F451545
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 476 | 285 | 474 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10001814|Ga0265327_100018148 |
| Length | 168 |
| Sequence | MKFIDPHHDQWRTVGGEDGPMSHPPIKSYSLLTLGQWHAVREQWPAQGSADYKPVGVILPNDTDIEVLEADTAKLALVVLQFPKWVDGRAYSQAHILRARYRFTGEIRATGEVLVDMMPLLARSGFDAVALRSDQDRAAAERALGFFAARGHYQGDIKVTKPVFGRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 2 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 3 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 173 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 196 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 206 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 210 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 211 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 212 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 213 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 214 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 215 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 216 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 256 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 257 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 258 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 259 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 260 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 261 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 262 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 266 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 267 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 268 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 269 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 270 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 271 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 272 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 273 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 274 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 276 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 277 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 278 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 279 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 280 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 281 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 282 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 283 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 285 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.53 |
| Metatranscriptomes | 0.84 |
| Isolates | 0.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.84 |
| Nodule | 0.63 |
| Rhizoplane | 1.47 |
| Rhizosphere | 61.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1011916 | 3300002705 | Bacteria | 1944 |
| 2 | JGI25156J39149_1013855 | 3300002705 | Bacteria | 1691 |
| 3 | JGI25154J39366_1001787 | 3300002738 | Bacteria | 6771 |
| 4 | JGI25157J39369_1000423 | 3300002741 | Bacteria | 27882 |
| 5 | Ga0006778J45830_1110127 | 3300003162 | Bacteria | 1064 |
| 6 | rootH1_10015183 | 3300003316 | Bacteria | 1597 |
| 7 | rootH1_10041378 | 3300003316 | Bacteria | 1902 |
| 8 | rootH2_10002555 | 3300003320 | Bacteria | 1751 |
| 9 | rootH2_10169528 | 3300003320 | Bacteria | 1788 |
| 10 | rootL2_10000073 | 3300003322 | Bacteria | 23640 |
| 11 | rootL2_10036206 | 3300003322 | Bacteria | 1383 |
| 12 | rootH1_10003718 | 3300003323 | Bacteria | 13571 |
| 13 | rootH1_10026770 | 3300003323 | Bacteria | 1255 |
| 14 | rootH1_10026771 | 3300003316 | Bacteria | 4380 |
| 15 | rootH1_10026771 | 3300003323 | Bacteria | 1416 |
| 16 | rootH1_10045867 | 3300003323 | Bacteria | 1838 |
| 17 | rootH1_10045868 | 3300003323 | Bacteria | 2301 |
| 18 | Ga0055539_1000267 | 3300003752 | Bacteria | 31502 |
| 19 | Ga0055539_1000525 | 3300003752 | Bacteria | 11716 |
| 20 | Ga0055533_1000006 | 3300003756 | Bacteria | 635559 |
| 21 | Ga0055525_1000601 | 3300003759 | Bacteria | 15226 |
| 22 | Ga0055535_1000702 | 3300003761 | Bacteria | 25845 |
| 23 | Ga0055529_1000340 | 3300003763 | Bacteria | 52215 |
| 24 | Ga0055526_1004906 | 3300003771 | Bacteria | 7870 |
| 25 | Ga0055524_1009872 | 3300003775 | Bacteria | 3843 |
| 26 | Ga0055528_1064815 | 3300003790 | Bacteria | 677 |
| 27 | Ga0055531_10019970 | 3300003794 | Bacteria | 2676 |
| 28 | Ga0055543_1003950 | 3300004625 | Bacteria | 4185 |
| 29 | Ga0065165_1000390 | 3300005262 | Bacteria | 71262 |
| 30 | Ga0070658_10097061 | 3300005327 | Bacteria | 2433 |
| 31 | Ga0070658_10295208 | 3300005327 | Bacteria | 1381 |
| 32 | Ga0070658_10328567 | 3300005327 | Bacteria | 1306 |
| 33 | Ga0070676_10640023 | 3300005328 | Bacteria | 771 |
| 34 | Ga0070683_100671548 | 3300005329 | Bacteria | 992 |
| 35 | Ga0070670_100001786 | 3300005331 | Bacteria | 17507 |
| 36 | Ga0070670_100210937 | 3300005331 | Bacteria | 1689 |
| 37 | Ga0070670_100533812 | 3300005331 | Bacteria | 1045 |
| 38 | Ga0070670_100736829 | 3300005331 | Bacteria | 888 |
| 39 | Ga0070677_10039887 | 3300005333 | Bacteria | 1845 |
| 40 | Ga0070677_10182410 | 3300005333 | Bacteria | 1001 |
| 41 | Ga0068869_100105058 | 3300005334 | Bacteria | 2141 |
| 42 | Ga0070666_10240595 | 3300005335 | Bacteria | 1280 |
| 43 | Ga0068868_100199964 | 3300005338 | Bacteria | 1665 |
| 44 | Ga0070660_100142558 | 3300005339 | Bacteria | 1923 |
| 45 | Ga0070660_100837147 | 3300005339 | Bacteria | 775 |
| 46 | Ga0070689_101481545 | 3300005340 | Bacteria | 614 |
| 47 | Ga0070661_100385840 | 3300005344 | Bacteria | 1105 |
| 48 | Ga0070668_101637773 | 3300005347 | Bacteria | 590 |
| 49 | Ga0070669_100048889 | 3300005353 | Bacteria | 3087 |
| 50 | Ga0070675_100007685 | 3300005354 | Bacteria | 8344 |
| 51 | Ga0070671_100013507 | 3300005355 | Bacteria | 6584 |
| 52 | Ga0070671_100019824 | 3300005355 | Bacteria | 5479 |
| 53 | Ga0070671_100060692 | 3300005355 | Bacteria | 3148 |
| 54 | Ga0070674_100004831 | 3300005356 | Bacteria | 7724 |
| 55 | Ga0070673_100011292 | 3300005364 | Bacteria | 6090 |
| 56 | Ga0070673_100020575 | 3300005364 | Bacteria | 4760 |
| 57 | Ga0070688_100266194 | 3300005365 | Bacteria | 1226 |
| 58 | Ga0070659_100167470 | 3300005366 | Bacteria | 1798 |
| 59 | Ga0070659_100183360 | 3300005366 | Bacteria | 1718 |
| 60 | Ga0070659_100919373 | 3300005366 | Bacteria | 765 |
| 61 | Ga0070667_100029603 | 3300005367 | Bacteria | 4564 |
| 62 | Ga0070667_100515321 | 3300005367 | Bacteria | 1097 |
| 63 | Ga0070667_100590155 | 3300005367 | Bacteria | 1023 |
| 64 | Ga0070708_100207663 | 3300005445 | Bacteria | 1835 |
| 65 | Ga0070663_100001001 | 3300005455 | Bacteria | 15402 |
| 66 | Ga0070678_100002432 | 3300005456 | Bacteria | 10201 |
| 67 | Ga0070678_100120155 | 3300005456 | Bacteria | 2071 |
| 68 | Ga0070678_100757317 | 3300005456 | Bacteria | 879 |
| 69 | Ga0070662_100739125 | 3300005457 | Bacteria | 834 |
| 70 | Ga0068867_100000228 | 3300005459 | Bacteria | 36773 |
| 71 | Ga0068867_100003245 | 3300005459 | Bacteria | 11462 |
| 72 | Ga0068867_100021071 | 3300005459 | Bacteria | 4649 |
| 73 | Ga0068867_100107262 | 3300005459 | Bacteria | 2141 |
| 74 | Ga0068867_100132918 | 3300005459 | Bacteria | 1936 |
| 75 | Ga0068867_100313200 | 3300005459 | Bacteria | 1298 |
| 76 | Ga0068867_100413139 | 3300005459 | Bacteria | 1141 |
| 77 | Ga0068867_100677035 | 3300005459 | Bacteria | 908 |
| 78 | Ga0070685_10497497 | 3300005466 | Bacteria | 862 |
| 79 | Ga0070706_100009701 | 3300005467 | Bacteria | 8948 |
| 80 | Ga0070706_100418157 | 3300005467 | Bacteria | 1248 |
| 81 | Ga0070707_100017523 | 3300005468 | Bacteria | 6735 |
| 82 | Ga0070698_100330885 | 3300005471 | Bacteria | 1454 |
| 83 | Ga0070699_101289782 | 3300005518 | Bacteria | 670 |
| 84 | Ga0070679_101491795 | 3300005530 | Bacteria | 623 |
| 85 | Ga0070684_100610654 | 3300005535 | Bacteria | 1014 |
| 86 | Ga0070672_100000447 | 3300005543 | Bacteria | 24121 |
| 87 | Ga0070665_100024775 | 3300005548 | Bacteria | 6045 |
| 88 | Ga0070665_101108138 | 3300005548 | Bacteria | 803 |
| 89 | Ga0068855_100476231 | 3300005563 | Bacteria | 1359 |
| 90 | Ga0068855_100523959 | 3300005563 | Bacteria | 1285 |
| 91 | Ga0070664_100110974 | 3300005564 | Bacteria | 2394 |
| 92 | Ga0070664_100536579 | 3300005564 | Bacteria | 1081 |
| 93 | Ga0068857_100003384 | 3300005577 | Bacteria | 13274 |
| 94 | Ga0068857_100044181 | 3300005577 | Bacteria | 3951 |
| 95 | Ga0068857_100059339 | 3300005577 | Bacteria | 3398 |
