414_100286322 156
236 3300032005 Ga0307411_10114846 Ga0307411_101148461 156
237 3300032005 Ga0307411_10835430 Ga0307411_108354301 156
238 3300032005 Ga0307411_10989249 Ga0307411_109892492 156
239 3300032126 Ga0307415_100039530 Ga0307415_1000395304 156
240 3300033179 Ga0307507_10319028 Ga0307507_103190282 156
241 3300033180 Ga0307510_10032222 Ga0307510_100322223 156
242 3300033180 Ga0307510_10036007 Ga0307510_100360074 156
243 3300033180 Ga0307510_10102227 Ga0307510_101022272 156
244 3300033180 Ga0307510_10354242 Ga0307510_103542422 156
245 3300034957 Ga0373938_0034261 Ga0373938_0034261_318_854 156
246 3300035084 Ga0373928_0046618 Ga0373928_0046618_245_790 156
247 3300036401 Ga0373937_0847408 Ga0373937_0847408_209_751 156
248 3300037471 Ga0395905_0163392 Ga0395905_0163392_1125_1631 156
249 3300037471 Ga0395905_0169731 Ga0395905_0169731_511_1017 156
250 3300041460 Ga0451802_1818719 Ga0451802_1818719_184_729 156
251 3300041486 Ga0451807_1905397 Ga0451807_1905397_146_634 156
252 3300041494 Ga0451837_1548583 Ga0451837_1548583_31_567 156
253 3300041503 Ga0451847_0510527 Ga0451847_0510527_195_728 156
254 3300042001 Ga0439441_019829 Ga0439441_019829_692_1210 156
255 3300042126 Ga0450888_056834 Ga0450888_056834_65_553 156
256 3300042876 Ga0451577_0433035 Ga0451577_0433035_380_928 156
257 3300044712 Ga0453684_0020258 Ga0453684_0020258_8574_9119 156
258 3300044712 Ga0453684_0075261 Ga0453684_0075261_2162_2710 156
259 3300046454 Ga0495592_0005413 Ga0495592_0005413_8247_8792 156
260 3300046460 Ga0495638_0035681 Ga0495638_0035681_509_1054 156
261 3300046473 Ga0495582_0265260 Ga0495582_0265260_98_640 156
262 3300046474 Ga0495605_0377282 Ga0495605_0377282_11_499 156
263 3300046512 Ga0495610_0236135 Ga0495610_0236135_173_718 156
264 3300046512 Ga0495610_0310795 Ga0495610_0310795_29_562 156
265 3300046519 Ga0495632_0004080 Ga0495632_0004080_3201_3689 156
266 3300046526 Ga0495666_0028509 Ga0495666_0028509_45_587 156
267 3300046539 Ga0495621_0000186 Ga0495621_0000186_8471_8962 156
268 3300046539 Ga0495621_0013043 Ga0495621_0013043_1140_1631 156
269 3300046616 Ga0495668_0129102 Ga0495668_0129102_593_1081 156
270 3300046660 Ga0495625_0059298 Ga0495625_0059298_1241_1786 156
271 3300046660 Ga0495625_0283802 Ga0495625_0283802_267_755 156
272 3300046690 Ga0495624_0094567 Ga0495624_0094567_336_878 156
273 3300046692 Ga0495671_0040228 Ga0495671_0040228_1451_2008 156
274 3300046694 Ga0495649_0008664 Ga0495649_0008664_2774_3262 156
275 3300046810 Ga0495660_0072989 Ga0495660_0072989_241_729 156
276 3300049575 Ga0501039_0295246 Ga0501039_0295246_144_692 156
277 3300050489 nmdc:mga03683_22922_c1 nmdc:mga03683_22922_c1_13_501 156
278 3300050489 nmdc:mga03683_98030_c1 nmdc:mga03683_98030_c1_364_909 156
279 3300050491 nmdc:mga00v17_44553_c1 nmdc:mga00v17_44553_c1_1130_1618 156
280 3300050492 nmdc:mga0yw44_322280_c1 nmdc:mga0yw44_322280_c1_244_732 156
281 3300050493 nmdc:mga0k408_1070_c2 nmdc:mga0k408_1070_c2_218_706 156
282 3300050493 nmdc:mga0k408_121579_c1 nmdc:mga0k408_121579_c1_679_1236 156
283 3300050493 nmdc:mga0k408_1281_c1 nmdc:mga0k408_1281_c1_751_1293 156
284 3300050493 nmdc:mga0k408_140895_c1 nmdc:mga0k408_140895_c1_363_851 156
285 3300050493 nmdc:mga0k408_1749_c1 nmdc:mga0k408_1749_c1_7082_7570 156
286 3300050493 nmdc:mga0k408_200775_c1 nmdc:mga0k408_200775_c1_45_533 156