| 96 | Ga0068857_100464525 | 3300005577 | Bacteria | 1185 |
| 97 | Ga0068857_101328908 | 3300005577 | Bacteria | 698 |
| 98 | Ga0068854_100176847 | 3300005578 | Bacteria | 1664 |
| 99 | Ga0068854_100213648 | 3300005578 | Bacteria | 1523 |
| 100 | Ga0068856_100001919 | 3300005614 | Bacteria | 21672 |
| 101 | Ga0068852_100166880 | 3300005616 | Bacteria | 2060 |
| 102 | Ga0068852_101073753 | 3300005616 | Bacteria | 825 |
| 103 | Ga0068852_101436971 | 3300005616 | Bacteria | 712 |
| 104 | Ga0068864_100126434 | 3300005618 | Bacteria | 2291 |
| 105 | Ga0068861_100074016 | 3300005719 | Bacteria | 2648 |
| 106 | Ga0068851_10728585 | 3300005834 | Bacteria | 612 |
| 107 | Ga0068863_100935149 | 3300005841 | Bacteria | 868 |
| 108 | Ga0068860_100371627 | 3300005843 | Bacteria | 1410 |
| 109 | Ga0075365_10015895 | 3300006038 | Bacteria | 4561 |
| 110 | Ga0075365_10221757 | 3300006038 | Bacteria | 1327 |
| 111 | Ga0075368_10003121 | 3300006042 | Bacteria | 5496 |
| 112 | Ga0075364_10142406 | 3300006051 | Bacteria | 1613 |
| 113 | Ga0075364_10239470 | 3300006051 | Bacteria | 1232 |
| 114 | Ga0075362_10091752 | 3300006177 | Bacteria | 1410 |
| 115 | Ga0075362_10129360 | 3300006177 | Bacteria | 1199 |
| 116 | Ga0075362_10183687 | 3300006177 | Bacteria | 1014 |
| 117 | Ga0075362_10355605 | 3300006177 | Bacteria | 734 |
| 118 | Ga0075367_10112326 | 3300006178 | Bacteria | 1673 |
| 119 | Ga0075367_10180367 | 3300006178 | Bacteria | 1317 |
| 120 | Ga0075367_10307310 | 3300006178 | Bacteria | 998 |
| 121 | Ga0075369_10020121 | 3300006186 | Bacteria | 2731 |
| 122 | Ga0075369_10160409 | 3300006186 | Bacteria | 1031 |
| 123 | Ga0075366_10010092 | 3300006195 | Bacteria | 5292 |
| 124 | Ga0075366_10012503 | 3300006195 | Bacteria | 4815 |
| 125 | Ga0075366_10018606 | 3300006195 | Bacteria | 4013 |
| 126 | Ga0075366_10149629 | 3300006195 | Bacteria | 1413 |
| 127 | Ga0075366_10167581 | 3300006195 | Bacteria | 1332 |
| 128 | Ga0075366_10186227 | 3300006195 | Bacteria | 1261 |
| 129 | Ga0075366_10212211 | 3300006195 | Bacteria | 1178 |
| 130 | Ga0075366_10219297 | 3300006195 | Bacteria | 1159 |
| 131 | Ga0075366_10267645 | 3300006195 | Bacteria | 1044 |
| 132 | Ga0075366_10306821 | 3300006195 | Bacteria | 971 |
| 133 | Ga0097621_100231666 | 3300006237 | Bacteria | 1613 |
| 134 | Ga0097621_101090090 | 3300006237 | Bacteria | 749 |
| 135 | Ga0075370_10009411 | 3300006353 | Bacteria | 5072 |
| 136 | Ga0075370_10013131 | 3300006353 | Bacteria | 4395 |
| 137 | Ga0075370_10013927 | 3300006353 | Bacteria | 4280 |
| 138 | Ga0075370_10086242 | 3300006353 | Bacteria | 1808 |
| 139 | Ga0075370_10148512 | 3300006353 | Bacteria | 1373 |
| 140 | Ga0075370_10307043 | 3300006353 | Bacteria | 944 |
| 141 | Ga0075370_10332219 | 3300006353 | Bacteria | 906 |
| 142 | Ga0075370_10402648 | 3300006353 | Bacteria | 821 |
| 143 | Ga0075429_100002218 | 3300006880 | Bacteria | 16266 |
| 144 | Ga0068865_100368041 | 3300006881 | Bacteria | 1169 |
| 145 | Ga0099823_1000211 | 3300006944 | Bacteria | 32728 |
| 146 | Ga0105240_10092549 | 3300009093 | Bacteria | 3691 |
| 147 | Ga0105240_10240449 | 3300009093 | Bacteria | 2099 |
| 148 | Ga0105240_10785485 | 3300009093 | Bacteria | 1032 |
| 149 | Ga0111539_10926720 | 3300009094 | Bacteria | 1013 |
| 150 | Ga0105245_10382210 | 3300009098 | Bacteria | 1402 |
| 151 | Ga0105245_10615974 | 3300009098 | Bacteria | 1113 |
| 152 | Ga0114129_10121124 | 3300009147 | Bacteria | 3601 |
| 153 | Ga0105243_10001277 | 3300009148 | Bacteria | 22593 |
| 154 | Ga0105243_10148061 | 3300009148 | Bacteria | 2011 |
| 155 | Ga0105241_10101254 | 3300009174 | Bacteria | 2290 |
| 156 | Ga0105241_10122629 | 3300009174 | Bacteria | 2095 |
| 157 | Ga0105242_10099559 | 3300009176 | Bacteria | 2461 |
| 158 | Ga0105248_10666813 | 3300009177 | Bacteria | 1173 |
| 159 | Ga0105237_10034988 | 3300009545 | Bacteria | 5084 |
| 160 | Ga0105237_10198589 | 3300009545 | Bacteria | 2005 |
| 161 | Ga0105238_10067050 | 3300009551 | Bacteria | 3590 |
| 162 | Ga0105239_10072130 | 3300010375 | Bacteria | 3795 |
| 163 | Ga0105246_10081657 | 3300011119 | Bacteria | 2305 |
| 164 | Ga0105246_10114725 | 3300011119 | Bacteria | 1985 |
| 165 | Ga0157319_1000003 | 3300012497 | Bacteria | 397199 |
| 166 | Ga0157374_10205798 | 3300013296 | Bacteria | 1928 |
| 167 | Ga0157374_10314228 | 3300013296 | Bacteria | 1552 |
| 168 | Ga0163162_10478387 | 3300013306 | Bacteria | 1377 |
| 169 | Ga0157372_10143169 | 3300013307 | Bacteria | 2756 |
| 170 | Ga0157375_10735771 | 3300013308 | Bacteria | 1138 |
| 171 | Ga0157375_10974406 | 3300013308 | Bacteria | 989 |
| 172 | Ga0163163_10222645 | 3300014325 | Bacteria | 1936 |
| 173 | Ga0157380_10263698 | 3300014326 | Bacteria | 1566 |
| 174 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 175 | Ga0157379_11313108 | 3300014968 | Bacteria | 699 |
| 176 | Ga0157376_10115189 | 3300014969 | Bacteria | 2373 |
| 177 | Ga0163161_10011249 | 3300017792 | Bacteria | 6200 |
| 178 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 179 | Ga0209672_106548 | 3300025228 | Bacteria | 1881 |
| 180 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 181 | Ga0209563_115978 | 3300025230 | Bacteria | 932 |
| 182 | Ga0207427_100190 | 3300025231 | Bacteria | 61601 |
| 183 | Ga0209258_100060 | 3300025242 | Bacteria | 319881 |
| 184 | Ga0209258_101561 | 3300025242 | Bacteria | 7659 |
| 185 | Ga0209646_1000376 | 3300025246 | Bacteria | 28912 |
| 186 | Ga0209026_1000179 | 3300025250 | Bacteria | 95680 |
| 187 | Ga0209677_100026 | 3300025253 | Bacteria | 382520 |
| 188 | Ga0209677_100784 | 3300025253 | Bacteria | 15983 |
| 189 | Ga0209677_107536 | 3300025253 | Bacteria | 2288 |
| 190 | Ga0209148_1010057 | 3300025254 | Bacteria | 1812 |
| 191 | Ga0209759_1000196 | 3300025256 | Bacteria | 95680 |
| 192 | Ga0209759_1003221 | 3300025256 | Bacteria | 6608 |
| 193 | Ga0209759_1003576 | 3300025256 | Bacteria | 6140 |
| 194 | Ga0209759_1005886 | 3300025256 | Bacteria | 4196 |
| 195 | Ga0209759_1019941 | 3300025256 | Bacteria | 1573 |
| 196 | Ga0209455_1000093 | 3300025272 | Bacteria | 220487 |
| 197 | Ga0209673_1034259 | 3300025273 | Bacteria | 1537 |
| 198 | Ga0209673_1050517 | 3300025273 | Bacteria | 1104 |
| 199 | Ga0209564_1000051 | 3300025295 | Bacteria | 357748 |
| 200 | Ga0209050_1005005 | 3300025298 | Bacteria | 8612 |
| 201 | Ga0209256_1000675 | 3300025299 | Bacteria | 46128 |
| 202 | Ga0209051_1003055 | 3300025303 | Bacteria | 11322 |
| 203 | Ga0209051_1016986 | 3300025303 | Bacteria | 3267 |
| 204 | Ga0209257_1005336 | 3300025304 | Bacteria | 9099 |
| 205 | Ga0207656_10044454 | 3300025321 | Bacteria | 1897 |
| 206 | Ga0207682_10034010 | 3300025893 | Bacteria | 2054 |
| 207 | Ga0207682_10041355 | 3300025893 | Bacteria | 1881 |
| 208 | Ga0207688_10047704 | 3300025901 | Bacteria | 2391 |
| 209 | Ga0207688_10207409 | 3300025901 | Bacteria | 1177 |
| 210 | Ga0207680_10261044 | 3300025903 | Bacteria | 1199 |
| 211 | Ga0207645_10021528 | 3300025907 | Bacteria | 4204 |
| 212 | Ga0207705_10255094 | 3300025909 | Bacteria | 1338 |
| 213 | Ga0207684_10009174 | 3300025910 | Bacteria | 8752 |
| 214 | Ga0207654_10027444 | 3300025911 | Bacteria | 3094 |
| 215 | Ga0207695_10039555 | 3300025913 | Bacteria | 5068 |
| 216 | Ga0207671_10025887 | 3300025914 | Bacteria | 4402 |
| 217 | Ga0207657_10028816 | 3300025919 | Bacteria | 5059 |
| 218 | Ga0207657_10234138 | 3300025919 | Bacteria | 1468 |
| 219 | Ga0207649_10167693 | 3300025920 | Bacteria | 1527 |
| 220 | Ga0207649_10293852 | 3300025920 | Bacteria | 1186 |
| 221 | Ga0207681_10029245 | 3300025923 | Bacteria | 3577 |
| 222 | Ga0207681_10043404 | 3300025923 | Bacteria | 3009 |
| 223 | Ga0207694_10074907 | 3300025924 | Bacteria | 2649 |
| 224 | Ga0207650_10000783 | 3300025925 | Bacteria | 24484 |
| 225 | Ga0207650_10447239 | 3300025925 | Bacteria | 1075 |
| 226 | Ga0207659_10000307 | 3300025926 | Bacteria | 29582 |
| 227 | Ga0207659_10734972 | 3300025926 | Bacteria | 846 |
| 228 | Ga0207687_10050006 | 3300025927 | Bacteria | 2909 |
| 229 | Ga0207644_10055496 | 3300025931 | Bacteria | 2855 |
| 230 | Ga0207644_10232255 | 3300025931 | Bacteria | 1466 |
| 231 | Ga0207644_10986828 | 3300025931 | Bacteria | 707 |
| 232 | Ga0207690_10080985 | 3300025932 | Bacteria | 2267 |
| 233 | Ga0207690_11097229 | 3300025932 | Bacteria | 663 |
| 234 | Ga0207706_10394857 | 3300025933 | Bacteria | 1200 |
| 235 | Ga0207686_10467042 | 3300025934 | Bacteria | 973 |