287 3300050493 nmdc:mga0k408_267279_c1 nmdc:mga0k408_267279_c1_330_800 156
288 3300050493 nmdc:mga0k408_299925_c1 nmdc:mga0k408_299925_c1_118_609 156
289 3300050493 nmdc:mga0k408_330_c1 nmdc:mga0k408_330_c1_7515_8051 156
290 3300050493 nmdc:mga0k408_34111_c1 nmdc:mga0k408_34111_c1_346_834 156
291 3300050493 nmdc:mga0k408_365678_c1 nmdc:mga0k408_365678_c1_218_706 156
292 3300050493 nmdc:mga0k408_64903_c1 nmdc:mga0k408_64903_c1_154_699 156
293 3300050493 nmdc:mga0k408_7031_c1 nmdc:mga0k408_7031_c1_4261_4749 156
294 3300050493 nmdc:mga0k408_96421_c1 nmdc:mga0k408_96421_c1_1017_1553 156
295 3300050494 nmdc:mga06z11_233954_c1 nmdc:mga06z11_233954_c1_212_754 156
296 3300050494 nmdc:mga06z11_274049_c1 nmdc:mga06z11_274049_c1_133_621 156
297 3300050494 nmdc:mga06z11_4773_c1 nmdc:mga06z11_4773_c1_1832_2320 156
298 3300050494 nmdc:mga06z11_59827_c1 nmdc:mga06z11_59827_c1_412_900 156
299 3300050495 nmdc:mga04h51_79888_c1 nmdc:mga04h51_79888_c1_660_1148 156
300 3300050496 nmdc:mga07m45_191_c1 nmdc:mga07m45_191_c1_15755_16243 156
301 3300050496 nmdc:mga07m45_20994_c1 nmdc:mga07m45_20994_c1_91_579 156
302 3300050496 nmdc:mga07m45_214690_c1 nmdc:mga07m45_214690_c1_458_1003 156
303 3300050496 nmdc:mga07m45_38159_c1 nmdc:mga07m45_38159_c1_1016_1504 156
304 3300050496 nmdc:mga07m45_56421_c1 nmdc:mga07m45_56421_c1_1421_1966 156
305 3300050496 nmdc:mga07m45_6895_c1 nmdc:mga07m45_6895_c1_5123_5611 156
306 3300050508 nmdc:mga09592_93741_c1 nmdc:mga09592_93741_c1_683_1219 156
307 3300050516 nmdc:mga0sz30_10145_c1 nmdc:mga0sz30_10145_c1_2835_3323 156
308 3300053087 Ga0500643_031271 Ga0500643_031271_173_718 156
309 3300053088 Ga0500644_0031695 Ga0500644_0031695_132_677 156
310 3300053118 Ga0500594_0000801 Ga0500594_0000801_5406_5951 156
311 3300053131 Ga0500652_143249 Ga0500652_143249_118_663 156
312 3300053136 Ga0500559_0000069 Ga0500559_0000069_39989_40534 156
313 3300053137 Ga0500561_0057483 Ga0500561_0057483_432_920 156
314 3300053139 Ga0500568_0032110 Ga0500568_0032110_386_883 156
315 3300053148 Ga0500590_133961 Ga0500590_133961_266_802 156
316 3300053151 Ga0500604_0101367 Ga0500604_0101367_227_760 156
317 3300053153 Ga0500616_0247885 Ga0500616_0247885_113_670 156
318 3300053154 Ga0500619_114382 Ga0500619_114382_161_706 156
319 3300053155 Ga0500620_062191 Ga0500620_062191_186_731 156
320 3300053156 Ga0500622_0000881 Ga0500622_0000881_21381_21926 156
321 3300053158 Ga0500627_0289148 Ga0500627_0289148_109_597 156
322 3300053177 Ga0500636_0094060 Ga0500636_0094060_217_762 156
323 3300006186 Ga0075369_10020121 Ga0075369_100201213 157
324 3300006195 Ga0075366_10012503 Ga0075366_100125032 157
325 3300006353 Ga0075370_10148512 Ga0075370_101485122 157
326 3300025910 Ga0207684_10009174 Ga0207684_100091749 157
327 3300050493 nmdc:mga0k408_422444_c1 nmdc:mga0k408_422444_c1_71_574 157
328 3300003323 rootH1_10026771 rootH1_100267712 158
329 3300025903 Ga0207680_10261044 Ga0207680_102610442 158
330 3300026078 Ga0207702_10371156 Ga0207702_103711562 158
331 3300035121 Ga0373960_0037144 Ga0373960_0037144_675_1226 158
332 3300035691 Ga0373931_0023509 Ga0373931_0023509_195_671 158
333 3300037068 Ga0373925_0086709 Ga0373925_0086709_1502_2053 158
334 3300039447 Ga0436361_0152229 Ga0436361_0152229_956_1432 158
335 3300048088 Ga0495602_0131355 Ga0495602_0131355_247_798 158
336 3300048903 Ga0496100_0311308 Ga0496100_0311308_233_784 158
337 3300002705 JGI25156J39149_1013855 JGI25156J39149_10138552 159
338 3300002738 JGI25154J39366_1001787 JGI25154J39366_10017874 159
339 3300002741 JGI25157J39369_1000423 JGI25157J39369_10004235 159
340 3300003320 rootH2_10169528 rootH2_101695282 159
341 3300003322 rootL2_10036206 rootL2_100362063 159
342 3300003323 rootH1_10003718 rootH1_1000371817 159
343 3300003323 rootH1_10026770 rootH1_100267702 159
344 3300003752 Ga0055539_1000267 Ga0055539_100026717 159
345 3300003752 Ga0055539_1000525 Ga0055539_10005255 159
346 3300003756 Ga0055533_1000006 Ga0055533_1000006160 159
347 3300003759 Ga0055525_1000601 Ga0055525_100060115 159
348 3300003761 Ga0055535_1000702 Ga0055535_100070219 159
349 3300003763 Ga0055529_1000340 Ga0055529_10003409 159
350 3300005327 Ga0070658_10097061 Ga0070658_100970612 159
351 3300005327 Ga0070658_10295208 Ga0070658_102952082 159
352 3300005327 Ga0070658_10328567 Ga0070658_103285672 159
353 3300005328 Ga0070676_10640023 Ga0070676_106400232 159
354 3300005329 Ga0070683_100671548 Ga0070683_1006715482 159
355 3300005339 Ga0070660_100142558 Ga0070660_1001425582 159
356 3300005339 Ga0070660_100837147 Ga0070660_1008371471 159
357 3300005344 Ga0070661_100385840 Ga0070661_1003858402 159
358 3300005364 Ga0070673_100011292 Ga0070673_1000112926 159
359 3300005365 Ga0070688_100266194 Ga0070688_1002661942 159
360 3300005366 Ga0070659_100167470 Ga0070659_1001674702 159
361 3300005366 Ga0070659_100183360 Ga0070659_1001833602 159
362 3300005456 Ga0070678_100757317 Ga0070678_1007573172 159
363 3300005459 Ga0068867_100677035 Ga0068867_1006770351 159
364 3300005530 Ga0070679_101491795 Ga0070679_1014917951 159
365 3300005563 Ga0068855_100476231 Ga0068855_1004762312 159
366 3300005563 Ga0068855_100523959 Ga0068855_1005239591 159
367 3300005577 Ga0068857_100003384 Ga0068857_10000338411 159
368 3300005614 Ga0068856_100001919 Ga0068856_1000019199 159
369 3300005616 Ga0068852_100166880 Ga0068852_1001668803 159
370 3300005719 Ga0068861_100074016 Ga0068861_1000740161 159
371 3300005834 Ga0068851_10728585 Ga0068851_107285851 159
372 3300005841 Ga0068863_100935149 Ga0068863_1009351492 159
373 3300005843 Ga0068860_100371627 Ga0068860_1003716272 159
374 3300006195 Ga0075366_10010092 Ga0075366_100100927 159
375 3300009093 Ga0105240_10092549 Ga0105240_100925493 159
376 3300009093 Ga0105240_10785485 Ga0105240_107854852 159
377 3300009174 Ga0105241_10101254 Ga0105241_101012543 159
378 3300009176 Ga0105242_10099559 Ga0105242_100995592 159
379 3300009545 Ga0105237_10198589 Ga0105237_101985892 159
380 3300009551 Ga0105238_10067050 Ga0105238_100670502 159
381 3300010375 Ga0105239_10072130 Ga0105239_100721302 159
382 3300011119 Ga0105246_10081657 Ga0105246_100816573 159
383 3300013296 Ga0157374_10205798 Ga0157374_102057983 159
384 3300013307 Ga0157372_10143169 Ga0157372_101431692 159
385 3300013308 Ga0157375_10735771 Ga0157375_107357712 159
386 3300014968 Ga0157379_11313108 Ga0157379_113131081 159
387 3300025226 Ga0209674_100003 Ga0209674_1000031177 159
388 3300025230 Ga0209563_100010 Ga0209563_100010905 159
389 3300025230 Ga0209563_115978 Ga0209563_1159782 159
390 3300025231 Ga0207427_100190 Ga0207427_10019034 159
391 3300025242 Ga0209258_100060 Ga0209258_10006099 159
392 3300025242 Ga0209258_101561 Ga0209258_1015616 159