| 236 | Ga0207709_10001251 | 3300025935 | Bacteria | 18257 |
| 237 | Ga0207709_10262342 | 3300025935 | Bacteria | 1267 |
| 238 | Ga0207669_10002758 | 3300025937 | Bacteria | 7535 |
| 239 | Ga0207704_10237941 | 3300025938 | Bacteria | 1358 |
| 240 | Ga0207691_10003997 | 3300025940 | Bacteria | 14303 |
| 241 | Ga0207691_10070487 | 3300025940 | Bacteria | 3156 |
| 242 | Ga0207711_10553013 | 3300025941 | Bacteria | 1073 |
| 243 | Ga0207689_10074348 | 3300025942 | Bacteria | 2792 |
| 244 | Ga0207679_10130612 | 3300025945 | Bacteria | 2014 |
| 245 | Ga0207679_10237132 | 3300025945 | Bacteria | 1543 |
| 246 | Ga0207667_10003358 | 3300025949 | Bacteria | 19745 |
| 247 | Ga0207667_11434044 | 3300025949 | Bacteria | 663 |
| 248 | Ga0207651_10031751 | 3300025960 | Bacteria | 3381 |
| 249 | Ga0207651_10032204 | 3300025960 | Bacteria | 3364 |
| 250 | Ga0207668_10194305 | 3300025972 | Bacteria | 1611 |
| 251 | Ga0207668_10925331 | 3300025972 | Bacteria | 777 |
| 252 | Ga0207640_10056317 | 3300025981 | Bacteria | 2580 |
| 253 | Ga0207640_10124302 | 3300025981 | Bacteria | 1855 |
| 254 | Ga0207640_10452058 | 3300025981 | Bacteria | 1059 |
| 255 | Ga0207640_10456509 | 3300025981 | Bacteria | 1054 |
| 256 | Ga0207658_10052703 | 3300025986 | Bacteria | 3003 |
| 257 | Ga0207658_10232903 | 3300025986 | Bacteria | 1556 |
| 258 | Ga0207639_10142367 | 3300026041 | Bacteria | 1999 |
| 259 | Ga0207639_10142983 | 3300026041 | Bacteria | 1995 |
| 260 | Ga0207639_10820593 | 3300026041 | Bacteria | 867 |
| 261 | Ga0207678_10001091 | 3300026067 | Bacteria | 24903 |
| 262 | Ga0207678_10237941 | 3300026067 | Bacteria | 1559 |
| 263 | Ga0207678_10255305 | 3300026067 | Bacteria | 1502 |
| 264 | Ga0207678_10427405 | 3300026067 | Bacteria | 1149 |
| 265 | Ga0207702_10000199 | 3300026078 | Bacteria | 70834 |
| 266 | Ga0207702_10371156 | 3300026078 | Bacteria | 1374 |
| 267 | Ga0207648_10000598 | 3300026089 | Bacteria | 40545 |
| 268 | Ga0207648_10008882 | 3300026089 | Bacteria | 9674 |
| 269 | Ga0207648_10030699 | 3300026089 | Bacteria | 4757 |
| 270 | Ga0207648_10068060 | 3300026089 | Bacteria | 3103 |
| 271 | Ga0207648_10131309 | 3300026089 | Bacteria | 2205 |
| 272 | Ga0207648_10377104 | 3300026089 | Bacteria | 1282 |
| 273 | Ga0207676_10133919 | 3300026095 | Bacteria | 2111 |
| 274 | Ga0207676_11055197 | 3300026095 | Bacteria | 802 |
| 275 | Ga0207674_10006359 | 3300026116 | Bacteria | 13907 |
| 276 | Ga0207674_10057633 | 3300026116 | Bacteria | 3937 |
| 277 | Ga0207674_10242910 | 3300026116 | Bacteria | 1748 |
| 278 | Ga0207674_10741448 | 3300026116 | Bacteria | 948 |
| 279 | Ga0207675_100052849 | 3300026118 | Bacteria | 3790 |
| 280 | Ga0207683_10001684 | 3300026121 | Bacteria | 19770 |
| 281 | Ga0207683_10173488 | 3300026121 | Bacteria | 1953 |
| 282 | Ga0207683_10231379 | 3300026121 | Bacteria | 1686 |
| 283 | Ga0207698_10778213 | 3300026142 | Bacteria | 958 |
| 284 | Ga0209389_1023716 | 3300027296 | Bacteria | 5405 |
| 285 | Ga0209371_1031621 | 3300027312 | Bacteria | 1146 |
| 286 | Ga0209971_1102796 | 3300027682 | Bacteria | 700 |
| 287 | Ga0209813_10001967 | 3300027866 | Bacteria | 4645 |
| 288 | Ga0268266_10084814 | 3300028379 | Bacteria | 2767 |
| 289 | Ga0268266_10313008 | 3300028379 | Bacteria | 1467 |
| 290 | Ga0268264_10367530 | 3300028381 | Bacteria | 1374 |
| 291 | Ga0265336_10000012 | 3300028666 | Bacteria | 261478 |
| 292 | Ga0307517_10000150 | 3300028786 | Bacteria | 110446 |
| 293 | Ga0307517_10148113 | 3300028786 | Bacteria | 1621 |
| 294 | Ga0307517_10229311 | 3300028786 | Bacteria | 1117 |
| 295 | Ga0307517_10339013 | 3300028786 | Bacteria | 822 |
| 296 | Ga0307515_10048427 | 3300028794 | Bacteria | 6426 |
| 297 | Ga0307515_10374035 | 3300028794 | Bacteria | 1060 |
| 298 | Ga0268256_1023218 | 3300030500 | Bacteria | 1614 |
| 299 | Ga0307511_10072563 | 3300030521 | Bacteria | 2499 |
| 300 | Ga0307512_10012395 | 3300030522 | Bacteria | 8045 |
| 301 | Ga0307512_10291968 | 3300030522 | Bacteria | 768 |
| 302 | Ga0265328_10030177 | 3300031239 | Bacteria | 2020 |
| 303 | Ga0265327_10001814 | 3300031251 | Bacteria | 25001 |
| 304 | Ga0307509_10002837 | 3300031507 | Bacteria | 27455 |
| 305 | Ga0307509_10011064 | 3300031507 | Bacteria | 10987 |
| 306 | Ga0307509_10017922 | 3300031507 | Bacteria | 8131 |
| 307 | Ga0307509_10384121 | 3300031507 | Bacteria | 1116 |
| 308 | Ga0307408_100100040 | 3300031548 | Bacteria | 2207 |
| 309 | Ga0307408_100124347 | 3300031548 | Bacteria | 2003 |
| 310 | Ga0307508_10001937 | 3300031616 | Bacteria | 22703 |
| 311 | Ga0307508_10002030 | 3300031616 | Bacteria | 21943 |
| 312 | Ga0307508_10188802 | 3300031616 | Bacteria | 1662 |
| 313 | Ga0307514_10181140 | 3300031649 | Bacteria | 1358 |
| 314 | Ga0307514_10273342 | 3300031649 | Bacteria | 975 |
| 315 | Ga0307516_10002378 | 3300031730 | Bacteria | 25205 |
| 316 | Ga0307516_10266315 | 3300031730 | Bacteria | 1402 |
| 317 | Ga0307516_10562740 | 3300031730 | Bacteria | 794 |
| 318 | Ga0307405_10014843 | 3300031731 | Bacteria | 4202 |
| 319 | Ga0307413_10033011 | 3300031824 | Bacteria | 2941 |
| 320 | Ga0307413_10061552 | 3300031824 | Bacteria | 2317 |
| 321 | Ga0307410_10098224 | 3300031852 | Bacteria | 2094 |
| 322 | Ga0307406_10291521 | 3300031901 | Bacteria | 1249 |
| 323 | Ga0307407_10051492 | 3300031903 | Bacteria | 2361 |
| 324 | Ga0307412_10279276 | 3300031911 | Bacteria | 1310 |
| 325 | Ga0307409_100015073 | 3300031995 | Bacteria | 5056 |
| 326 | Ga0307409_100112176 | 3300031995 | Bacteria | 2289 |
| 327 | Ga0307409_101147565 | 3300031995 | Bacteria | 799 |
| 328 | Ga0307416_100080432 | 3300032002 | Bacteria | 2751 |
| 329 | Ga0307414_10028632 | 3300032004 | Bacteria | 3616 |
| 330 | Ga0307411_10114846 | 3300032005 | Bacteria | 1935 |
| 331 | Ga0307411_10835430 | 3300032005 | Bacteria | 814 |
| 332 | Ga0307411_10989249 | 3300032005 | Bacteria | 752 |
| 333 | Ga0307415_100039530 | 3300032126 | Bacteria | 3119 |
| 334 | Ga0307507_10319028 | 3300033179 | Bacteria | 937 |
| 335 | Ga0307510_10032222 | 3300033180 | Bacteria | 5906 |
| 336 | Ga0307510_10036007 | 3300033180 | Bacteria | 5516 |
| 337 | Ga0307510_10102227 | 3300033180 | Bacteria | 2649 |
| 338 | Ga0307510_10354242 | 3300033180 | Bacteria | 917 |
| 339 | Ga0373959_0001904 | 3300034820 | Bacteria | 3332 |
| 340 | Ga0373938_0034261 | 3300034957 | Bacteria | 1102 |
| 341 | Ga0373928_0046618 | 3300035084 | Bacteria | 1012 |
| 342 | Ga0373934_0015101 | 3300035086 | Bacteria | 2927 |
| 343 | Ga0373960_0037144 | 3300035121 | Bacteria | 1391 |
| 344 | Ga0373931_0023509 | 3300035691 | Bacteria | 3112 |
| 345 | Ga0373937_0847408 | 3300036401 | Bacteria | 862 |
| 346 | Ga0373925_0086709 | 3300037068 | Bacteria | 2389 |
| 347 | Ga0395898_0248339 | 3300037466 | Bacteria | 1697 |
| 348 | Ga0395905_0163392 | 3300037471 | Bacteria | 2092 |
| 349 | Ga0395905_0169731 | 3300037471 | Bacteria | 2049 |
| 350 | Ga0395905_0248303 | 3300037471 | Bacteria | 1662 |
| 351 | Ga0395901_0003991 | 3300038443 | Bacteria | 14856 |
| 352 | Ga0436361_0152229 | 3300039447 | Bacteria | 2211 |
| 353 | Ga0451800_1299428 | 3300041459 | Bacteria | 722 |
| 354 | Ga0451802_1818719 | 3300041460 | Bacteria | 863 |
| 355 | Ga0451807_1905397 | 3300041486 | Bacteria | 804 |
| 356 | Ga0451837_1548583 | 3300041494 | Bacteria | 617 |
| 357 | Ga0451847_0510527 | 3300041503 | Bacteria | 919 |
| 358 | Ga0439441_019829 | 3300042001 | Bacteria | 1227 |
| 359 | Ga0439443_046792 | 3300042003 | Bacteria | 750 |
| 360 | Ga0450888_056834 | 3300042126 | Bacteria | 569 |
| 361 | Ga0450890_004077 | 3300042127 | Bacteria | 1917 |
| 362 | Ga0439458_0017606 | 3300042157 | Bacteria | 1634 |
| 363 | Ga0439459_0004944 | 3300042438 | Bacteria | 2169 |
| 364 | Ga0451577_0052147 | 3300042876 | Bacteria | 3652 |
| 365 | Ga0451577_0433035 | 3300042876 | Bacteria | 1194 |
| 366 | Ga0466963_0411779 | 3300044694 | Bacteria | 953 |
| 367 | Ga0466963_0448302 | 3300044694 | Bacteria | 910 |
| 368 | Ga0466964_0032134 | 3300044706 | Bacteria | 2085 |
| 369 | Ga0453684_0020258 | 3300044712 | Bacteria | 10051 |
| 370 | Ga0453684_0075261 | 3300044712 | Bacteria | 4245 |
| 371 | Ga0451576_1975545 | 3300045051 | Bacteria | 601 |
| 372 | Ga0495592_0005413 | 3300046454 | Bacteria | 9423 |
| 373 | Ga0495592_0339698 | 3300046454 | Bacteria | 966 |
| 374 | Ga0495638_0035681 | 3300046460 | Bacteria | 3169 |
| 375 | Ga0495638_0064276 | 3300046460 | Bacteria | 2261 |
| 376 | Ga0495650_0020058 | 3300046471 | Bacteria | 3270 |