393 3300025246 Ga0209646_1000376 Ga0209646_10003766 159
394 3300025250 Ga0209026_1000179 Ga0209026_100017985 159
395 3300025253 Ga0209677_100026 Ga0209677_10002630 159
396 3300025253 Ga0209677_100784 Ga0209677_1007844 159
397 3300025253 Ga0209677_107536 Ga0209677_1075362 159
398 3300025256 Ga0209759_1000196 Ga0209759_100019685 159
399 3300025256 Ga0209759_1003221 Ga0209759_10032212 159
400 3300025256 Ga0209759_1003576 Ga0209759_10035764 159
401 3300025256 Ga0209759_1005886 Ga0209759_10058864 159
402 3300025256 Ga0209759_1019941 Ga0209759_10199412 159
403 3300025272 Ga0209455_1000093 Ga0209455_1000093139 159
404 3300025909 Ga0207705_10255094 Ga0207705_102550942 159
405 3300025911 Ga0207654_10027444 Ga0207654_100274442 159
406 3300025913 Ga0207695_10039555 Ga0207695_100395555 159
407 3300025919 Ga0207657_10028816 Ga0207657_100288163 159
408 3300025919 Ga0207657_10234138 Ga0207657_102341382 159
409 3300025920 Ga0207649_10293852 Ga0207649_102938522 159
410 3300025924 Ga0207694_10074907 Ga0207694_100749072 159
411 3300025931 Ga0207644_10986828 Ga0207644_109868282 159
412 3300025932 Ga0207690_10080985 Ga0207690_100809853 159
413 3300025932 Ga0207690_11097229 Ga0207690_110972291 159
414 3300025934 Ga0207686_10467042 Ga0207686_104670422 159
415 3300025938 Ga0207704_10237941 Ga0207704_102379412 159
416 3300025949 Ga0207667_10003358 Ga0207667_100033582 159
417 3300025949 Ga0207667_11434044 Ga0207667_114340442 159
418 3300025960 Ga0207651_10031751 Ga0207651_100317512 159
419 3300025981 Ga0207640_10124302 Ga0207640_101243022 159
420 3300026041 Ga0207639_10142983 Ga0207639_101429831 159
421 3300026041 Ga0207639_10820593 Ga0207639_108205932 159
422 3300026067 Ga0207678_10427405 Ga0207678_104274052 159
423 3300026078 Ga0207702_10000199 Ga0207702_1000019965 159
424 3300026089 Ga0207648_10377104 Ga0207648_103771043 159
425 3300026116 Ga0207674_10006359 Ga0207674_100063596 159
426 3300026118 Ga0207675_100052849 Ga0207675_1000528496 159
427 3300026121 Ga0207683_10231379 Ga0207683_102313792 159
428 3300028381 Ga0268264_10367530 Ga0268264_103675302 159
429 3300028666 Ga0265336_10000012 Ga0265336_10000012228 159
430 3300030521 Ga0307511_10072563 Ga0307511_100725632 159
431 3300031730 Ga0307516_10002378 Ga0307516_1000237825 159
432 3300034820 Ga0373959_0001904 Ga0373959_0001904_2339_2818 159
433 3300035086 Ga0373934_0015101 Ga0373934_0015101_2020_2499 159
434 3300037466 Ga0395898_0248339 Ga0395898_0248339_1008_1487 159
435 3300038443 Ga0395901_0003991 Ga0395901_0003991_1251_1730 159
436 3300044694 Ga0466963_0411779 Ga0466963_0411779_26_505 159
437 3300046454 Ga0495592_0339698 Ga0495592_0339698_140_619 159
438 3300046471 Ga0495650_0020058 Ga0495650_0020058_1964_2443 159
439 3300046506 Ga0495583_0001275 Ga0495583_0001275_5314_5793 159
440 3300046507 Ga0495606_0003090 Ga0495606_0003090_873_1352 159
441 3300046511 Ga0495608_0852606 Ga0495608_0852606_12_491 159
442 3300046616 Ga0495668_0075573 Ga0495668_0075573_353_832 159
443 3300046660 Ga0495625_0031998 Ga0495625_0031998_978_1457 159
444 3300046684 Ga0495669_0052625 Ga0495669_0052625_568_1047 159
445 3300046694 Ga0495649_0003769 Ga0495649_0003769_5313_5792 159
446 3300046794 Ga0495589_0086306 Ga0495589_0086306_867_1346 159
447 3300047323 Ga0495683_0283304 Ga0495683_0283304_146_625 159