| 377 | Ga0495582_0265260 | 3300046473 | Bacteria | 985 |
| 378 | Ga0495605_0377282 | 3300046474 | Bacteria | 592 |
| 379 | Ga0495583_0001275 | 3300046506 | Bacteria | 26345 |
| 380 | Ga0495606_0003090 | 3300046507 | Bacteria | 18134 |
| 381 | Ga0495608_0852606 | 3300046511 | Bacteria | 535 |
| 382 | Ga0495610_0236135 | 3300046512 | Bacteria | 731 |
| 383 | Ga0495610_0310795 | 3300046512 | Bacteria | 605 |
| 384 | Ga0495618_0332562 | 3300046514 | Bacteria | 939 |
| 385 | Ga0495632_0004080 | 3300046519 | Bacteria | 10076 |
| 386 | Ga0495648_0207484 | 3300046524 | Bacteria | 976 |
| 387 | Ga0495666_0028509 | 3300046526 | Bacteria | 2747 |
| 388 | Ga0495652_1037751 | 3300046529 | Bacteria | 535 |
| 389 | Ga0495621_0000186 | 3300046539 | Bacteria | 14274 |
| 390 | Ga0495621_0013043 | 3300046539 | Bacteria | 2605 |
| 391 | Ga0495668_0075573 | 3300046616 | Bacteria | 1850 |
| 392 | Ga0495668_0129102 | 3300046616 | Bacteria | 1384 |
| 393 | Ga0495625_0031998 | 3300046660 | Bacteria | 3907 |
| 394 | Ga0495625_0059298 | 3300046660 | Bacteria | 2716 |
| 395 | Ga0495625_0283802 | 3300046660 | Bacteria | 1064 |
| 396 | Ga0495669_0052625 | 3300046684 | Bacteria | 1830 |
| 397 | Ga0495624_0094567 | 3300046690 | Bacteria | 1842 |
| 398 | Ga0495671_0040228 | 3300046692 | Bacteria | 2358 |
| 399 | Ga0495649_0003769 | 3300046694 | Bacteria | 10057 |
| 400 | Ga0495649_0008664 | 3300046694 | Bacteria | 6107 |
| 401 | Ga0495589_0086306 | 3300046794 | Bacteria | 1524 |
| 402 | Ga0495660_0072989 | 3300046810 | Bacteria | 1816 |
| 403 | Ga0495683_0283304 | 3300047323 | Bacteria | 717 |
| 404 | Ga0495686_0005311 | 3300047472 | Bacteria | 10208 |
| 405 | Ga0495602_0131355 | 3300048088 | Bacteria | 1996 |
| 406 | Ga0496100_0311308 | 3300048903 | Bacteria | 1181 |
| 407 | Ga0496100_0766972 | 3300048903 | Bacteria | 755 |
| 408 | Ga0496109_0093655 | 3300048912 | Bacteria | 2780 |
| 409 | Ga0496110_0047518 | 3300048913 | Bacteria | 3759 |
| 410 | Ga0501306_016425 | 3300049127 | Bacteria | 994 |
| 411 | Ga0501304_000171 | 3300049160 | Bacteria | 2763 |
| 412 | Ga0501315_004286 | 3300049531 | Bacteria | 1485 |
| 413 | Ga0501039_0295246 | 3300049575 | Bacteria | 1274 |
| 414 | Ga0501257_095970 | 3300049686 | Bacteria | 775 |
| 415 | nmdc:mga03683_22922_c1 | 3300050489 | Bacteria | 2426 |
| 416 | nmdc:mga03683_98030_c1 | 3300050489 | Bacteria | 1285 |
| 417 | nmdc:mga00v17_44553_c1 | 3300050491 | Bacteria | 2676 |
| 418 | nmdc:mga0yw44_322280_c1 | 3300050492 | Bacteria | 1038 |
| 419 | nmdc:mga0k408_1070_c2 | 3300050493 | Bacteria | 9350 |
| 420 | nmdc:mga0k408_121579_c1 | 3300050493 | Bacteria | 1546 |
| 421 | nmdc:mga0k408_1281_c1 | 3300050493 | Bacteria | 13618 |
| 422 | nmdc:mga0k408_140895_c1 | 3300050493 | Bacteria | 1435 |
| 423 | nmdc:mga0k408_1749_c1 | 3300050493 | Bacteria | 11633 |
| 424 | nmdc:mga0k408_200775_c1 | 3300050493 | Bacteria | 1190 |
| 425 | nmdc:mga0k408_267279_c1 | 3300050493 | Bacteria | 1021 |
| 426 | nmdc:mga0k408_299925_c1 | 3300050493 | Bacteria | 959 |
| 427 | nmdc:mga0k408_330_c1 | 3300050493 | Bacteria | 25941 |
| 428 | nmdc:mga0k408_34111_c1 | 3300050493 | Bacteria | 2913 |
| 429 | nmdc:mga0k408_365678_c1 | 3300050493 | Bacteria | 860 |
| 430 | nmdc:mga0k408_422444_c1 | 3300050493 | Bacteria | 793 |
| 431 | nmdc:mga0k408_57281_c1 | 3300050493 | Bacteria | 2262 |
| 432 | nmdc:mga0k408_64903_c1 | 3300050493 | Bacteria | 2125 |
| 433 | nmdc:mga0k408_7031_c1 | 3300050493 | Bacteria | 6007 |
| 434 | nmdc:mga0k408_8999_c1 | 3300050493 | Bacteria | 5372 |
| 435 | nmdc:mga0k408_96421_c1 | 3300050493 | Bacteria | 1741 |
| 436 | nmdc:mga06z11_233954_c1 | 3300050494 | Bacteria | 1077 |
| 437 | nmdc:mga06z11_274049_c1 | 3300050494 | Bacteria | 998 |
| 438 | nmdc:mga06z11_4773_c1 | 3300050494 | Bacteria | 5363 |
| 439 | nmdc:mga06z11_59827_c1 | 3300050494 | Bacteria | 1981 |
| 440 | nmdc:mga04h51_79888_c1 | 3300050495 | Bacteria | 1159 |
| 441 | nmdc:mga07m45_191_c1 | 3300050496 | Bacteria | 24330 |
| 442 | nmdc:mga07m45_20994_c1 | 3300050496 | Bacteria | 3552 |
| 443 | nmdc:mga07m45_214690_c1 | 3300050496 | Bacteria | 1119 |
| 444 | nmdc:mga07m45_3609_c1 | 3300050496 | Bacteria | 7474 |
| 445 | nmdc:mga07m45_38159_c1 | 3300050496 | Bacteria | 2681 |
| 446 | nmdc:mga07m45_56421_c1 | 3300050496 | Bacteria | 2220 |
| 447 | nmdc:mga07m45_6895_c1 | 3300050496 | Bacteria | 5778 |
| 448 | nmdc:mga05p37_60728_c1 | 3300050507 | Bacteria | 4653 |
| 449 | nmdc:mga09592_93741_c1 | 3300050508 | Bacteria | 2568 |
| 450 | nmdc:mga0sz30_10145_c1 | 3300050516 | Bacteria | 3603 |
| 451 | nmdc:mga0sz30_498484_c1 | 3300050516 | Bacteria | 548 |
| 452 | Ga0500635_0000096 | 3300053080 | Bacteria | 53378 |
| 453 | Ga0500643_031271 | 3300053087 | Bacteria | 1625 |
| 454 | Ga0500644_0031695 | 3300053088 | Bacteria | 1683 |
| 455 | Ga0500651_0027673 | 3300053093 | Bacteria | 3566 |
| 456 | Ga0500593_000112 | 3300053117 | Bacteria | 31359 |
| 457 | Ga0500594_0000801 | 3300053118 | Bacteria | 6704 |
| 458 | Ga0500652_143249 | 3300053131 | Bacteria | 994 |
| 459 | Ga0500559_0000069 | 3300053136 | Bacteria | 82288 |
| 460 | Ga0500559_0005362 | 3300053136 | Bacteria | 5905 |
| 461 | Ga0500561_0057483 | 3300053137 | Bacteria | 1080 |
| 462 | Ga0500564_185344 | 3300053138 | Bacteria | 865 |
| 463 | Ga0500568_0032110 | 3300053139 | Bacteria | 2160 |
| 464 | Ga0500590_133961 | 3300053148 | Bacteria | 1142 |
| 465 | Ga0500604_0101367 | 3300053151 | Bacteria | 949 |
| 466 | Ga0500616_0247885 | 3300053153 | Bacteria | 762 |
| 467 | Ga0500619_114382 | 3300053154 | Bacteria | 919 |
| 468 | Ga0500619_153973 | 3300053154 | Bacteria | 781 |
| 469 | Ga0500620_062191 | 3300053155 | Bacteria | 1273 |
| 470 | Ga0500622_0000881 | 3300053156 | Bacteria | 25562 |
| 471 | Ga0500622_0002736 | 3300053156 | Bacteria | 12446 |
| 472 | Ga0500627_0289148 | 3300053158 | Bacteria | 718 |
| 473 | Ga0500636_0094060 | 3300053177 | Bacteria | 1713 |
| 474 | Ga0500661_019784 | 3300055283 | Bacteria | 1198 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_1975545 | Ga0451576_1975545_23_481 | 132 |
| 2 | 3300046514 | Ga0495618_0332562 | Ga0495618_0332562_440_916 | 136 |
| 3 | 3300046524 | Ga0495648_0207484 | Ga0495648_0207484_455_931 | 136 |
| 4 | 3300046529 | Ga0495652_1037751 | Ga0495652_1037751_28_507 | 136 |
| 5 | 3300050516 | nmdc:mga0sz30_498484_c1 | nmdc:mga0sz30_498484_c1_16_492 | 136 |
| 6 | 3300014326 | Ga0157380_10263698 | Ga0157380_102636982 | 142 |
| 7 | 3300041459 | Ga0451800_1299428 | Ga0451800_1299428_158_655 | 150 |
| 8 | 3300003316 | rootH1_10015183 | rootH1_100151832 | 151 |
| 9 | 3300005445 | Ga0070708_100207663 | Ga0070708_1002076632 | 151 |
| 10 | 3300005467 | Ga0070706_100009701 | Ga0070706_1000097012 | 151 |
| 11 | 3300005468 | Ga0070707_100017523 | Ga0070707_1000175232 | 151 |
| 12 | 3300005471 | Ga0070698_100330885 | Ga0070698_1003308852 | 151 |
| 13 | 3300005518 | Ga0070699_101289782 | Ga0070699_1012897821 | 151 |
| 14 | 3300042157 | Ga0439458_0017606 | Ga0439458_0017606_512_985 | 151 |
| 15 | iso_pu_bacteria | 2831864461 | 2831866060 | 151 |
| 16 | iso_pu_bacteria | 2886848708 | 2886851528 | 151 |
| 17 | iso_pu_bacteria | 2643221660 | 2644340030 | 152 |
| 18 | 3300003316 | rootH1_10041378 | rootH1_100413783 | 153 |
| 19 | 3300003320 | rootH2_10002555 | rootH2_100025553 | 153 |
| 20 | 3300003322 | rootL2_10000073 | rootL2_100000732 | 153 |
| 21 | 3300003323 | rootH1_10045867 | rootH1_100458672 | 153 |
| 22 | 3300009147 | Ga0114129_10121124 | Ga0114129_101211242 | 154 |
| 23 | 3300047472 | Ga0495686_0005311 | Ga0495686_0005311_5946_6422 | 154 |
| 24 | 3300048912 | Ga0496109_0093655 | Ga0496109_0093655_2135_2620 | 154 |
| 25 | 3300048913 | Ga0496110_0047518 | Ga0496110_0047518_2757_3242 | 154 |
| 26 | 3300050507 | nmdc:mga05p37_60728_c1 | nmdc:mga05p37_60728_c1_2564_3046 | 154 |
| 27 | 3300003323 | rootH1_10045868 | rootH1_100458682 | 155 |
| 28 | 3300003775 | Ga0055524_1009872 | Ga0055524_10098722 | 155 |
| 29 | 3300003790 | Ga0055528_1064815 | Ga0055528_10648152 | 155 |
| 30 | 3300003794 | Ga0055531_10019970 | Ga0055531_100199702 | 155 |
| 31 | 3300004625 | Ga0055543_1003950 | Ga0055543_10039502 | 155 |
| 32 | 3300005262 | Ga0065165_1000390 | Ga0065165_100039016 | 155 |
| 33 | 3300005466 | Ga0070685_10497497 | Ga0070685_104974971 | 155 |
| 34 | 3300005535 | Ga0070684_100610654 | Ga0070684_1006106542 | 155 |
| 35 | 3300006195 | Ga0075366_10018606 | Ga0075366_100186065 | 155 |
| 36 | 3300006353 | Ga0075370_10013131 | Ga0075370_100131314 | 155 |
| 37 | 3300006944 | Ga0099823_1000211 | Ga0099823_10002117 | 155 |
| 38 | 3300012497 | Ga0157319_1000003 | Ga0157319_1000003293 | 155 |
| 39 | 3300025273 | Ga0209673_1034259 | Ga0209673_10342592 | 155 |
| 40 | 3300025273 | Ga0209673_1050517 | Ga0209673_10505172 | 155 |
| 41 | 3300025298 | Ga0209050_1005005 | Ga0209050_10050055 | 155 |
| 42 | 3300025299 | Ga0209256_1000675 | Ga0209256_100067539 | 155 |
| 43 | 3300025303 | Ga0209051_1016986 | Ga0209051_10169862 | 155 |
| 44 | 3300025304 | Ga0209257_1005336 | Ga0209257_10053367 | 155 |
| 45 | 3300027296 | Ga0209389_1023716 | Ga0209389_10237162 | 155 |
| 46 | 3300027312 | Ga0209371_1031621 | Ga0209371_10316212 | 155 |
| 47 | 3300030500 | Ga0268256_1023218 | Ga0268256_10232182 | 155 |
| 48 | 3300031548 | Ga0307408_100100040 | Ga0307408_1001000402 | 155 |
| 49 | 3300042003 | Ga0439443_046792 | Ga0439443_046792_13_522 | 155 |
| 50 | 3300042127 | Ga0450890_004077 | Ga0450890_004077_436_945 | 155 |
| 51 | 3300042438 | Ga0439459_0004944 | Ga0439459_0004944_684_1193 | 155 |
| 52 | 3300044694 | Ga0466963_0448302 | Ga0466963_0448302_147_656 | 155 |
| 53 | 3300044706 | Ga0466964_0032134 | Ga0466964_0032134_1321_1830 | 155 |
| 54 | 3300046460 | Ga0495638_0064276 | Ga0495638_0064276_1371_1871 | 155 |
| 55 | 3300050493 | nmdc:mga0k408_57281_c1 | nmdc:mga0k408_57281_c1_262_771 | 155 |
| 56 | 3300050496 | nmdc:mga07m45_3609_c1 | nmdc:mga07m45_3609_c1_1877_2386 | 155 |
| 57 | 3300053117 | Ga0500593_000112 | Ga0500593_000112_1068_1592 | 155 |
| 58 | 3300053156 | Ga0500622_0002736 | Ga0500622_0002736_3208_3717 | 155 |
| 59 | 3300003162 | Ga0006778J45830_1110127 | Ga0006778J45830_11101271 | 156 |
| 60 | 3300005331 | Ga0070670_100001786 | Ga0070670_10000178611 | 156 |
| 61 | 3300005331 | Ga0070670_100210937 | Ga0070670_1002109372 | 156 |
| 62 | 3300005331 | Ga0070670_100533812 | Ga0070670_1005338122 | 156 |
| 63 | 3300005331 | Ga0070670_100736829 | Ga0070670_1007368291 | 156 |
| 64 | 3300005333 | Ga0070677_10039887 | Ga0070677_100398872 | 156 |
| 65 | 3300005333 | Ga0070677_10182410 | Ga0070677_101824102 | 156 |
| 66 | 3300005334 | Ga0068869_100105058 | Ga0068869_1001050582 | 156 |
| 67 | 3300005335 | Ga0070666_10240595 | Ga0070666_102405952 | 156 |
| 68 | 3300005338 | Ga0068868_100199964 | Ga0068868_1001999641 | 156 |
| 69 | 3300005347 | Ga0070668_101637773 | Ga0070668_1016377731 | 156 |
| 70 | 3300005353 | Ga0070669_100048889 | Ga0070669_1000488894 | 156 |
| 71 | 3300005354 | Ga0070675_100007685 | Ga0070675_1000076858 | 156 |
| 72 | 3300005355 | Ga0070671_100013507 | Ga0070671_1000135074 | 156 |
| 73 | 3300005355 | Ga0070671_100019824 | Ga0070671_1000198243 | 156 |
| 74 | 3300005355 | Ga0070671_100060692 | Ga0070671_1000606922 | 156 |
| 75 | 3300005356 | Ga0070674_100004831 | Ga0070674_1000048314 | 156 |
| 76 | 3300005364 | Ga0070673_100020575 | Ga0070673_1000205753 | 156 |
| 77 | 3300005366 | Ga0070659_100919373 | Ga0070659_1009193731 | 156 |
| 78 | 3300005367 | Ga0070667_100029603 | Ga0070667_1000296032 | 156 |
| 79 | 3300005367 | Ga0070667_100515321 | Ga0070667_1005153212 | 156 |
| 80 | 3300005367 | Ga0070667_100590155 | Ga0070667_1005901552 | 156 |
| 81 | 3300005455 | Ga0070663_100001001 | Ga0070663_10000100114 | 156 |
| 82 | 3300005456 | Ga0070678_100002432 | Ga0070678_1000024329 | 156 |
| 83 | 3300005456 | Ga0070678_100120155 | Ga0070678_1001201552 | 156 |
| 84 | 3300005457 | Ga0070662_100739125 | Ga0070662_1007391251 | 156 |
| 85 | 3300005459 | Ga0068867_100000228 | Ga0068867_10000022821 | 156 |
| 86 | 3300005459 | Ga0068867_100003245 | Ga0068867_1000032453 | 156 |
| 87 | 3300005459 | Ga0068867_100021071 | Ga0068867_1000210713 | 156 |
| 88 | 3300005459 | Ga0068867_100107262 | Ga0068867_1001072622 | 156 |
| 89 | 3300005459 | Ga0068867_100313200 | Ga0068867_1003132001 | 156 |
| 90 | 3300005459 | Ga0068867_100413139 | Ga0068867_1004131391 | 156 |
| 91 | 3300005467 | Ga0070706_100418157 | Ga0070706_1004181572 | 156 |
| 92 | 3300005543 | Ga0070672_100000447 | Ga0070672_10000044711 | 156 |
| 93 | 3300005548 | Ga0070665_100024775 | Ga0070665_1000247755 | 156 |
| 94 | 3300005548 | Ga0070665_101108138 | Ga0070665_1011081382 | 156 |
| 95 | 3300005564 | Ga0070664_100110974 | Ga0070664_1001109742 | 156 |
| 96 | 3300005564 | Ga0070664_100536579 | Ga0070664_1005365792 | 156 |
| 97 | 3300005577 | Ga0068857_100044181 | Ga0068857_1000441812 | 156 |
| 98 | 3300005577 | Ga0068857_100059339 | Ga0068857_1000593392 | 156 |
| 99 | 3300005577 | Ga0068857_100464525 | Ga0068857_1004645252 | 156 |
| 100 | 3300005577 | Ga0068857_101328908 | Ga0068857_1013289082 | 156 |
| 101 | 3300005578 | Ga0068854_100176847 | Ga0068854_1001768472 | 156 |
| 102 | 3300005578 | Ga0068854_100213648 | Ga0068854_1002136482 | 156 |
| 103 | 3300005616 | Ga0068852_101436971 | Ga0068852_1014369711 | 156 |
| 104 | 3300005618 | Ga0068864_100126434 | Ga0068864_1001264343 | 156 |
| 105 | 3300006038 | Ga0075365_10015895 | Ga0075365_100158954 | 156 |
| 106 | 3300006038 | Ga0075365_10221757 | Ga0075365_102217572 | 156 |
| 107 | 3300006042 | Ga0075368_10003121 | Ga0075368_100031214 | 156 |
| 108 | 3300006051 | Ga0075364_10142406 | Ga0075364_101424062 | 156 |
| 109 | 3300006051 | Ga0075364_10239470 | Ga0075364_102394702 | 156 |
| 110 | 3300006177 | Ga0075362_10091752 | Ga0075362_100917522 | 156 |
| 111 | 3300006177 | Ga0075362_10129360 | Ga0075362_101293602 | 156 |
| 112 | 3300006177 | Ga0075362_10183687 | Ga0075362_101836872 | 156 |
| 113 | 3300006177 | Ga0075362_10355605 | Ga0075362_103556051 | 156 |
| 114 | 3300006178 | Ga0075367_10112326 | Ga0075367_101123262 | 156 |
| 115 | 3300006178 | Ga0075367_10180367 | Ga0075367_101803672 | 156 |
| 116 | 3300006178 | Ga0075367_10307310 | Ga0075367_103073102 | 156 |
| 117 | 3300006186 | Ga0075369_10160409 | Ga0075369_101604092 | 156 |
| 118 | 3300006195 | Ga0075366_10149629 | Ga0075366_101496292 | 156 |
| 119 | 3300006195 | Ga0075366_10167581 | Ga0075366_101675812 | 156 |
| 120 | 3300006195 | Ga0075366_10186227 | Ga0075366_101862272 | 156 |
| 121 | 3300006195 | Ga0075366_10212211 | Ga0075366_102122111 | 156 |
| 122 | 3300006195 | Ga0075366_10267645 | Ga0075366_102676452 | 156 |
| 123 | 3300006195 | Ga0075366_10306821 | Ga0075366_103068212 | 156 |
| 124 | 3300006237 | Ga0097621_100231666 | Ga0097621_1002316662 | 156 |
| 125 | 3300006237 | Ga0097621_101090090 | Ga0097621_1010900901 | 156 |
| 126 | 3300006353 | Ga0075370_10009411 | Ga0075370_100094115 | 156 |
| 127 | 3300006353 | Ga0075370_10013927 | Ga0075370_100139272 | 156 |
| 128 | 3300006353 | Ga0075370_10086242 | Ga0075370_100862423 | 156 |
| 129 | 3300006353 | Ga0075370_10307043 | Ga0075370_103070432 | 156 |
| 130 | 3300006353 | Ga0075370_10332219 | Ga0075370_103322192 | 156 |
| 131 | 3300006880 | Ga0075429_100002218 | Ga0075429_10000221811 | 156 |
| 132 | 3300006881 | Ga0068865_100368041 | Ga0068865_1003680412 | 156 |
| 133 | 3300009093 | Ga0105240_10240449 | Ga0105240_102404492 | 156 |
| 134 | 3300009094 | Ga0111539_10926720 | Ga0111539_109267202 | 156 |
| 135 | 3300009098 | Ga0105245_10382210 | Ga0105245_103822102 | 156 |
| 136 | 3300009098 | Ga0105245_10615974 | Ga0105245_106159742 | 156 |
| 137 | 3300009148 | Ga0105243_10001277 | Ga0105243_100012772 | 156 |
| 138 | 3300009148 | Ga0105243_10148061 | Ga0105243_101480612 | 156 |
| 139 | 3300009174 | Ga0105241_10122629 | Ga0105241_101226292 | 156 |
| 140 | 3300009177 | Ga0105248_10666813 | Ga0105248_106668132 | 156 |
| 141 | 3300009545 | Ga0105237_10034988 | Ga0105237_100349884 | 156 |
| 142 | 3300011119 | Ga0105246_10114725 | Ga0105246_101147252 | 156 |
| 143 | 3300013296 | Ga0157374_10314228 | Ga0157374_103142282 | 156 |
| 144 | 3300013308 | Ga0157375_10974406 | Ga0157375_109744062 | 156 |
| 145 | 3300014325 | Ga0163163_10222645 | Ga0163163_102226453 | 156 |
| 146 | 3300014745 | Ga0157377_10000016 | Ga0157377_1000001610 | 156 |
| 147 | 3300014969 | Ga0157376_10115189 | Ga0157376_101151892 | 156 |
| 148 | 3300017792 | Ga0163161_10011249 | Ga0163161_100112492 | 156 |
| 149 | 3300025321 | Ga0207656_10044454 | Ga0207656_100444543 | 156 |
| 150 | 3300025893 | Ga0207682_10034010 | Ga0207682_100340103 | 156 |
| 151 | 3300025893 | Ga0207682_10041355 | Ga0207682_100413552 | 156 |
| 152 | 3300025901 | Ga0207688_10047704 | Ga0207688_100477043 | 156 |
| 153 | 3300025901 | Ga0207688_10207409 | Ga0207688_102074092 | 156 |