448 3300048903 Ga0496100_0766972 Ga0496100_0766972_262_741 159
449 3300049160 Ga0501304_000171 Ga0501304_000171_1392_1889 159
450 3300049531 Ga0501315_004286 Ga0501315_004286_680_1177 159
451 3300049686 Ga0501257_095970 Ga0501257_095970_192_689 159
452 3300050493 nmdc:mga0k408_8999_c1 nmdc:mga0k408_8999_c1_2893_3372 159
453 3300053080 Ga0500635_0000096 Ga0500635_0000096_23559_24038 159
454 3300053093 Ga0500651_0027673 Ga0500651_0027673_1034_1513 159
455 3300053136 Ga0500559_0005362 Ga0500559_0005362_4587_5066 159
456 3300053138 Ga0500564_185344 Ga0500564_185344_106_585 159
457 3300053154 Ga0500619_153973 Ga0500619_153973_64_543 159
458 3300055283 Ga0500661_019784 Ga0500661_019784_345_824 159
459 3300005340 Ga0070689_101481545 Ga0070689_1014815451 160
460 3300005459 Ga0068867_100132918 Ga0068867_1001329182 160
461 3300013306 Ga0163162_10478387 Ga0163162_104783872 160
462 3300025303 Ga0209051_1003055 Ga0209051_100305511 160
463 3300026089 Ga0207648_10068060 Ga0207648_100680603 160
464 3300042876 Ga0451577_0052147 Ga0451577_0052147_405_887 160
465 3300003771 Ga0055526_1004906 Ga0055526_10049064 161
466 3300006195 Ga0075366_10219297 Ga0075366_102192972 161
467 3300006353 Ga0075370_10402648 Ga0075370_104026482 161
468 3300025295 Ga0209564_1000051 Ga0209564_1000051160 161
469 3300037471 Ga0395905_0248303 Ga0395905_0248303_931_1434 161
470 3300049127 Ga0501306_016425 Ga0501306_016425_303_806 161
471 3300005616 Ga0068852_101073753 Ga0068852_1010737532 162
472 3300026142 Ga0207698_10778213 Ga0207698_107782132 162
473 3300031730 Ga0307516_10266315 Ga0307516_102663152 162
474 3300002705 JGI25156J39149_1011916 JGI25156J39149_10119162 165
475 3300025228 Ga0209672_106548 Ga0209672_1065482 165
476 3300025254 Ga0209148_1010057 Ga0209148_10100573 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06073

DUF934

Bacterial protein of unknown function (DUF934)

56

164

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uqg-assembly2.cif.gz_G crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p200 0.808 50 128
5uqh-assembly2.cif.gz_G crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p182 0.807 50 128
5urq-assembly2.cif.gz_F crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p176 0.807 50 128
5uqg-assembly1.cif.gz_D crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p200 0.8058 50 128
5uqh-assembly1.cif.gz_B crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p182 0.8048 50 128
ID Description Score Start End Superfamily
3r2gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7472 31 128 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7405 32 141 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7334 32 142 3.20.20.70
af_Q9GZH3_19_534_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7287 50 128 3.20.20.70
3gnnA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7144 40 133 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A382FJS1-F1-model_v4 DUF934 domain-containing protein 0.9585 33 110
AF-A0A5C7JJR4-F1-model_v4 deleted 0.9448 61 143
AF-A0A160JE19-F1-model_v4 DUF934 domain-containing protein 0.933 15 145
AF-A0A1W6MZ42-F1-model_v4 Oxidoreductase 0.9319 15 144
AF-A0A7Y3IVL2-F1-model_v4 DUF934 domain-containing protein 0.9276 15 145

Feature Viewer

pLDDT pTM Quality
86.97 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map