| 154 | 3300025907 | Ga0207645_10021528 | Ga0207645_100215284 | 156 |
| 155 | 3300025914 | Ga0207671_10025887 | Ga0207671_100258873 | 156 |
| 156 | 3300025920 | Ga0207649_10167693 | Ga0207649_101676932 | 156 |
| 157 | 3300025923 | Ga0207681_10029245 | Ga0207681_100292454 | 156 |
| 158 | 3300025923 | Ga0207681_10043404 | Ga0207681_100434042 | 156 |
| 159 | 3300025925 | Ga0207650_10000783 | Ga0207650_1000078310 | 156 |
| 160 | 3300025925 | Ga0207650_10447239 | Ga0207650_104472392 | 156 |
| 161 | 3300025926 | Ga0207659_10000307 | Ga0207659_1000030727 | 156 |
| 162 | 3300025926 | Ga0207659_10734972 | Ga0207659_107349722 | 156 |
| 163 | 3300025927 | Ga0207687_10050006 | Ga0207687_100500063 | 156 |
| 164 | 3300025931 | Ga0207644_10055496 | Ga0207644_100554962 | 156 |
| 165 | 3300025931 | Ga0207644_10232255 | Ga0207644_102322552 | 156 |
| 166 | 3300025933 | Ga0207706_10394857 | Ga0207706_103948572 | 156 |
| 167 | 3300025935 | Ga0207709_10001251 | Ga0207709_100012512 | 156 |
| 168 | 3300025935 | Ga0207709_10262342 | Ga0207709_102623422 | 156 |
| 169 | 3300025937 | Ga0207669_10002758 | Ga0207669_100027582 | 156 |
| 170 | 3300025940 | Ga0207691_10003997 | Ga0207691_1000399710 | 156 |
| 171 | 3300025940 | Ga0207691_10070487 | Ga0207691_100704872 | 156 |
| 172 | 3300025941 | Ga0207711_10553013 | Ga0207711_105530132 | 156 |
| 173 | 3300025942 | Ga0207689_10074348 | Ga0207689_100743483 | 156 |
| 174 | 3300025945 | Ga0207679_10130612 | Ga0207679_101306122 | 156 |
| 175 | 3300025945 | Ga0207679_10237132 | Ga0207679_102371322 | 156 |
| 176 | 3300025960 | Ga0207651_10032204 | Ga0207651_100322043 | 156 |
| 177 | 3300025972 | Ga0207668_10194305 | Ga0207668_101943052 | 156 |
| 178 | 3300025972 | Ga0207668_10925331 | Ga0207668_109253312 | 156 |
| 179 | 3300025981 | Ga0207640_10056317 | Ga0207640_100563172 | 156 |
| 180 | 3300025981 | Ga0207640_10452058 | Ga0207640_104520582 | 156 |
| 181 | 3300025981 | Ga0207640_10456509 | Ga0207640_104565092 | 156 |
| 182 | 3300025986 | Ga0207658_10052703 | Ga0207658_100527032 | 156 |
| 183 | 3300025986 | Ga0207658_10232903 | Ga0207658_102329032 | 156 |
| 184 | 3300026041 | Ga0207639_10142367 | Ga0207639_101423672 | 156 |
| 185 | 3300026067 | Ga0207678_10001091 | Ga0207678_1000109115 | 156 |
| 186 | 3300026067 | Ga0207678_10237941 | Ga0207678_102379412 | 156 |
| 187 | 3300026067 | Ga0207678_10255305 | Ga0207678_102553052 | 156 |
| 188 | 3300026089 | Ga0207648_10000598 | Ga0207648_1000059812 | 156 |
| 189 | 3300026089 | Ga0207648_10008882 | Ga0207648_100088827 | 156 |
| 190 | 3300026089 | Ga0207648_10030699 | Ga0207648_100306993 | 156 |
| 191 | 3300026089 | Ga0207648_10131309 | Ga0207648_101313092 | 156 |
| 192 | 3300026095 | Ga0207676_10133919 | Ga0207676_101339192 | 156 |
| 193 | 3300026095 | Ga0207676_11055197 | Ga0207676_110551972 | 156 |
| 194 | 3300026116 | Ga0207674_10057633 | Ga0207674_100576333 | 156 |
| 195 | 3300026116 | Ga0207674_10242910 | Ga0207674_102429102 | 156 |
| 196 | 3300026116 | Ga0207674_10741448 | Ga0207674_107414482 | 156 |
| 197 | 3300026121 | Ga0207683_10001684 | Ga0207683_100016849 | 156 |
| 198 | 3300026121 | Ga0207683_10173488 | Ga0207683_101734883 | 156 |
| 199 | 3300027682 | Ga0209971_1102796 | Ga0209971_11027962 | 156 |
| 200 | 3300027866 | Ga0209813_10001967 | Ga0209813_100019674 | 156 |
| 201 | 3300028379 | Ga0268266_10084814 | Ga0268266_100848142 | 156 |
| 202 | 3300028379 | Ga0268266_10313008 | Ga0268266_103130082 | 156 |
| 203 | 3300028786 | Ga0307517_10000150 | Ga0307517_1000015075 | 156 |
| 204 | 3300028786 | Ga0307517_10148113 | Ga0307517_101481131 | 156 |
| 205 | 3300028786 | Ga0307517_10229311 | Ga0307517_102293112 | 156 |
| 206 | 3300028786 | Ga0307517_10339013 | Ga0307517_103390132 | 156 |
| 207 | 3300028794 | Ga0307515_10048427 | Ga0307515_100484276 | 156 |
| 208 | 3300028794 | Ga0307515_10374035 | Ga0307515_103740352 | 156 |
| 209 | 3300030522 | Ga0307512_10012395 | Ga0307512_100123952 | 156 |
| 210 | 3300030522 | Ga0307512_10291968 | Ga0307512_102919682 | 156 |
| 211 | 3300031239 | Ga0265328_10030177 | Ga0265328_100301773 | 156 |
| 212 | 3300031251 | Ga0265327_10001814 | Ga0265327_100018148 | 156 |
| 213 | 3300031507 | Ga0307509_10002837 | Ga0307509_100028378 | 156 |
| 214 | 3300031507 | Ga0307509_10011064 | Ga0307509_100110648 | 156 |
| 215 | 3300031507 | Ga0307509_10017922 | Ga0307509_100179224 | 156 |
| 216 | 3300031507 | Ga0307509_10384121 | Ga0307509_103841212 | 156 |
| 217 | 3300031548 | Ga0307408_100124347 | Ga0307408_1001243472 | 156 |
| 218 | 3300031616 | Ga0307508_10001937 | Ga0307508_1000193712 | 156 |
| 219 | 3300031616 | Ga0307508_10002030 | Ga0307508_1000203011 | 156 |
| 220 | 3300031616 | Ga0307508_10188802 | Ga0307508_101888022 | 156 |
| 221 | 3300031649 | Ga0307514_10181140 | Ga0307514_101811402 | 156 |
| 222 | 3300031649 | Ga0307514_10273342 | Ga0307514_102733422 | 156 |
| 223 | 3300031730 | Ga0307516_10562740 | Ga0307516_105627401 | 156 |
| 224 | 3300031731 | Ga0307405_10014843 | Ga0307405_100148432 | 156 |
| 225 | 3300031824 | Ga0307413_10033011 | Ga0307413_100330112 | 156 |
| 226 | 3300031824 | Ga0307413_10061552 | Ga0307413_100615522 | 156 |
| 227 | 3300031852 | Ga0307410_10098224 | Ga0307410_100982242 | 156 |
| 228 | 3300031901 | Ga0307406_10291521 | Ga0307406_102915212 | 156 |
| 229 | 3300031903 | Ga0307407_10051492 | Ga0307407_100514922 | 156 |
| 230 | 3300031911 | Ga0307412_10279276 | Ga0307412_102792762 | 156 |
| 231 | 3300031995 | Ga0307409_100015073 | Ga0307409_1000150732 | 156 |
| 232 | 3300031995 | Ga0307409_100112176 | Ga0307409_1001121762 | 156 |
| 233 | 3300031995 | Ga0307409_101147565 | Ga0307409_1011475651 | 156 |
| 234 | 3300032002 | Ga0307416_100080432 | Ga0307416_1000804322 | 156 |
| 235 | 3300032004 | Ga0307414_10028632 | Ga0307414_100286322 | 156 |
| 236 | 3300032005 | Ga0307411_10114846 | Ga0307411_101148461 | 156 |
| 237 | 3300032005 | Ga0307411_10835430 | Ga0307411_108354301 | 156 |
| 238 | 3300032005 | Ga0307411_10989249 | Ga0307411_109892492 | 156 |
| 239 | 3300032126 | Ga0307415_100039530 | Ga0307415_1000395304 | 156 |
| 240 | 3300033179 | Ga0307507_10319028 | Ga0307507_103190282 | 156 |
| 241 | 3300033180 | Ga0307510_10032222 | Ga0307510_100322223 | 156 |
| 242 | 3300033180 | Ga0307510_10036007 | Ga0307510_100360074 | 156 |
| 243 | 3300033180 | Ga0307510_10102227 | Ga0307510_101022272 | 156 |
| 244 | 3300033180 | Ga0307510_10354242 | Ga0307510_103542422 | 156 |
| 245 | 3300034957 | Ga0373938_0034261 | Ga0373938_0034261_318_854 | 156 |
| 246 | 3300035084 | Ga0373928_0046618 | Ga0373928_0046618_245_790 | 156 |
| 247 | 3300036401 | Ga0373937_0847408 | Ga0373937_0847408_209_751 | 156 |
| 248 | 3300037471 | Ga0395905_0163392 | Ga0395905_0163392_1125_1631 | 156 |
| 249 | 3300037471 | Ga0395905_0169731 | Ga0395905_0169731_511_1017 | 156 |
| 250 | 3300041460 | Ga0451802_1818719 | Ga0451802_1818719_184_729 | 156 |
| 251 | 3300041486 | Ga0451807_1905397 | Ga0451807_1905397_146_634 | 156 |
| 252 | 3300041494 | Ga0451837_1548583 | Ga0451837_1548583_31_567 | 156 |
| 253 | 3300041503 | Ga0451847_0510527 | Ga0451847_0510527_195_728 | 156 |
| 254 | 3300042001 | Ga0439441_019829 | Ga0439441_019829_692_1210 | 156 |
| 255 | 3300042126 | Ga0450888_056834 | Ga0450888_056834_65_553 | 156 |
| 256 | 3300042876 | Ga0451577_0433035 | Ga0451577_0433035_380_928 | 156 |
| 257 | 3300044712 | Ga0453684_0020258 | Ga0453684_0020258_8574_9119 | 156 |
| 258 | 3300044712 | Ga0453684_0075261 | Ga0453684_0075261_2162_2710 | 156 |
| 259 | 3300046454 | Ga0495592_0005413 | Ga0495592_0005413_8247_8792 | 156 |
| 260 | 3300046460 | Ga0495638_0035681 | Ga0495638_0035681_509_1054 | 156 |
| 261 | 3300046473 | Ga0495582_0265260 | Ga0495582_0265260_98_640 | 156 |
| 262 | 3300046474 | Ga0495605_0377282 | Ga0495605_0377282_11_499 | 156 |
| 263 | 3300046512 | Ga0495610_0236135 | Ga0495610_0236135_173_718 | 156 |
| 264 | 3300046512 | Ga0495610_0310795 | Ga0495610_0310795_29_562 | 156 |
| 265 | 3300046519 | Ga0495632_0004080 | Ga0495632_0004080_3201_3689 | 156 |
| 266 | 3300046526 | Ga0495666_0028509 | Ga0495666_0028509_45_587 | 156 |
| 267 | 3300046539 | Ga0495621_0000186 | Ga0495621_0000186_8471_8962 | 156 |
| 268 | 3300046539 | Ga0495621_0013043 | Ga0495621_0013043_1140_1631 | 156 |
| 269 | 3300046616 | Ga0495668_0129102 | Ga0495668_0129102_593_1081 | 156 |
| 270 | 3300046660 | Ga0495625_0059298 | Ga0495625_0059298_1241_1786 | 156 |
| 271 | 3300046660 | Ga0495625_0283802 | Ga0495625_0283802_267_755 | 156 |
| 272 | 3300046690 | Ga0495624_0094567 | Ga0495624_0094567_336_878 | 156 |
| 273 | 3300046692 | Ga0495671_0040228 | Ga0495671_0040228_1451_2008 | 156 |
| 274 | 3300046694 | Ga0495649_0008664 | Ga0495649_0008664_2774_3262 | 156 |
| 275 | 3300046810 | Ga0495660_0072989 | Ga0495660_0072989_241_729 | 156 |
| 276 | 3300049575 | Ga0501039_0295246 | Ga0501039_0295246_144_692 | 156 |
| 277 | 3300050489 | nmdc:mga03683_22922_c1 | nmdc:mga03683_22922_c1_13_501 | 156 |
| 278 | 3300050489 | nmdc:mga03683_98030_c1 | nmdc:mga03683_98030_c1_364_909 | 156 |
| 279 | 3300050491 | nmdc:mga00v17_44553_c1 | nmdc:mga00v17_44553_c1_1130_1618 | 156 |
| 280 | 3300050492 | nmdc:mga0yw44_322280_c1 | nmdc:mga0yw44_322280_c1_244_732 | 156 |
| 281 | 3300050493 | nmdc:mga0k408_1070_c2 | nmdc:mga0k408_1070_c2_218_706 | 156 |
| 282 | 3300050493 | nmdc:mga0k408_121579_c1 | nmdc:mga0k408_121579_c1_679_1236 | 156 |
| 283 | 3300050493 | nmdc:mga0k408_1281_c1 | nmdc:mga0k408_1281_c1_751_1293 | 156 |
| 284 | 3300050493 | nmdc:mga0k408_140895_c1 | nmdc:mga0k408_140895_c1_363_851 | 156 |
| 285 | 3300050493 | nmdc:mga0k408_1749_c1 | nmdc:mga0k408_1749_c1_7082_7570 | 156 |
| 286 | 3300050493 | nmdc:mga0k408_200775_c1 | nmdc:mga0k408_200775_c1_45_533 | 156 |
| 287 | 3300050493 | nmdc:mga0k408_267279_c1 | nmdc:mga0k408_267279_c1_330_800 | 156 |
| 288 | 3300050493 | nmdc:mga0k408_299925_c1 | nmdc:mga0k408_299925_c1_118_609 | 156 |
| 289 | 3300050493 | nmdc:mga0k408_330_c1 | nmdc:mga0k408_330_c1_7515_8051 | 156 |
| 290 | 3300050493 | nmdc:mga0k408_34111_c1 | nmdc:mga0k408_34111_c1_346_834 | 156 |
| 291 | 3300050493 | nmdc:mga0k408_365678_c1 | nmdc:mga0k408_365678_c1_218_706 | 156 |
| 292 | 3300050493 | nmdc:mga0k408_64903_c1 | nmdc:mga0k408_64903_c1_154_699 | 156 |
| 293 | 3300050493 | nmdc:mga0k408_7031_c1 | nmdc:mga0k408_7031_c1_4261_4749 | 156 |
| 294 | 3300050493 | nmdc:mga0k408_96421_c1 | nmdc:mga0k408_96421_c1_1017_1553 | 156 |
| 295 | 3300050494 | nmdc:mga06z11_233954_c1 | nmdc:mga06z11_233954_c1_212_754 | 156 |
| 296 | 3300050494 | nmdc:mga06z11_274049_c1 | nmdc:mga06z11_274049_c1_133_621 | 156 |
| 297 | 3300050494 | nmdc:mga06z11_4773_c1 | nmdc:mga06z11_4773_c1_1832_2320 | 156 |
| 298 | 3300050494 | nmdc:mga06z11_59827_c1 | nmdc:mga06z11_59827_c1_412_900 | 156 |
| 299 | 3300050495 | nmdc:mga04h51_79888_c1 | nmdc:mga04h51_79888_c1_660_1148 | 156 |
| 300 | 3300050496 | nmdc:mga07m45_191_c1 | nmdc:mga07m45_191_c1_15755_16243 | 156 |
| 301 | 3300050496 | nmdc:mga07m45_20994_c1 | nmdc:mga07m45_20994_c1_91_579 | 156 |
| 302 | 3300050496 | nmdc:mga07m45_214690_c1 | nmdc:mga07m45_214690_c1_458_1003 | 156 |
| 303 | 3300050496 | nmdc:mga07m45_38159_c1 | nmdc:mga07m45_38159_c1_1016_1504 | 156 |
| 304 | 3300050496 | nmdc:mga07m45_56421_c1 | nmdc:mga07m45_56421_c1_1421_1966 | 156 |
| 305 | 3300050496 | nmdc:mga07m45_6895_c1 | nmdc:mga07m45_6895_c1_5123_5611 | 156 |
| 306 | 3300050508 | nmdc:mga09592_93741_c1 | nmdc:mga09592_93741_c1_683_1219 | 156 |
| 307 | 3300050516 | nmdc:mga0sz30_10145_c1 | nmdc:mga0sz30_10145_c1_2835_3323 | 156 |
| 308 | 3300053087 | Ga0500643_031271 | Ga0500643_031271_173_718 | 156 |
| 309 | 3300053088 | Ga0500644_0031695 | Ga0500644_0031695_132_677 | 156 |
| 310 | 3300053118 | Ga0500594_0000801 | Ga0500594_0000801_5406_5951 | 156 |
| 311 | 3300053131 | Ga0500652_143249 | Ga0500652_143249_118_663 | 156 |
| 312 | 3300053136 | Ga0500559_0000069 | Ga0500559_0000069_39989_40534 | 156 |
| 313 | 3300053137 | Ga0500561_0057483 | Ga0500561_0057483_432_920 | 156 |
| 314 | 3300053139 | Ga0500568_0032110 | Ga0500568_0032110_386_883 | 156 |
| 315 | 3300053148 | Ga0500590_133961 | Ga0500590_133961_266_802 | 156 |
| 316 | 3300053151 | Ga0500604_0101367 | Ga0500604_0101367_227_760 | 156 |
| 317 | 3300053153 | Ga0500616_0247885 | Ga0500616_0247885_113_670 | 156 |
| 318 | 3300053154 | Ga0500619_114382 | Ga0500619_114382_161_706 | 156 |
| 319 | 3300053155 | Ga0500620_062191 | Ga0500620_062191_186_731 | 156 |
| 320 | 3300053156 | Ga0500622_0000881 | Ga0500622_0000881_21381_21926 | 156 |
| 321 | 3300053158 | Ga0500627_0289148 | Ga0500627_0289148_109_597 | 156 |
| 322 | 3300053177 | Ga0500636_0094060 | Ga0500636_0094060_217_762 | 156 |
| 323 | 3300006186 | Ga0075369_10020121 | Ga0075369_100201213 | 157 |
| 324 | 3300006195 | Ga0075366_10012503 | Ga0075366_100125032 | 157 |
| 325 | 3300006353 | Ga0075370_10148512 | Ga0075370_101485122 | 157 |
| 326 | 3300025910 | Ga0207684_10009174 | Ga0207684_100091749 | 157 |
| 327 | 3300050493 | nmdc:mga0k408_422444_c1 | nmdc:mga0k408_422444_c1_71_574 | 157 |
| 328 | 3300003323 | rootH1_10026771 | rootH1_100267712 | 158 |
| 329 | 3300025903 | Ga0207680_10261044 | Ga0207680_102610442 | 158 |
| 330 | 3300026078 | Ga0207702_10371156 | Ga0207702_103711562 | 158 |
| 331 | 3300035121 | Ga0373960_0037144 | Ga0373960_0037144_675_1226 | 158 |
| 332 | 3300035691 | Ga0373931_0023509 | Ga0373931_0023509_195_671 | 158 |
| 333 | 3300037068 | Ga0373925_0086709 | Ga0373925_0086709_1502_2053 | 158 |
| 334 | 3300039447 | Ga0436361_0152229 | Ga0436361_0152229_956_1432 | 158 |
| 335 | 3300048088 | Ga0495602_0131355 | Ga0495602_0131355_247_798 | 158 |
| 336 | 3300048903 | Ga0496100_0311308 | Ga0496100_0311308_233_784 | 158 |
| 337 | 3300002705 | JGI25156J39149_1013855 | JGI25156J39149_10138552 | 159 |
| 338 | 3300002738 | JGI25154J39366_1001787 | JGI25154J39366_10017874 | 159 |
| 339 | 3300002741 | JGI25157J39369_1000423 | JGI25157J39369_10004235 | 159 |
| 340 | 3300003320 | rootH2_10169528 | rootH2_101695282 | 159 |
| 341 | 3300003322 | rootL2_10036206 | rootL2_100362063 | 159 |
| 342 | 3300003323 | rootH1_10003718 | rootH1_1000371817 | 159 |
| 343 | 3300003323 | rootH1_10026770 | rootH1_100267702 | 159 |
| 344 | 3300003752 | Ga0055539_1000267 | Ga0055539_100026717 | 159 |
| 345 | 3300003752 | Ga0055539_1000525 | Ga0055539_10005255 | 159 |
| 346 | 3300003756 | Ga0055533_1000006 | Ga0055533_1000006160 | 159 |
| 347 | 3300003759 | Ga0055525_1000601 | Ga0055525_100060115 | 159 |
| 348 | 3300003761 | Ga0055535_1000702 | Ga0055535_100070219 | 159 |
| 349 | 3300003763 | Ga0055529_1000340 | Ga0055529_10003409 | 159 |
| 350 | 3300005327 | Ga0070658_10097061 | Ga0070658_100970612 | 159 |
| 351 | 3300005327 | Ga0070658_10295208 | Ga0070658_102952082 | 159 |
| 352 | 3300005327 | Ga0070658_10328567 | Ga0070658_103285672 | 159 |
| 353 | 3300005328 | Ga0070676_10640023 | Ga0070676_106400232 | 159 |
| 354 | 3300005329 | Ga0070683_100671548 | Ga0070683_1006715482 | 159 |
| 355 | 3300005339 | Ga0070660_100142558 | Ga0070660_1001425582 | 159 |
| 356 | 3300005339 | Ga0070660_100837147 | Ga0070660_1008371471 | 159 |
| 357 | 3300005344 | Ga0070661_100385840 | Ga0070661_1003858402 | 159 |
| 358 | 3300005364 | Ga0070673_100011292 | Ga0070673_1000112926 | 159 |
| 359 | 3300005365 | Ga0070688_100266194 | Ga0070688_1002661942 | 159 |
| 360 | 3300005366 | Ga0070659_100167470 | Ga0070659_1001674702 | 159 |
| 361 | 3300005366 | Ga0070659_100183360 | Ga0070659_1001833602 | 159 |
| 362 | 3300005456 | Ga0070678_100757317 | Ga0070678_1007573172 | 159 |
| 363 | 3300005459 | Ga0068867_100677035 | Ga0068867_1006770351 | 159 |
| 364 | 3300005530 | Ga0070679_101491795 | Ga0070679_1014917951 | 159 |
| 365 | 3300005563 | Ga0068855_100476231 | Ga0068855_1004762312 | 159 |
| 366 | 3300005563 | Ga0068855_100523959 | Ga0068855_1005239591 | 159 |
| 367 | 3300005577 | Ga0068857_100003384 | Ga0068857_10000338411 | 159 |
| 368 | 3300005614 | Ga0068856_100001919 | Ga0068856_1000019199 | 159 |
| 369 | 3300005616 | Ga0068852_100166880 | Ga0068852_1001668803 | 159 |
| 370 | 3300005719 | Ga0068861_100074016 | Ga0068861_1000740161 | 159 |
| 371 | 3300005834 | Ga0068851_10728585 | Ga0068851_107285851 | 159 |
| 372 | 3300005841 | Ga0068863_100935149 | Ga0068863_1009351492 | 159 |
| 373 | 3300005843 | Ga0068860_100371627 | Ga0068860_1003716272 | 159 |
| 374 | 3300006195 | Ga0075366_10010092 | Ga0075366_100100927 | 159 |
| 375 | 3300009093 | Ga0105240_10092549 | Ga0105240_100925493 | 159 |
| 376 | 3300009093 | Ga0105240_10785485 | Ga0105240_107854852 | 159 |
| 377 | 3300009174 | Ga0105241_10101254 | Ga0105241_101012543 | 159 |
| 378 | 3300009176 | Ga0105242_10099559 | Ga0105242_100995592 | 159 |
| 379 | 3300009545 | Ga0105237_10198589 | Ga0105237_101985892 | 159 |
| 380 | 3300009551 | Ga0105238_10067050 | Ga0105238_100670502 | 159 |
| 381 | 3300010375 | Ga0105239_10072130 | Ga0105239_100721302 | 159 |
| 382 | 3300011119 | Ga0105246_10081657 | Ga0105246_100816573 | 159 |
| 383 | 3300013296 | Ga0157374_10205798 | Ga0157374_102057983 | 159 |
| 384 | 3300013307 | Ga0157372_10143169 | Ga0157372_101431692 | 159 |
| 385 | 3300013308 | Ga0157375_10735771 | Ga0157375_107357712 | 159 |
| 386 | 3300014968 | Ga0157379_11313108 | Ga0157379_113131081 | 159 |
| 387 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031177 | 159 |
| 388 | 3300025230 | Ga0209563_100010 | Ga0209563_100010905 | 159 |
| 389 | 3300025230 | Ga0209563_115978 | Ga0209563_1159782 | 159 |
| 390 | 3300025231 | Ga0207427_100190 | Ga0207427_10019034 | 159 |
| 391 | 3300025242 | Ga0209258_100060 | Ga0209258_10006099 | 159 |
| 392 | 3300025242 | Ga0209258_101561 | Ga0209258_1015616 | 159 |
| 393 | 3300025246 | Ga0209646_1000376 | Ga0209646_10003766 | 159 |
| 394 | 3300025250 | Ga0209026_1000179 | Ga0209026_100017985 | 159 |
| 395 | 3300025253 | Ga0209677_100026 | Ga0209677_10002630 | 159 |
| 396 | 3300025253 | Ga0209677_100784 | Ga0209677_1007844 | 159 |
| 397 | 3300025253 | Ga0209677_107536 | Ga0209677_1075362 | 159 |
| 398 | 3300025256 | Ga0209759_1000196 | Ga0209759_100019685 | 159 |
| 399 | 3300025256 | Ga0209759_1003221 | Ga0209759_10032212 | 159 |
| 400 | 3300025256 | Ga0209759_1003576 | Ga0209759_10035764 | 159 |
| 401 | 3300025256 | Ga0209759_1005886 | Ga0209759_10058864 | 159 |
| 402 | 3300025256 | Ga0209759_1019941 | Ga0209759_10199412 | 159 |
| 403 | 3300025272 | Ga0209455_1000093 | Ga0209455_1000093139 | 159 |
| 404 | 3300025909 | Ga0207705_10255094 | Ga0207705_102550942 | 159 |
| 405 | 3300025911 | Ga0207654_10027444 | Ga0207654_100274442 | 159 |
| 406 | 3300025913 | Ga0207695_10039555 | Ga0207695_100395555 | 159 |
| 407 | 3300025919 | Ga0207657_10028816 | Ga0207657_100288163 | 159 |
| 408 | 3300025919 | Ga0207657_10234138 | Ga0207657_102341382 | 159 |
| 409 | 3300025920 | Ga0207649_10293852 | Ga0207649_102938522 | 159 |
| 410 | 3300025924 | Ga0207694_10074907 | Ga0207694_100749072 | 159 |
| 411 | 3300025931 | Ga0207644_10986828 | Ga0207644_109868282 | 159 |
| 412 | 3300025932 | Ga0207690_10080985 | Ga0207690_100809853 | 159 |
| 413 | 3300025932 | Ga0207690_11097229 | Ga0207690_110972291 | 159 |
| 414 | 3300025934 | Ga0207686_10467042 | Ga0207686_104670422 | 159 |
| 415 | 3300025938 | Ga0207704_10237941 | Ga0207704_102379412 | 159 |
| 416 | 3300025949 | Ga0207667_10003358 | Ga0207667_100033582 | 159 |
| 417 | 3300025949 | Ga0207667_11434044 | Ga0207667_114340442 | 159 |
| 418 | 3300025960 | Ga0207651_10031751 | Ga0207651_100317512 | 159 |
| 419 | 3300025981 | Ga0207640_10124302 | Ga0207640_101243022 | 159 |
| 420 | 3300026041 | Ga0207639_10142983 | Ga0207639_101429831 | 159 |
| 421 | 3300026041 | Ga0207639_10820593 | Ga0207639_108205932 | 159 |
| 422 | 3300026067 | Ga0207678_10427405 | Ga0207678_104274052 | 159 |
| 423 | 3300026078 | Ga0207702_10000199 | Ga0207702_1000019965 | 159 |
| 424 | 3300026089 | Ga0207648_10377104 | Ga0207648_103771043 | 159 |
| 425 | 3300026116 | Ga0207674_10006359 | Ga0207674_100063596 | 159 |
| 426 | 3300026118 | Ga0207675_100052849 | Ga0207675_1000528496 | 159 |
| 427 | 3300026121 | Ga0207683_10231379 | Ga0207683_102313792 | 159 |
| 428 | 3300028381 | Ga0268264_10367530 | Ga0268264_103675302 | 159 |
| 429 | 3300028666 | Ga0265336_10000012 | Ga0265336_10000012228 | 159 |
| 430 | 3300030521 | Ga0307511_10072563 | Ga0307511_100725632 | 159 |
| 431 | 3300031730 | Ga0307516_10002378 | Ga0307516_1000237825 | 159 |
| 432 | 3300034820 | Ga0373959_0001904 | Ga0373959_0001904_2339_2818 | 159 |
| 433 | 3300035086 | Ga0373934_0015101 | Ga0373934_0015101_2020_2499 | 159 |
| 434 | 3300037466 | Ga0395898_0248339 | Ga0395898_0248339_1008_1487 | 159 |
| 435 | 3300038443 | Ga0395901_0003991 | Ga0395901_0003991_1251_1730 | 159 |
| 436 | 3300044694 | Ga0466963_0411779 | Ga0466963_0411779_26_505 | 159 |
| 437 | 3300046454 | Ga0495592_0339698 | Ga0495592_0339698_140_619 | 159 |
| 438 | 3300046471 | Ga0495650_0020058 | Ga0495650_0020058_1964_2443 | 159 |
| 439 | 3300046506 | Ga0495583_0001275 | Ga0495583_0001275_5314_5793 | 159 |
| 440 | 3300046507 | Ga0495606_0003090 | Ga0495606_0003090_873_1352 | 159 |
| 441 | 3300046511 | Ga0495608_0852606 | Ga0495608_0852606_12_491 | 159 |
| 442 | 3300046616 | Ga0495668_0075573 | Ga0495668_0075573_353_832 | 159 |
| 443 | 3300046660 | Ga0495625_0031998 | Ga0495625_0031998_978_1457 | 159 |
| 444 | 3300046684 | Ga0495669_0052625 | Ga0495669_0052625_568_1047 | 159 |
| 445 | 3300046694 | Ga0495649_0003769 | Ga0495649_0003769_5313_5792 | 159 |
| 446 | 3300046794 | Ga0495589_0086306 | Ga0495589_0086306_867_1346 | 159 |
| 447 | 3300047323 | Ga0495683_0283304 | Ga0495683_0283304_146_625 | 159 |
| 448 | 3300048903 | Ga0496100_0766972 | Ga0496100_0766972_262_741 | 159 |
| 449 | 3300049160 | Ga0501304_000171 | Ga0501304_000171_1392_1889 | 159 |
| 450 | 3300049531 | Ga0501315_004286 | Ga0501315_004286_680_1177 | 159 |
| 451 | 3300049686 | Ga0501257_095970 | Ga0501257_095970_192_689 | 159 |
| 452 | 3300050493 | nmdc:mga0k408_8999_c1 | nmdc:mga0k408_8999_c1_2893_3372 | 159 |
| 453 | 3300053080 | Ga0500635_0000096 | Ga0500635_0000096_23559_24038 | 159 |
| 454 | 3300053093 | Ga0500651_0027673 | Ga0500651_0027673_1034_1513 | 159 |
| 455 | 3300053136 | Ga0500559_0005362 | Ga0500559_0005362_4587_5066 | 159 |
| 456 | 3300053138 | Ga0500564_185344 | Ga0500564_185344_106_585 | 159 |
| 457 | 3300053154 | Ga0500619_153973 | Ga0500619_153973_64_543 | 159 |
| 458 | 3300055283 | Ga0500661_019784 | Ga0500661_019784_345_824 | 159 |
| 459 | 3300005340 | Ga0070689_101481545 | Ga0070689_1014815451 | 160 |
| 460 | 3300005459 | Ga0068867_100132918 | Ga0068867_1001329182 | 160 |
| 461 | 3300013306 | Ga0163162_10478387 | Ga0163162_104783872 | 160 |
| 462 | 3300025303 | Ga0209051_1003055 | Ga0209051_100305511 | 160 |
| 463 | 3300026089 | Ga0207648_10068060 | Ga0207648_100680603 | 160 |
| 464 | 3300042876 | Ga0451577_0052147 | Ga0451577_0052147_405_887 | 160 |
| 465 | 3300003771 | Ga0055526_1004906 | Ga0055526_10049064 | 161 |
| 466 | 3300006195 | Ga0075366_10219297 | Ga0075366_102192972 | 161 |
| 467 | 3300006353 | Ga0075370_10402648 | Ga0075370_104026482 | 161 |
| 468 | 3300025295 | Ga0209564_1000051 | Ga0209564_1000051160 | 161 |
| 469 | 3300037471 | Ga0395905_0248303 | Ga0395905_0248303_931_1434 | 161 |
| 470 | 3300049127 | Ga0501306_016425 | Ga0501306_016425_303_806 | 161 |
| 471 | 3300005616 | Ga0068852_101073753 | Ga0068852_1010737532 | 162 |
| 472 | 3300026142 | Ga0207698_10778213 | Ga0207698_107782132 | 162 |
| 473 | 3300031730 | Ga0307516_10266315 | Ga0307516_102663152 | 162 |
| 474 | 3300002705 | JGI25156J39149_1011916 | JGI25156J39149_10119162 | 165 |
| 475 | 3300025228 | Ga0209672_106548 | Ga0209672_1065482 | 165 |
| 476 | 3300025254 | Ga0209148_1010057 | Ga0209148_10100573 | 165 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uqg-assembly2.cif.gz_G | crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p200 | 0.808 | 50 | 128 |
| 5uqh-assembly2.cif.gz_G | crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p182 | 0.807 | 50 | 128 |
| 5urq-assembly2.cif.gz_F | crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p176 | 0.807 | 50 | 128 |
| 5uqg-assembly1.cif.gz_D | crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p200 | 0.8058 | 50 | 128 |
| 5uqh-assembly1.cif.gz_B | crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p182 | 0.8048 | 50 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r2gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7472 | 31 | 128 | 3.20.20.70 |
| 1tqjD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7405 | 32 | 141 | 3.20.20.70 |
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7334 | 32 | 142 | 3.20.20.70 |
| af_Q9GZH3_19_534_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7287 | 50 | 128 | 3.20.20.70 |
| 3gnnA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7144 | 40 | 133 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382FJS1-F1-model_v4 | DUF934 domain-containing protein | 0.9585 | 33 | 110 |
|
| AF-A0A5C7JJR4-F1-model_v4 | deleted | 0.9448 | 61 | 143 |
|
| AF-A0A160JE19-F1-model_v4 | DUF934 domain-containing protein | 0.933 | 15 | 145 |
|
| AF-A0A1W6MZ42-F1-model_v4 | Oxidoreductase | 0.9319 | 15 | 144 |
|
| AF-A0A7Y3IVL2-F1-model_v4 | DUF934 domain-containing protein | 0.9276 | 15 | 145 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar