F451563

General Info

Members Datasets Scaffolds Average Seq Length
476 301 467 135

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0029103|Ga0466961_0029103_555_1067
Length 144
Sequence MSEIDWAGLRSAAREAMSCAYVPYSRFPVGAAGITDDGRVVTGCNVENASYGLTLCAECSLVSILHTQRRSEKPRLRAVAIVDGRGEPLMPCGRCRQLLWEHGGPDLLVETARGILPMSEILPDAFGPDDLSSVRASGGDLERG

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
3 2643221721 Oerskovia sp. Root918 Isolate Unclassified
4 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
5 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
6 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
7 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
8 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
9 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
178 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
182 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
186 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
187 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
188 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
189 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
190 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
191 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
295 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
296 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
297 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0.84
Isolates 1.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 7.35
Rhizosphere 88.87
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10003335 3300002459 Bacteria 3238
2 JGI25406J46586_10054901 3300003203 Bacteria 1315
3 Ga0065704_10330192 3300005289 Bacteria 839
4 Ga0070658_10039000 3300005327 Bacteria 3832
5 Ga0070658_11662840 3300005327 Bacteria 553
6 Ga0070658_11764518 3300005327 Bacteria 535
7 Ga0070676_10133754 3300005328 Bacteria 1571
8 Ga0070683_100001419 3300005329 Bacteria 18396
9 Ga0070683_100877449 3300005329 Bacteria 860
10 Ga0070690_100198444 3300005330 Bacteria 1395
11 Ga0070670_100028083 3300005331 Bacteria 4841
12 Ga0068869_100047975 3300005334 Bacteria 3086
13 Ga0068869_100162245 3300005334 Bacteria 1740
14 Ga0070666_10179324 3300005335 Bacteria 1485
15 Ga0070680_100003706 3300005336 Bacteria 11416
16 Ga0070680_100949759 3300005336 Bacteria 742
17 Ga0070682_100004861 3300005337 Bacteria 7457
18 Ga0070682_100005511 3300005337 Bacteria 7044
19 Ga0070682_100507549 3300005337 Bacteria 936
20 Ga0068868_100022672 3300005338 Bacteria 4743
21 Ga0068868_100184056 3300005338 Bacteria 1734
22 Ga0070660_100067725 3300005339 Bacteria 2782
23 Ga0070691_10004532 3300005341 Bacteria 6308
24 Ga0070687_100364288 3300005343 Bacteria 937
25 Ga0070687_100668970 3300005343 Bacteria 722
26 Ga0070661_100033883 3300005344 Bacteria 3702
27 Ga0070661_100528370 3300005344 Bacteria 947
28 Ga0070661_100591919 3300005344 Bacteria 896
29 Ga0070692_10004363 3300005345 Bacteria 5897
30 Ga0070692_10069429 3300005345 Bacteria 1874
31 Ga0070668_100319964 3300005347 Bacteria 1306
32 Ga0070668_101013396 3300005347 Bacteria 747
33 Ga0070675_100019411 3300005354 Bacteria 5417
34 Ga0070671_100021056 3300005355 Bacteria 5323
35 Ga0070673_100631306 3300005364 Bacteria 979
36 Ga0070673_101317131 3300005364 Bacteria 678
37 Ga0070659_100011774 3300005366 Bacteria 6474
38 Ga0070659_100072838 3300005366 Bacteria 2734
39 Ga0070694_100736205 3300005444 Bacteria 804
40 Ga0070663_100005840 3300005455 Bacteria 7354
41 Ga0070663_100479021 3300005455 Bacteria 1030
42 Ga0070678_100002551 3300005456 Bacteria 9995
43 Ga0070678_100027637 3300005456 Bacteria 3855
44 Ga0070678_101227548 3300005456 Bacteria 696
45 Ga0070662_100163234 3300005457 Bacteria 1744
46 Ga0070662_101207293 3300005457 Bacteria 650
47 Ga0070681_10153010 3300005458 Bacteria 2232
48 Ga0068867_100903348 3300005459 Bacteria 795
49 Ga0070685_10198811 3300005466 Bacteria 1302
50 Ga0070707_100129500 3300005468 Bacteria 2453
51 Ga0070698_100001827 3300005471 Bacteria 23695
52 Ga0070679_100154362 3300005530 Bacteria 2271
53 Ga0070684_100001579 3300005535 Bacteria 16458
54 Ga0070684_100461659 3300005535 Bacteria 1174
55 Ga0068853_100012771 3300005539 Bacteria 6839
56 Ga0070672_100253736 3300005543 Bacteria 1482
57 Ga0070672_101138662 3300005543 Bacteria 694
58 Ga0070695_100039579 3300005545 Bacteria 2981
59 Ga0070696_100349607 3300005546 Bacteria 1144
60 Ga0070693_100003363 3300005547 Bacteria 7437
61 Ga0070693_100254662 3300005547 Bacteria 1165
62 Ga0070665_100004127 3300005548 Bacteria 15284
63 Ga0070665_101019257 3300005548 Bacteria 840
64 Ga0070704_100583098 3300005549 Bacteria 981
65 Ga0070704_101072162 3300005549 Bacteria 731
66 Ga0068855_100078875 3300005563 Bacteria 3820
67 Ga0068855_100415323 3300005563 Bacteria 1472
68 Ga0070664_100039164 3300005564 Bacteria 3993
69 Ga0068857_100050318 3300005577 Bacteria 3697
70 Ga0068854_100006376 3300005578 Bacteria 7504
71 Ga0068854_101297847 3300005578 Bacteria 655
72 Ga0068856_100113084 3300005614 Bacteria 2713
73 Ga0070702_100001410 3300005615 Bacteria 9817
74 Ga0068852_100017856 3300005616 Bacteria 5577
75 Ga0068852_100115133 3300005616 Bacteria 2451
76 Ga0068859_100071949 3300005617 Bacteria 3493
77 Ga0068864_100023735 3300005618 Bacteria 5153
78 Ga0068864_100058298 3300005618 Bacteria 3337
79 Ga0068861_100760111 3300005719 Bacteria 906
80 Ga0068851_10030503 3300005834 Bacteria 2674
81 Ga0068870_10002418 3300005840 Bacteria 7766
82 Ga0068870_10766789 3300005840 Bacteria 671
83 Ga0068863_100009759 3300005841 Bacteria 9361
84 Ga0068858_100150547 3300005842 Bacteria 2188
85 Ga0068860_100068588 3300005843 Bacteria 3370
86 Ga0081455_10746354 3300005937 Bacteria 619
87 Ga0081539_10000238 3300005985 Bacteria 129119
88 Ga0081539_10017213 3300005985 Bacteria 5089
89 Ga0075365_10000753 3300006038 Bacteria 13137
90 Ga0075364_10037038 3300006051 Bacteria 3156
91 Ga0075432_10019715 3300006058 Bacteria 2305
92 Ga0097621_100022781 3300006237 Bacteria 4867
93 Ga0068871_100034455 3300006358 Bacteria 4018
94 Ga0068871_101553367 3300006358 Bacteria 626
95 Ga0075428_100057114 3300006844 Bacteria 4273
96 Ga0075431_100001720 3300006847 Bacteria 20585
97 Ga0075431_101270680 3300006847 Bacteria 697
98 Ga0075433_10003466 3300006852 Bacteria 12177
99 Ga0075434_100008167 3300006871 Bacteria 9709
100 Ga0075434_101140750 3300006871 Bacteria 792
101 Ga0075436_100002226 3300006914 Bacteria 13397
102 Ga0097620_100071944 3300006931 Bacteria 3493
103 Ga0075435_100026916 3300007076 Bacteria 4492
104 Ga0105251_10024250 3300009011 Bacteria 3117
105 Ga0105240_10706549 3300009093 Bacteria 1100
106 Ga0111539_10024062 3300009094 Bacteria 7480
107 Ga0105245_10019865 3300009098 Bacteria 5889
108 Ga0105245_10073096 3300009098 Bacteria 3117
109 Ga0105245_10379252 3300009098 Bacteria 1408
110 Ga0105247_10043223 3300009101 Bacteria 2760
111 Ga0114129_10511206 3300009147 Bacteria 1567
112 Ga0114129_11758772 3300009147 Bacteria 755
113 Ga0105243_10262445 3300009148 Bacteria 1547
114 Ga0105243_11222627 3300009148 Bacteria 765
115 Ga0105243_11950512 3300009148 Bacteria 621
116 Ga0105241_10002283 3300009174 Bacteria 14411
117 Ga0105248_10030094 3300009177 Bacteria 6059
118 Ga0105248_10056909 3300009177 Bacteria 4387
119 Ga0105248_11629433 3300009177 Bacteria 731
120 Ga0105237_10067135 3300009545 Bacteria 3581
121 Ga0105237_10621240 3300009545 Bacteria 1087
122 Ga0105237_10702513 3300009545 Bacteria 1018
123 Ga0105238_10225327 3300009551 Bacteria 1851
124 Ga0105249_10081579 3300009553 Bacteria 3007
125 Ga0105249_11460510 3300009553 Bacteria 756
126 Ga0105239_10016479 3300010375 Bacteria 8174
127 Ga0105239_10016902 3300010375 Bacteria 8063
128 Ga0105239_10142062 3300010375 Bacteria 2676
129 Ga0105246_10002791 3300011119 Bacteria 10572
130 Ga0105246_10304275 3300011119 Bacteria 1289
131 Ga0157373_10031647 3300013100 Bacteria 3808
132 Ga0157371_10011527 3300013102 Bacteria 6798
133 Ga0157371_10150527 3300013102 Bacteria 1659
134 Ga0157371_10535092 3300013102 Bacteria 867
135 Ga0157370_10004634 3300013104 Bacteria 15719
136 Ga0157370_10838582 3300013104 Bacteria 836
137 Ga0157370_11348503 3300013104 Bacteria 642
138 Ga0157369_10067624 3300013105 Bacteria 3840
139 Ga0157369_10072485 3300013105 Bacteria 3697
140 Ga0157369_10200618 3300013105 Bacteria 2094
141 Ga0157369_10657274 3300013105 Bacteria 1081
142 Ga0157369_11875859 3300013105 Bacteria 608
143 Ga0157374_10043380 3300013296 Bacteria 4155
144 Ga0163162_10009205 3300013306 Bacteria 9612
145 Ga0163162_10775032 3300013306 Bacteria 1077
146 Ga0163162_11157592 3300013306 Bacteria 877
147 Ga0163162_11562198 3300013306 Bacteria 752
148 Ga0157372_10022729 3300013307 Bacteria 6788
149 Ga0157372_10249661 3300013307 Bacteria 2059
150 Ga0157375_10008923 3300013308 Bacteria 8772
151 Ga0157375_10187290 3300013308 Bacteria 2223
152 Ga0157375_10910086 3300013308 Bacteria 1023
153 Ga0157375_11217335 3300013308 Bacteria 884
154 Ga0157375_12427331 3300013308 Bacteria 626
155 Ga0163163_10020847 3300014325 Bacteria 6179
156 Ga0163163_10060553 3300014325 Bacteria 3749
157 Ga0163163_10679571 3300014325 Bacteria 1093
158 Ga0157380_11095799 3300014326 Bacteria 835
159 Ga0157377_10019278 3300014745 Bacteria 3562
160 Ga0157377_10019428 3300014745 Bacteria 3550
161 Ga0157379_10086636 3300014968 Bacteria 2808
162 Ga0163161_10896341 3300017792 Bacteria 751
163 Ga0206356_11489755 3300020070 Bacteria 838
164 Ga0206354_11295076 3300020081 Bacteria 653
165 Ga0206353_10807704 3300020082 Bacteria 504
166 Ga0224712_10056616 3300022467 Bacteria 1547
167 Ga0207642_10368019 3300025899 Bacteria 852
168 Ga0207710_10022959 3300025900 Bacteria 2678
169 Ga0207688_10003974 3300025901 Bacteria 8060
170 Ga0207680_10575695 3300025903 Bacteria 805
171 Ga0207647_10021460 3300025904 Bacteria 4311
172 Ga0207645_10107722 3300025907 Bacteria 1803
173 Ga0207643_10000204 3300025908 Bacteria 41257
174 Ga0207643_10711211 3300025908 Bacteria 649
175 Ga0207705_10013621 3300025909 Bacteria 5867
176 Ga0207705_10049721 3300025909 Bacteria 3018
177 Ga0207654_10057903 3300025911 Bacteria 2254
178 Ga0207671_10399673 3300025914 Bacteria 1093
179 Ga0207660_10011767 3300025917 Bacteria 5704
180 Ga0207660_11176177 3300025917 Bacteria 624
181 Ga0207660_11438488 3300025917 Bacteria 558
182 Ga0207662_10077014 3300025918 Bacteria 2028
183 Ga0207662_10121290 3300025918 Bacteria 1640
184 Ga0207657_10018467 3300025919 Bacteria 6656
185 Ga0207657_10078196 3300025919 Bacteria 2786
186 Ga0207649_10373330 3300025920 Bacteria 1061
187 Ga0207649_10375664 3300025920 Bacteria 1058
188 Ga0207649_10970149 3300025920 Bacteria 668
189 Ga0207652_10009474 3300025921 Bacteria 7829
190 Ga0207646_10110174 3300025922 Bacteria 2471
191 Ga0207694_10787150 3300025924 Bacteria 803
192 Ga0207650_10000859 3300025925 Bacteria 23092
193 Ga0207650_11809169 3300025925 Bacteria 517
194 Ga0207659_10847088 3300025926 Bacteria 786
195 Ga0207687_10007160 3300025927 Bacteria 7354
196 Ga0207687_10009509 3300025927 Bacteria 6357
197 Ga0207664_10000019 3300025929 Bacteria 220528
198 Ga0207644_10014199 3300025931 Bacteria 5325
199 Ga0207690_10518445 3300025932 Bacteria 966
200 Ga0207706_10119008 3300025933 Bacteria 2322
201 Ga0207706_11430327 3300025933 Bacteria 567
202 Ga0207709_10031195 3300025935 Bacteria 3110
203 Ga0207709_10129555 3300025935 Bacteria 1717
204 Ga0207670_10007610 3300025936 Bacteria 6059
205 Ga0207669_10421405 3300025937 Bacteria 1051
206 Ga0207691_10064302 3300025940 Bacteria 3324
207 Ga0207691_11003534 3300025940 Bacteria 696
208 Ga0207711_10130421 3300025941 Bacteria 2253
209 Ga0207711_10997273 3300025941 Bacteria 777
210 Ga0207689_10000223 3300025942 Bacteria 50338
211 Ga0207689_10136527 3300025942 Bacteria 2020
212 Ga0207661_10157474 3300025944 Bacteria 1968
213 Ga0207661_10187257 3300025944 Bacteria 1812
214 Ga0207661_10964179 3300025944 Bacteria 785
215 Ga0207679_10024970 3300025945 Bacteria 4104
216 Ga0207679_10037711 3300025945 Bacteria 3438
217 Ga0207667_10211546 3300025949 Bacteria 1988
218 Ga0207651_10602424 3300025960 Bacteria 960
219 Ga0207712_11393448 3300025961 Bacteria 627
220 Ga0207640_10051509 3300025981 Bacteria 2676
221 Ga0207658_10805601 3300025986 Bacteria 853
222 Ga0207677_10043744 3300026023 Bacteria 2979
223 Ga0207703_10181135 3300026035 Bacteria 1859
224 Ga0207639_10357588 3300026041 Bacteria 1306
225 Ga0207678_10000183 3300026067 Bacteria 53634
226 Ga0207678_11366602 3300026067 Bacteria 626
227 Ga0207702_10003008 3300026078 Bacteria 15672
228 Ga0207702_10935089 3300026078 Bacteria 859
229 Ga0207648_10904197 3300026089 Bacteria 825
230 Ga0207676_10001332 3300026095 Bacteria 18376
231 Ga0207676_10063696 3300026095 Bacteria 2929
232 Ga0207674_10005483 3300026116 Bacteria 15069
233 Ga0207674_10047997 3300026116 Bacteria 4374
234 Ga0207675_100738190 3300026118 Bacteria 995
235 Ga0207683_10010694 3300026121 Bacteria 7821
236 Ga0207683_10044104 3300026121 Bacteria 3898
237 Ga0207683_10076091 3300026121 Bacteria 2972
238 Ga0207698_10053329 3300026142 Bacteria 3104
239 Ga0207698_10269888 3300026142 Bacteria 1568
240 Ga0207698_11847040 3300026142 Bacteria 619
241 Ga0207428_10007862 3300027907 Bacteria 9698
242 Ga0268266_10013489 3300028379 Bacteria 7035
243 Ga0268264_10160098 3300028381 Bacteria 2027
244 Ga0265340_10002327 3300031247 Bacteria 10855
245 Ga0307413_11131376 3300031824 Bacteria 678
246 Ga0307410_10083946 3300031852 Bacteria 2244
247 Ga0307407_10748521 3300031903 Bacteria 740
248 Ga0307416_101360440 3300032002 Bacteria 816
249 Ga0307414_11014369 3300032004 Bacteria 764
250 Ga0307411_11108487 3300032005 Bacteria 714
251 Ga0373961_0146756 3300035241 Bacteria 801
252 Ga0395899_0432662 3300037312 Bacteria 865
253 Ga0395900_0115466 3300037418 Bacteria 2754
254 Ga0395898_0801932 3300037466 Bacteria 882
255 Ga0395905_0014740 3300037471 Bacteria 7454
256 Ga0436364_0149183 3300037853 Bacteria 2911
257 Ga0395901_0228542 3300038443 Bacteria 1943
258 Ga0395901_0263204 3300038443 Bacteria 1795
259 Ga0451791_1640225 3300041451 Bacteria 751
260 Ga0451797_0378137 3300041453 Bacteria 863
261 Ga0451795_0908999 3300041456 Bacteria 608
262 Ga0451795_1353394 3300041456 Bacteria 727
263 Ga0451802_1439164 3300041460 Bacteria 974
264 Ga0451807_0701810 3300041486 Bacteria 956
265 Ga0451841_0306135 3300041498 Bacteria 742
266 Ga0451843_0843010 3300041509 Bacteria 2850
267 Ga0451843_1034932 3300041509 Bacteria 891
268 Ga0451853_2690963 3300041512 Bacteria 694
269 Ga0439448_0205477 3300042005 Bacteria 691
270 Ga0439448_0325651 3300042005 Bacteria 547
271 Ga0439450_025606 3300042008 Bacteria 1295
272 Ga0439455_0033538 3300042012 Bacteria 1288
273 Ga0439463_031072 3300042016 Bacteria 1347
274 Ga0450917_023995 3300042120 Bacteria 557
275 Ga0450902_020096 3300042137 Bacteria 1100
276 Ga0450903_048552 3300042138 Bacteria 623
277 Ga0439459_0005269 3300042438 Bacteria 2117
278 Ga0439459_0156926 3300042438 Bacteria 598
279 Ga0466969_0009709 3300044656 Bacteria 5100
280 Ga0466972_0032648 3300044658 Bacteria 2556
281 Ga0466966_0002927 3300044684 Bacteria 11250
282 Ga0466966_0142852 3300044684 Bacteria 1462
283 Ga0466966_0293976 3300044684 Bacteria 976
284 Ga0466966_0558526 3300044684 Bacteria 689
285 Ga0466961_0029103 3300044693 Bacteria 3552
286 Ga0466961_0111121 3300044693 Bacteria 1724
287 Ga0466961_0640774 3300044693 Bacteria 638
288 Ga0466963_0115538 3300044694 Bacteria 1844
289 Ga0466963_0249671 3300044694 Bacteria 1245
290 Ga0466963_0291075 3300044694 Bacteria 1148
291 Ga0466963_0374964 3300044694 Bacteria 1003
292 Ga0466963_0426878 3300044694 Bacteria 935
293 Ga0466963_0457200 3300044694 Bacteria 901
294 Ga0466963_0699068 3300044694 Bacteria 715
295 Ga0466971_0161507 3300044719 Bacteria 1049
296 Ga0466970_0002458 3300044765 Bacteria 8960
297 Ga0466957_0057972 3300044842 Bacteria 2372
298 Ga0466957_0295737 3300044842 Bacteria 1087
299 Ga0466957_0344806 3300044842 Bacteria 1009
300 Ga0466960_0040315 3300044901 Bacteria 2208
301 Ga0466960_0235041 3300044901 Bacteria 1013
302 Ga0466960_0309399 3300044901 Bacteria 892
303 Ga0466959_0012818 3300045049 Bacteria 6065
304 Ga0466959_0141985 3300045049 Bacteria 1696
305 Ga0466959_0176221 3300045049 Bacteria 1498
306 Ga0451576_0146835 3300045051 Bacteria 2459
307 Ga0466958_0004224 3300045836 Bacteria 7556
308 Ga0466958_1001470 3300045836 Bacteria 545
309 Ga0466967_0041654 3300045976 Bacteria 3962
310 Ga0466967_0063658 3300045976 Bacteria 3278
311 Ga0466967_0412901 3300045976 Bacteria 1315
312 Ga0466967_0618051 3300045976 Bacteria 1070
313 Ga0466967_0962918 3300045976 Bacteria 849
314 Ga0466967_2345501 3300045976 Bacteria 529
315 Ga0495641_0096217 3300046461 Bacteria 1322
316 Ga0495651_0001091 3300046462 Bacteria 20911
317 Ga0495653_0013721 3300046463 Bacteria 6603
318 Ga0495580_0019016 3300046472 Bacteria 5108
319 Ga0495662_0003967 3300046476 Bacteria 7463
320 Ga0495664_0088266 3300046477 Bacteria 1863
321 Ga0495606_0001262 3300046507 Bacteria 35224
322 Ga0495608_0012469 3300046511 Bacteria 5897
323 Ga0495628_0012756 3300046516 Bacteria 7076
324 Ga0495630_0025022 3300046517 Bacteria 4413
325 Ga0495666_0001072 3300046526 Bacteria 13019
326 Ga0495652_0028520 3300046529 Bacteria 4911
327 Ga0495665_0001570 3300046531 Bacteria 12206
328 Ga0495640_0035534 3300046533 Bacteria 3526
329 Ga0495587_0026277 3300046536 Bacteria 3550
330 Ga0495645_0003795 3300046543 Bacteria 10272
331 Ga0495667_0003103 3300046559 Bacteria 11143
332 Ga0495668_0005016 3300046616 Bacteria 9134
333 Ga0495668_0340439 3300046616 Bacteria 823
334 Ga0495634_0004575 3300046642 Bacteria 10802
335 Ga0495625_0000948 3300046660 Bacteria 38775
336 Ga0495635_0026235 3300046663 Bacteria 4056
337 Ga0495657_0004255 3300046675 Bacteria 11445
338 Ga0495623_0018119 3300046679 Bacteria 4547
339 Ga0495646_0067436 3300046680 Bacteria 2114
340 Ga0495647_0052652 3300046681 Bacteria 1586
341 Ga0495613_0001823 3300046689 Bacteria 16195
342 Ga0495600_0013171 3300046809 Bacteria 5188
343 Ga0495581_0009592 3300047315 Bacteria 5598
344 Ga0495604_0000612 3300047317 Bacteria 30635
345 Ga0495636_0308127 3300047318 Bacteria 742
346 Ga0495674_0063878 3300047319 Bacteria 3201
347 Ga0495683_0180649 3300047323 Bacteria 964
348 Ga0495675_0010378 3300047444 Bacteria 5822
349 Ga0495593_0005087 3300047673 Bacteria 7775
350 Ga0495602_0132263 3300048088 Bacteria 1987
351 Ga0495626_0002023 3300048091 Bacteria 14913
352 Ga0496101_0012930 3300048904 Bacteria 5583
353 Ga0496101_0792518 3300048904 Bacteria 747
354 Ga0496102_0010568 3300048905 Bacteria 7950
355 Ga0496102_0011361 3300048905 Bacteria 7673
356 Ga0496102_0284669 3300048905 Bacteria 1558
357 Ga0496103_0097951 3300048906 Bacteria 1854
358 Ga0496103_0204905 3300048906 Bacteria 1269
359 Ga0496104_0150617 3300048907 Bacteria 2233
360 Ga0496105_0000691 3300048908 Bacteria 22703
361 Ga0496105_0070584 3300048908 Bacteria 2888
362 Ga0496105_0533860 3300048908 Bacteria 918
363 Ga0496106_0001744 3300048909 Bacteria 16241
364 Ga0496108_0007397 3300048911 Bacteria 8905
365 Ga0496108_0415732 3300048911 Bacteria 1174
366 Ga0496109_0021019 3300048912 Bacteria 5770
367 Ga0496110_0001017 3300048913 Bacteria 19745
368 Ga0496110_1425878 3300048913 Bacteria 602
369 Ga0496111_0003398 3300048914 Bacteria 9844
370 Ga0496111_0006385 3300048914 Bacteria 7650
371 Ga0496111_0192625 3300048914 Bacteria 1515
372 Ga0496112_1087089 3300048915 Bacteria 718
373 Ga0496113_0018270 3300048916 Bacteria 4880
374 Ga0496113_0260537 3300048916 Bacteria 1385
375 Ga0496114_0072342 3300048917 Bacteria 2900
376 Ga0496114_0182204 3300048917 Bacteria 1835
377 Ga0496114_0405389 3300048917 Bacteria 1207
378 Ga0496114_0416518 3300048917 Bacteria 1190
379 Ga0496114_0495170 3300048917 Bacteria 1081
380 Ga0496114_1321650 3300048917 Bacteria 608
381 Ga0496118_0088358 3300048921 Bacteria 2144
382 Ga0496124_0154908 3300048927 Bacteria 1793
383 Ga0496126_0171509 3300048929 Bacteria 1848
384 Ga0501032_0065030 3300049569 Bacteria 2441
385 Ga0501032_0071236 3300049569 Bacteria 2317
386 Ga0501032_0127739 3300049569 Bacteria 1678
387 Ga0501032_0276238 3300049569 Bacteria 1088
388 Ga0501033_0050691 3300049570 Bacteria 3078
389 Ga0501033_0182032 3300049570 Bacteria 1506
390 Ga0501034_0022653 3300049571 Bacteria 6399
391 Ga0501034_0170994 3300049571 Bacteria 2140
392 Ga0501036_0013445 3300049572 Bacteria 6802
393 Ga0501036_0045854 3300049572 Bacteria 3702
394 Ga0501036_0190241 3300049572 Bacteria 1727
395 Ga0501037_0172359 3300049573 Bacteria 1537
396 Ga0501037_0352203 3300049573 Bacteria 1016
397 Ga0501037_1150055 3300049573 Bacteria 501
398 Ga0501038_0012965 3300049574 Bacteria 7604
399 Ga0501038_0035755 3300049574 Bacteria 4360
400 Ga0501039_0015006 3300049575 Bacteria 5927
401 Ga0501039_0071627 3300049575 Bacteria 2693
402 Ga0501039_0829781 3300049575 Bacteria 721
403 Ga0501039_1236807 3300049575 Bacteria 577
404 Ga0501040_0013154 3300049576 Bacteria 5442
405 Ga0501041_0127833 3300049577 Bacteria 1582
406 Ga0501042_0001600 3300049578 Bacteria 13468
407 Ga0501042_0009632 3300049578 Bacteria 6451
408 Ga0501042_0068106 3300049578 Bacteria 2545
409 Ga0501043_0008266 3300049579 Bacteria 8200
410 Ga0501043_0801185 3300049579 Bacteria 681
411 Ga0501046_0131097 3300049580 Bacteria 1902
412 Ga0501047_0025915 3300049581 Bacteria 5638
413 Ga0501047_0038391 3300049581 Bacteria 4634
414 Ga0501047_0159206 3300049581 Bacteria 2130
415 Ga0501048_0000534 3300049582 Bacteria 26788
416 Ga0501048_0002100 3300049582 Bacteria 15193
417 Ga0501048_0014098 3300049582 Bacteria 5924
418 Ga0501048_0302332 3300049582 Bacteria 1138
419 Ga0501068_0092015 3300049584 Bacteria 1872
420 Ga0501069_0027566 3300049585 Bacteria 3112
421 Ga0501070_0330395 3300049586 Bacteria 1239
422 Ga0501070_1080800 3300049586 Bacteria 619
423 Ga0501071_0001173 3300049587 Bacteria 14721
424 Ga0501072_0006206 3300049588 Bacteria 9102
425 Ga0501072_0067749 3300049588 Bacteria 2817
426 Ga0501073_0026670 3300049589 Bacteria 4137
427 Ga0501073_1246512 3300049589 Bacteria 510
428 Ga0501074_0012654 3300049590 Bacteria 6137
429 Ga0501074_0047597 3300049590 Bacteria 3099
430 Ga0501074_0050740 3300049590 Bacteria 2995
431 Ga0501075_0039238 3300049591 Bacteria 3544
432 Ga0501076_0003112 3300049592 Bacteria 11551
433 Ga0501076_0076556 3300049592 Bacteria 2683
434 Ga0501079_0070355 3300049741 Bacteria 2702
435 Ga0501079_0247880 3300049741 Bacteria 1392
436 Ga0501079_0380231 3300049741 Bacteria 1107
437 Ga0501081_0093119 3300049743 Bacteria 2121
438 Ga0501035_0048050 3300049822 Bacteria 3828
439 Ga0501035_0119334 3300049822 Bacteria 2307
440 Ga0501044_0056271 3300049823 Bacteria 4038
441 Ga0501044_0098754 3300049823 Bacteria 2939
442 Ga0501045_0063855 3300049824 Bacteria 2702
443 nmdc:mga00v17_35170_c1 3300050491 Bacteria 2979
444 nmdc:mga05p37_159628_c1 3300050507 Bacteria 2754
445 nmdc:mga06r32_13170_c1 3300050510 Bacteria 7491
446 nmdc:mga06r32_6204_c1 3300050510 Bacteria 10729
447 nmdc:mga06r32_643141_c1 3300050510 Bacteria 1029
448 nmdc:mga06r32_893511_c1 3300050510 Bacteria 845
449 nmdc:mga08y16_8110_c1 3300050511 Bacteria 10981
450 nmdc:mga0n895_14220_c1 3300050512 Bacteria 7219
451 nmdc:mga0rr50_4269_c1 3300050513 Bacteria 8366
452 nmdc:mga08x19_7096_c1 3300050514 Bacteria 6650
453 nmdc:mga0a205_21209_c1 3300050515 Bacteria 6144
454 Ga0495601_0033170 3300053077 Bacteria 3216
455 Ga0495655_0081689 3300053083 Bacteria 925
456 Ga0495655_0083297 3300053083 Bacteria 918
457 Ga0500594_0198762 3300053118 Bacteria 658
458 Ga0500573_0173806 3300053140 Bacteria 1163
459 Ga0500596_030120 3300053735 Bacteria 839
460 Ga0501084_0868017 3300054114 Bacteria 759
461 Ga0501084_1249342 3300054114 Bacteria 623
462 Ga0501082_0023184 3300060353 Bacteria 5354
463 Ga0466962_0204455 3300061719 Bacteria 965
464 Ga0466962_0293127 3300061719 Bacteria 804
465 Ga0466962_0445792 3300061719 Bacteria 651
466 Ga0530510_0104910 3300061734 Bacteria 2068
467 Ga0530510_0868573 3300061734 Bacteria 689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_11758772 Ga0114129_117587722 118
2 3300009148 Ga0105243_11222627 Ga0105243_112226272 119
3 3300046507 Ga0495606_0001262 Ga0495606_0001262_28939_29349 120
4 3300046616 Ga0495668_0005016 Ga0495668_0005016_4390_4800 120
5 3300046660 Ga0495625_0000948 Ga0495625_0000948_35727_36137 120
6 3300047323 Ga0495683_0180649 Ga0495683_0180649_218_628 120
7 3300048091 Ga0495626_0002023 Ga0495626_0002023_4560_4970 120
8 3300006871 Ga0075434_101140750 Ga0075434_1011407502 121
9 3300053083 Ga0495655_0081689 Ga0495655_0081689_41_415 121
10 3300041456 Ga0451795_1353394 Ga0451795_1353394_12_395 124
11 3300054114 Ga0501084_0868017 Ga0501084_0868017_234_620 125
12 3300013308 Ga0157375_10910086 Ga0157375_109100862 126
13 iso_pu_bacteria 2837268691 2837269156 126
14 iso_pu_bacteria 2868088558 2868092737 126
15 3300032002 Ga0307416_101360440 Ga0307416_1013604402 127
16 3300044656 Ga0466969_0009709 Ga0466969_0009709_675_1058 127
17 3300044684 Ga0466966_0002927 Ga0466966_0002927_7498_7881 127
18 3300044693 Ga0466961_0111121 Ga0466961_0111121_937_1320 127
19 3300045049 Ga0466959_0012818 Ga0466959_0012818_622_1005 127
20 iso_pu_bacteria 2616644941 2616903048 127
21 3300005347 Ga0070668_101013396 Ga0070668_1010133962 128
22 3300013105 Ga0157369_11875859 Ga0157369_118758591 128
23 3300013306 Ga0163162_11157592 Ga0163162_111575921 128
24 3300025924 Ga0207694_10787150 Ga0207694_107871502 128
25 3300025933 Ga0207706_11430327 Ga0207706_114303272 128
26 3300037418 Ga0395900_0115466 Ga0395900_0115466_1159_1545 128
27 3300041498 Ga0451841_0306135 Ga0451841_0306135_35_430 128
28 3300044694 Ga0466963_0457200 Ga0466963_0457200_273_659 128
29 3300045976 Ga0466967_0063658 Ga0466967_0063658_268_654 128
30 3300046462 Ga0495651_0001091 Ga0495651_0001091_10090_10503 128
31 3300046463 Ga0495653_0013721 Ga0495653_0013721_3622_4035 128
32 3300046472 Ga0495580_0019016 Ga0495580_0019016_1749_2162 128
33 3300046476 Ga0495662_0003967 Ga0495662_0003967_584_997 128
34 3300046477 Ga0495664_0088266 Ga0495664_0088266_1111_1524 128
35 3300046511 Ga0495608_0012469 Ga0495608_0012469_3586_3999 128
36 3300046516 Ga0495628_0012756 Ga0495628_0012756_220_633 128
37 3300046517 Ga0495630_0025022 Ga0495630_0025022_2612_3025 128
38 3300046526 Ga0495666_0001072 Ga0495666_0001072_2569_2982 128
39 3300046529 Ga0495652_0028520 Ga0495652_0028520_4002_4415 128
40 3300046531 Ga0495665_0001570 Ga0495665_0001570_1683_2096 128
41 3300046533 Ga0495640_0035534 Ga0495640_0035534_2617_3030 128
42 3300046536 Ga0495587_0026277 Ga0495587_0026277_2027_2440 128
43 3300046543 Ga0495645_0003795 Ga0495645_0003795_8749_9162 128
44 3300046559 Ga0495667_0003103 Ga0495667_0003103_10689_11102 128
45 3300046642 Ga0495634_0004575 Ga0495634_0004575_2519_2932 128
46 3300046663 Ga0495635_0026235 Ga0495635_0026235_320_733 128
47 3300046675 Ga0495657_0004255 Ga0495657_0004255_8730_9143 128
48 3300046679 Ga0495623_0018119 Ga0495623_0018119_497_910 128
49 3300046680 Ga0495646_0067436 Ga0495646_0067436_1414_1827 128
50 3300046689 Ga0495613_0001823 Ga0495613_0001823_14544_14957 128
51 3300046809 Ga0495600_0013171 Ga0495600_0013171_1317_1730 128
52 3300047315 Ga0495581_0009592 Ga0495581_0009592_4543_4956 128
53 3300047317 Ga0495604_0000612 Ga0495604_0000612_26749_27162 128
54 3300047319 Ga0495674_0063878 Ga0495674_0063878_1247_1660 128
55 3300047444 Ga0495675_0010378 Ga0495675_0010378_3383_3796 128
56 3300047673 Ga0495593_0005087 Ga0495593_0005087_1639_2052 128
57 3300048088 Ga0495602_0132263 Ga0495602_0132263_464_877 128
58 3300048917 Ga0496114_0182204 Ga0496114_0182204_1252_1647 128
59 3300053077 Ga0495601_0033170 Ga0495601_0033170_219_632 128
60 3300053140 Ga0500573_0173806 Ga0500573_0173806_386_799 128
61 3300005338 Ga0068868_100184056 Ga0068868_1001840562 129
62 3300005343 Ga0070687_100364288 Ga0070687_1003642882 129
63 3300005344 Ga0070661_100528370 Ga0070661_1005283702 129
64 3300005468 Ga0070707_100129500 Ga0070707_1001295002 129
65 3300005471 Ga0070698_100001827 Ga0070698_10000182714 129
66 3300005616 Ga0068852_100115133 Ga0068852_1001151333 129
67 3300009148 Ga0105243_11950512 Ga0105243_119505121 129
68 3300009545 Ga0105237_10702513 Ga0105237_107025132 129
69 3300010375 Ga0105239_10142062 Ga0105239_101420622 129
70 3300011119 Ga0105246_10304275 Ga0105246_103042752 129
71 3300013102 Ga0157371_10535092 Ga0157371_105350922 129
72 3300013105 Ga0157369_10200618 Ga0157369_102006182 129
73 3300013308 Ga0157375_11217335 Ga0157375_112173352 129
74 3300013308 Ga0157375_12427331 Ga0157375_124273312 129
75 3300014325 Ga0163163_10020847 Ga0163163_100208472 129
76 3300017792 Ga0163161_10896341 Ga0163161_108963411 129
77 3300020082 Ga0206353_10807704 Ga0206353_108077041 129
78 3300025920 Ga0207649_10373330 Ga0207649_103733302 129
79 3300025922 Ga0207646_10110174 Ga0207646_101101742 129
80 3300025941 Ga0207711_10997273 Ga0207711_109972732 129
81 3300026067 Ga0207678_11366602 Ga0207678_113666022 129
82 3300026142 Ga0207698_10053329 Ga0207698_100533292 129
83 3300035241 Ga0373961_0146756 Ga0373961_0146756_345_758 129
84 3300037471 Ga0395905_0014740 Ga0395905_0014740_4214_4603 129
85 3300037853 Ga0436364_0149183 Ga0436364_0149183_1680_2078 129
86 3300038443 Ga0395901_0228542 Ga0395901_0228542_1287_1676 129
87 3300041451 Ga0451791_1640225 Ga0451791_1640225_49_462 129
88 3300041453 Ga0451797_0378137 Ga0451797_0378137_119_523 129
89 3300041460 Ga0451802_1439164 Ga0451802_1439164_503_898 129
90 3300041486 Ga0451807_0701810 Ga0451807_0701810_157_561 129
91 3300041509 Ga0451843_1034932 Ga0451843_1034932_329_733 129
92 3300041512 Ga0451853_2690963 Ga0451853_2690963_137_544 129
93 3300042005 Ga0439448_0205477 Ga0439448_0205477_180_578 129
94 3300044658 Ga0466972_0032648 Ga0466972_0032648_720_1109 129
95 3300044684 Ga0466966_0142852 Ga0466966_0142852_827_1216 129
96 3300044693 Ga0466961_0640774 Ga0466961_0640774_207_596 129
97 3300044765 Ga0466970_0002458 Ga0466970_0002458_4427_4816 129
98 3300044842 Ga0466957_0057972 Ga0466957_0057972_1584_1973 129
99 3300044842 Ga0466957_0295737 Ga0466957_0295737_635_1024 129
100 3300044901 Ga0466960_0040315 Ga0466960_0040315_1603_1992 129
101 3300044901 Ga0466960_0309399 Ga0466960_0309399_395_784 129
102 3300045976 Ga0466967_0041654 Ga0466967_0041654_3359_3748 129
103 3300045976 Ga0466967_0618051 Ga0466967_0618051_288_680 129
104 3300046681 Ga0495647_0052652 Ga0495647_0052652_1100_1507 129
105 3300048904 Ga0496101_0792518 Ga0496101_0792518_161_568 129
106 3300048905 Ga0496102_0284669 Ga0496102_0284669_486_893 129
107 3300048907 Ga0496104_0150617 Ga0496104_0150617_858_1265 129
108 3300048908 Ga0496105_0533860 Ga0496105_0533860_163_561 129
109 3300048911 Ga0496108_0415732 Ga0496108_0415732_630_1037 129
110 3300048914 Ga0496111_0192625 Ga0496111_0192625_266_664 129
111 3300048916 Ga0496113_0260537 Ga0496113_0260537_681_1088 129
112 3300048917 Ga0496114_0405389 Ga0496114_0405389_604_999 129
113 3300048927 Ga0496124_0154908 Ga0496124_0154908_917_1315 129
114 3300048929 Ga0496126_0171509 Ga0496126_0171509_499_897 129
115 3300049569 Ga0501032_0065030 Ga0501032_0065030_885_1304 129
116 3300049572 Ga0501036_0045854 Ga0501036_0045854_3043_3462 129
117 3300049573 Ga0501037_1150055 Ga0501037_1150055_79_483 129
118 3300049575 Ga0501039_0829781 Ga0501039_0829781_43_447 129
119 3300049575 Ga0501039_1236807 Ga0501039_1236807_40_462 129
120 3300049576 Ga0501040_0013154 Ga0501040_0013154_1546_1965 129
121 3300049577 Ga0501041_0127833 Ga0501041_0127833_727_1146 129
122 3300049578 Ga0501042_0001600 Ga0501042_0001600_5580_5999 129
123 3300049580 Ga0501046_0131097 Ga0501046_0131097_179_598 129
124 3300049582 Ga0501048_0014098 Ga0501048_0014098_2598_3017 129
125 3300049584 Ga0501068_0092015 Ga0501068_0092015_334_753 129
126 3300049585 Ga0501069_0027566 Ga0501069_0027566_1423_1842 129
127 3300049586 Ga0501070_1080800 Ga0501070_1080800_158_568 129
128 3300049587 Ga0501071_0001173 Ga0501071_0001173_6069_6488 129
129 3300049588 Ga0501072_0006206 Ga0501072_0006206_2489_2908 129
130 3300049590 Ga0501074_0050740 Ga0501074_0050740_1845_2264 129
131 3300049591 Ga0501075_0039238 Ga0501075_0039238_316_735 129
132 3300049592 Ga0501076_0003112 Ga0501076_0003112_8873_9292 129
133 3300049741 Ga0501079_0070355 Ga0501079_0070355_241_660 129
134 3300049743 Ga0501081_0093119 Ga0501081_0093119_90_509 129
135 3300049824 Ga0501045_0063855 Ga0501045_0063855_2109_2528 129
136 3300053083 Ga0495655_0083297 Ga0495655_0083297_491_898 129
137 3300060353 Ga0501082_0023184 Ga0501082_0023184_1596_2015 129
138 3300061719 Ga0466962_0293127 Ga0466962_0293127_175_564 129
139 3300061734 Ga0530510_0868573 Ga0530510_0868573_200_616 129
140 iso_pu_bacteria 2515154155 2515855315 129
141 iso_pu_bacteria 2643221721 2644665769 129
142 iso_pu_bacteria 2855386786 2855390780 129
143 iso_pu_bacteria 2935890801 2935893271 129
144 3300005937 Ga0081455_10746354 Ga0081455_107463541 130
145 3300006038 Ga0075365_10000753 Ga0075365_100007537 130
146 3300006051 Ga0075364_10037038 Ga0075364_100370382 130
147 3300013104 Ga0157370_10004634 Ga0157370_1000463412 130
148 3300025917 Ga0207660_11438488 Ga0207660_114384882 130
149 3300025926 Ga0207659_10847088 Ga0207659_108470882 130
150 3300025929 Ga0207664_10000019 Ga0207664_1000001943 130
151 3300042438 Ga0439459_0156926 Ga0439459_0156926_76_468 130
152 3300044684 Ga0466966_0293976 Ga0466966_0293976_122_514 130
153 3300044684 Ga0466966_0558526 Ga0466966_0558526_208_600 130
154 3300044694 Ga0466963_0115538 Ga0466963_0115538_1118_1510 130
155 3300044694 Ga0466963_0249671 Ga0466963_0249671_161_553 130
156 3300044694 Ga0466963_0291075 Ga0466963_0291075_502_894 130
157 3300044694 Ga0466963_0374964 Ga0466963_0374964_18_410 130
158 3300044694 Ga0466963_0426878 Ga0466963_0426878_449_841 130
159 3300044694 Ga0466963_0699068 Ga0466963_0699068_220_612 130
160 3300044719 Ga0466971_0161507 Ga0466971_0161507_448_840 130
161 3300044842 Ga0466957_0344806 Ga0466957_0344806_108_500 130
162 3300045049 Ga0466959_0176221 Ga0466959_0176221_533_925 130
163 3300045836 Ga0466958_1001470 Ga0466958_1001470_122_514 130
164 3300045976 Ga0466967_0412901 Ga0466967_0412901_126_518 130
165 3300045976 Ga0466967_0962918 Ga0466967_0962918_374_766 130
166 3300045976 Ga0466967_2345501 Ga0466967_2345501_89_481 130
167 3300046616 Ga0495668_0340439 Ga0495668_0340439_242_643 130
168 3300049569 Ga0501032_0276238 Ga0501032_0276238_656_1048 130
169 3300049570 Ga0501033_0050691 Ga0501033_0050691_722_1120 130
170 3300049571 Ga0501034_0022653 Ga0501034_0022653_4691_5083 130
171 3300049572 Ga0501036_0013445 Ga0501036_0013445_2198_2590 130
172 3300049573 Ga0501037_0172359 Ga0501037_0172359_598_990 130
173 3300049574 Ga0501038_0035755 Ga0501038_0035755_2536_2928 130
174 3300049575 Ga0501039_0071627 Ga0501039_0071627_2112_2504 130
175 3300049578 Ga0501042_0009632 Ga0501042_0009632_2916_3308 130
176 3300049579 Ga0501043_0008266 Ga0501043_0008266_3886_4278 130
177 3300049581 Ga0501047_0038391 Ga0501047_0038391_1226_1618 130
178 3300049582 Ga0501048_0000534 Ga0501048_0000534_12383_12781 130
179 3300049582 Ga0501048_0002100 Ga0501048_0002100_14243_14635 130
180 3300049586 Ga0501070_0330395 Ga0501070_0330395_527_925 130
181 3300049589 Ga0501073_0026670 Ga0501073_0026670_2380_2772 130
182 3300049590 Ga0501074_0012654 Ga0501074_0012654_2886_3278 130
183 3300049822 Ga0501035_0048050 Ga0501035_0048050_1207_1605 130
184 3300049823 Ga0501044_0098754 Ga0501044_0098754_501_899 130
185 3300050491 nmdc:mga00v17_35170_c1 nmdc:mga00v17_35170_c1_2477_2875 130
186 3300053735 Ga0500596_030120 Ga0500596_030120_432_824 130
187 3300061719 Ga0466962_0445792 Ga0466962_0445792_57_449 130
188 3300061734 Ga0530510_0104910 Ga0530510_0104910_1324_1722 130
189 3300005985 Ga0081539_10017213 Ga0081539_100172136 131
190 3300006847 Ga0075431_100001720 Ga0075431_10000172013 131
191 3300050510 nmdc:mga06r32_6204_c1 nmdc:mga06r32_6204_c1_2058_2459 131
192 3300005543 Ga0070672_101138662 Ga0070672_1011386621 132
193 3300009177 Ga0105248_11629433 Ga0105248_116294331 132
194 3300013306 Ga0163162_11562198 Ga0163162_115621981 132
195 3300014325 Ga0163163_10679571 Ga0163163_106795712 132
196 3300025940 Ga0207691_11003534 Ga0207691_110035341 132
197 3300026121 Ga0207683_10076091 Ga0207683_100760913 132
198 3300031824 Ga0307413_11131376 Ga0307413_111313761 132
199 3300031852 Ga0307410_10083946 Ga0307410_100839462 132
200 3300032004 Ga0307414_11014369 Ga0307414_110143692 132
201 3300032005 Ga0307411_11108487 Ga0307411_111084872 132
202 3300044901 Ga0466960_0235041 Ga0466960_0235041_235_666 132
203 3300047318 Ga0495636_0308127 Ga0495636_0308127_58_465 132
204 3300048917 Ga0496114_1321650 Ga0496114_1321650_132_563 132
205 3300049569 Ga0501032_0127739 Ga0501032_0127739_488_907 132
206 3300049570 Ga0501033_0182032 Ga0501033_0182032_874_1293 132
207 3300049573 Ga0501037_0352203 Ga0501037_0352203_162_581 132
208 3300049575 Ga0501039_0015006 Ga0501039_0015006_4492_4911 132
209 3300049578 Ga0501042_0068106 Ga0501042_0068106_635_1060 132
210 3300049581 Ga0501047_0025915 Ga0501047_0025915_2215_2634 132
211 3300049588 Ga0501072_0067749 Ga0501072_0067749_745_1164 132
212 3300049592 Ga0501076_0076556 Ga0501076_0076556_1795_2214 132
213 3300049741 Ga0501079_0247880 Ga0501079_0247880_115_555 132
214 3300049741 Ga0501079_0380231 Ga0501079_0380231_527_946 132
215 3300049822 Ga0501035_0119334 Ga0501035_0119334_1337_1756 132
216 3300049823 Ga0501044_0056271 Ga0501044_0056271_2220_2639 132
217 3300050510 nmdc:mga06r32_643141_c1 nmdc:mga06r32_643141_c1_121_519 132
218 3300054114 Ga0501084_1249342 Ga0501084_1249342_153_581 132
219 3300005337 Ga0070682_100507549 Ga0070682_1005075492 133
220 3300005456 Ga0070678_101227548 Ga0070678_1012275481 133
221 3300005535 Ga0070684_100461659 Ga0070684_1004616592 133
222 3300009098 Ga0105245_10379252 Ga0105245_103792521 133
223 3300020081 Ga0206354_11295076 Ga0206354_112950762 133
224 3300031247 Ga0265340_10002327 Ga0265340_100023278 133
225 3300031903 Ga0307407_10748521 Ga0307407_107485212 133
226 3300041456 Ga0451795_0908999 Ga0451795_0908999_138_542 133
227 3300041509 Ga0451843_0843010 Ga0451843_0843010_744_1214 133
228 3300048908 Ga0496105_0070584 Ga0496105_0070584_1384_1791 133
229 3300048913 Ga0496110_1425878 Ga0496110_1425878_137_541 133
230 3300048917 Ga0496114_0416518 Ga0496114_0416518_706_1110 133
231 3300048917 Ga0496114_0495170 Ga0496114_0495170_271_675 133
232 3300053118 Ga0500594_0198762 Ga0500594_0198762_193_600 133
233 3300002459 JGI24751J29686_10003335 JGI24751J29686_100033352 134
234 3300003203 JGI25406J46586_10054901 JGI25406J46586_100549012 134
235 3300005289 Ga0065704_10330192 Ga0065704_103301922 134
236 3300005327 Ga0070658_10039000 Ga0070658_100390002 134
237 3300005327 Ga0070658_11662840 Ga0070658_116628402 134
238 3300005327 Ga0070658_11764518 Ga0070658_117645181 134
239 3300005328 Ga0070676_10133754 Ga0070676_101337542 134
240 3300005329 Ga0070683_100001419 Ga0070683_1000014197 134
241 3300005329 Ga0070683_100877449 Ga0070683_1008774492 134
242 3300005330 Ga0070690_100198444 Ga0070690_1001984442 134
243 3300005331 Ga0070670_100028083 Ga0070670_1000280833 134
244 3300005334 Ga0068869_100047975 Ga0068869_1000479752 134
245 3300005334 Ga0068869_100162245 Ga0068869_1001622452 134
246 3300005335 Ga0070666_10179324 Ga0070666_101793242 134
247 3300005336 Ga0070680_100003706 Ga0070680_1000037064 134
248 3300005336 Ga0070680_100949759 Ga0070680_1009497592 134
249 3300005337 Ga0070682_100004861 Ga0070682_1000048614 134
250 3300005337 Ga0070682_100005511 Ga0070682_1000055116 134
251 3300005338 Ga0068868_100022672 Ga0068868_1000226722 134
252 3300005339 Ga0070660_100067725 Ga0070660_1000677252 134
253 3300005341 Ga0070691_10004532 Ga0070691_100045326 134
254 3300005343 Ga0070687_100668970 Ga0070687_1006689702 134
255 3300005344 Ga0070661_100033883 Ga0070661_1000338832 134
256 3300005344 Ga0070661_100591919 Ga0070661_1005919192 134
257 3300005345 Ga0070692_10004363 Ga0070692_100043632 134
258 3300005345 Ga0070692_10069429 Ga0070692_100694292 134
259 3300005347 Ga0070668_100319964 Ga0070668_1003199641 134
260 3300005354 Ga0070675_100019411 Ga0070675_1000194113 134
261 3300005355 Ga0070671_100021056 Ga0070671_1000210564 134
262 3300005364 Ga0070673_100631306 Ga0070673_1006313062 134
263 3300005364 Ga0070673_101317131 Ga0070673_1013171311 134
264 3300005366 Ga0070659_100011774 Ga0070659_1000117744 134
265 3300005366 Ga0070659_100072838 Ga0070659_1000728382 134
266 3300005444 Ga0070694_100736205 Ga0070694_1007362052 134
267 3300005455 Ga0070663_100005840 Ga0070663_1000058406 134
268 3300005455 Ga0070663_100479021 Ga0070663_1004790212 134
269 3300005456 Ga0070678_100002551 Ga0070678_1000025514 134
270 3300005456 Ga0070678_100027637 Ga0070678_1000276374 134
271 3300005457 Ga0070662_100163234 Ga0070662_1001632342 134
272 3300005457 Ga0070662_101207293 Ga0070662_1012072932 134
273 3300005458 Ga0070681_10153010 Ga0070681_101530102 134
274 3300005459 Ga0068867_100903348 Ga0068867_1009033481 134
275 3300005466 Ga0070685_10198811 Ga0070685_101988112 134
276 3300005530 Ga0070679_100154362 Ga0070679_1001543623 134
277 3300005535 Ga0070684_100001579 Ga0070684_10000157915 134
278 3300005539 Ga0068853_100012771 Ga0068853_1000127714 134
279 3300005543 Ga0070672_100253736 Ga0070672_1002537362 134
280 3300005545 Ga0070695_100039579 Ga0070695_1000395793 134
281 3300005546 Ga0070696_100349607 Ga0070696_1003496072 134
282 3300005547 Ga0070693_100003363 Ga0070693_1000033638 134
283 3300005547 Ga0070693_100254662 Ga0070693_1002546622 134
284 3300005548 Ga0070665_100004127 Ga0070665_10000412715 134
285 3300005548 Ga0070665_101019257 Ga0070665_1010192572 134
286 3300005549 Ga0070704_100583098 Ga0070704_1005830981 134
287 3300005549 Ga0070704_101072162 Ga0070704_1010721622 134
288 3300005563 Ga0068855_100078875 Ga0068855_1000788752 134
289 3300005563 Ga0068855_100415323 Ga0068855_1004153232 134
290 3300005564 Ga0070664_100039164 Ga0070664_1000391643 134
291 3300005577 Ga0068857_100050318 Ga0068857_1000503184 134
292 3300005578 Ga0068854_100006376 Ga0068854_1000063765 134
293 3300005578 Ga0068854_101297847 Ga0068854_1012978472 134
294 3300005614 Ga0068856_100113084 Ga0068856_1001130842 134
295 3300005615 Ga0070702_100001410 Ga0070702_10000141010 134
296 3300005616 Ga0068852_100017856 Ga0068852_1000178565 134
297 3300005617 Ga0068859_100071949 Ga0068859_1000719496 134
298 3300005618 Ga0068864_100023735 Ga0068864_1000237354 134
299 3300005618 Ga0068864_100058298 Ga0068864_1000582984 134
300 3300005719 Ga0068861_100760111 Ga0068861_1007601112 134
301 3300005834 Ga0068851_10030503 Ga0068851_100305033 134
302 3300005840 Ga0068870_10002418 Ga0068870_100024184 134
303 3300005840 Ga0068870_10766789 Ga0068870_107667891 134
304 3300005841 Ga0068863_100009759 Ga0068863_1000097592 134
305 3300005842 Ga0068858_100150547 Ga0068858_1001505472 134
306 3300005843 Ga0068860_100068588 Ga0068860_1000685882 134
307 3300005985 Ga0081539_10000238 Ga0081539_1000023811 134
308 3300006058 Ga0075432_10019715 Ga0075432_100197152 134
309 3300006237 Ga0097621_100022781 Ga0097621_1000227812 134
310 3300006358 Ga0068871_100034455 Ga0068871_1000344554 134
311 3300006358 Ga0068871_101553367 Ga0068871_1015533671 134
312 3300006844 Ga0075428_100057114 Ga0075428_1000571142 134
313 3300006847 Ga0075431_101270680 Ga0075431_1012706802 134
314 3300006852 Ga0075433_10003466 Ga0075433_1000346612 134
315 3300006871 Ga0075434_100008167 Ga0075434_1000081676 134
316 3300006914 Ga0075436_100002226 Ga0075436_10000222615 134
317 3300006931 Ga0097620_100071944 Ga0097620_1000719446 134
318 3300007076 Ga0075435_100026916 Ga0075435_1000269164 134
319 3300009011 Ga0105251_10024250 Ga0105251_100242503 134
320 3300009093 Ga0105240_10706549 Ga0105240_107065492 134
321 3300009094 Ga0111539_10024062 Ga0111539_100240626 134
322 3300009098 Ga0105245_10019865 Ga0105245_100198657 134
323 3300009098 Ga0105245_10073096 Ga0105245_100730964 134
324 3300009101 Ga0105247_10043223 Ga0105247_100432232 134
325 3300009147 Ga0114129_10511206 Ga0114129_105112062 134
326 3300009148 Ga0105243_10262445 Ga0105243_102624452 134
327 3300009174 Ga0105241_10002283 Ga0105241_1000228311 134
328 3300009177 Ga0105248_10030094 Ga0105248_100300947 134
329 3300009177 Ga0105248_10056909 Ga0105248_100569092 134
330 3300009545 Ga0105237_10067135 Ga0105237_100671353 134
331 3300009545 Ga0105237_10621240 Ga0105237_106212402 134
332 3300009551 Ga0105238_10225327 Ga0105238_102253272 134
333 3300009553 Ga0105249_10081579 Ga0105249_100815792 134
334 3300009553 Ga0105249_11460510 Ga0105249_114605102 134
335 3300010375 Ga0105239_10016479 Ga0105239_100164795 134
336 3300010375 Ga0105239_10016902 Ga0105239_100169023 134
337 3300011119 Ga0105246_10002791 Ga0105246_100027914 134
338 3300013100 Ga0157373_10031647 Ga0157373_100316473 134
339 3300013102 Ga0157371_10011527 Ga0157371_100115273 134
340 3300013102 Ga0157371_10150527 Ga0157371_101505272 134
341 3300013104 Ga0157370_10838582 Ga0157370_108385822 134
342 3300013104 Ga0157370_11348503 Ga0157370_113485031 134
343 3300013105 Ga0157369_10067624 Ga0157369_100676244 134
344 3300013105 Ga0157369_10072485 Ga0157369_100724855 134
345 3300013105 Ga0157369_10657274 Ga0157369_106572741 134
346 3300013296 Ga0157374_10043380 Ga0157374_100433804 134
347 3300013306 Ga0163162_10009205 Ga0163162_100092052 134
348 3300013306 Ga0163162_10775032 Ga0163162_107750322 134
349 3300013307 Ga0157372_10022729 Ga0157372_100227296 134
350 3300013307 Ga0157372_10249661 Ga0157372_102496612 134
351 3300013308 Ga0157375_10008923 Ga0157375_100089232 134
352 3300013308 Ga0157375_10187290 Ga0157375_101872903 134
353 3300014325 Ga0163163_10060553 Ga0163163_100605532 134
354 3300014326 Ga0157380_11095799 Ga0157380_110957992 134
355 3300014745 Ga0157377_10019278 Ga0157377_100192782 134
356 3300014745 Ga0157377_10019428 Ga0157377_100194284 134
357 3300014968 Ga0157379_10086636 Ga0157379_100866363 134
358 3300020070 Ga0206356_11489755 Ga0206356_114897552 134
359 3300022467 Ga0224712_10056616 Ga0224712_100566162 134
360 3300025899 Ga0207642_10368019 Ga0207642_103680192 134
361 3300025900 Ga0207710_10022959 Ga0207710_100229592 134
362 3300025901 Ga0207688_10003974 Ga0207688_100039742 134
363 3300025903 Ga0207680_10575695 Ga0207680_105756952 134
364 3300025904 Ga0207647_10021460 Ga0207647_100214603 134
365 3300025907 Ga0207645_10107722 Ga0207645_101077222 134
366 3300025908 Ga0207643_10000204 Ga0207643_1000020422 134
367 3300025908 Ga0207643_10711211 Ga0207643_107112112 134
368 3300025909 Ga0207705_10013621 Ga0207705_100136214 134
369 3300025909 Ga0207705_10049721 Ga0207705_100497212 134
370 3300025911 Ga0207654_10057903 Ga0207654_100579032 134
371 3300025914 Ga0207671_10399673 Ga0207671_103996732 134
372 3300025917 Ga0207660_10011767 Ga0207660_100117675 134
373 3300025917 Ga0207660_11176177 Ga0207660_111761772 134
374 3300025918 Ga0207662_10077014 Ga0207662_100770142 134
375 3300025918 Ga0207662_10121290 Ga0207662_101212902 134
376 3300025919 Ga0207657_10018467 Ga0207657_100184672 134
377 3300025919 Ga0207657_10078196 Ga0207657_100781962 134
378 3300025920 Ga0207649_10375664 Ga0207649_103756642 134
379 3300025920 Ga0207649_10970149 Ga0207649_109701492 134
380 3300025921 Ga0207652_10009474 Ga0207652_100094742 134
381 3300025925 Ga0207650_10000859 Ga0207650_1000085919 134
382 3300025925 Ga0207650_11809169 Ga0207650_118091691 134
383 3300025927 Ga0207687_10007160 Ga0207687_100071603 134
384 3300025927 Ga0207687_10009509 Ga0207687_100095092 134
385 3300025931 Ga0207644_10014199 Ga0207644_100141994 134
386 3300025932 Ga0207690_10518445 Ga0207690_105184452 134
387 3300025933 Ga0207706_10119008 Ga0207706_101190082 134
388 3300025935 Ga0207709_10031195 Ga0207709_100311952 134
389 3300025935 Ga0207709_10129555 Ga0207709_101295552 134
390 3300025936 Ga0207670_10007610 Ga0207670_100076104 134
391 3300025937 Ga0207669_10421405 Ga0207669_104214052 134
392 3300025940 Ga0207691_10064302 Ga0207691_100643024 134
393 3300025941 Ga0207711_10130421 Ga0207711_101304212 134
394 3300025942 Ga0207689_10000223 Ga0207689_1000022329 134
395 3300025942 Ga0207689_10136527 Ga0207689_101365273 134
396 3300025944 Ga0207661_10157474 Ga0207661_101574742 134
397 3300025944 Ga0207661_10187257 Ga0207661_101872572 134
398 3300025944 Ga0207661_10964179 Ga0207661_109641792 134
399 3300025945 Ga0207679_10024970 Ga0207679_100249703 134
400 3300025945 Ga0207679_10037711 Ga0207679_100377115 134
401 3300025949 Ga0207667_10211546 Ga0207667_102115462 134
402 3300025960 Ga0207651_10602424 Ga0207651_106024242 134
403 3300025961 Ga0207712_11393448 Ga0207712_113934482 134
404 3300025981 Ga0207640_10051509 Ga0207640_100515093 134
405 3300025986 Ga0207658_10805601 Ga0207658_108056011 134
406 3300026023 Ga0207677_10043744 Ga0207677_100437442 134
407 3300026035 Ga0207703_10181135 Ga0207703_101811352 134
408 3300026041 Ga0207639_10357588 Ga0207639_103575882 134
409 3300026067 Ga0207678_10000183 Ga0207678_100001838 134
410 3300026078 Ga0207702_10003008 Ga0207702_1000300814 134
411 3300026078 Ga0207702_10935089 Ga0207702_109350892 134
412 3300026089 Ga0207648_10904197 Ga0207648_109041972 134
413 3300026095 Ga0207676_10001332 Ga0207676_1000133214 134
414 3300026095 Ga0207676_10063696 Ga0207676_100636963 134
415 3300026116 Ga0207674_10005483 Ga0207674_100054834 134
416 3300026116 Ga0207674_10047997 Ga0207674_100479972 134
417 3300026118 Ga0207675_100738190 Ga0207675_1007381902 134
418 3300026121 Ga0207683_10010694 Ga0207683_100106947 134
419 3300026121 Ga0207683_10044104 Ga0207683_100441042 134
420 3300026142 Ga0207698_10269888 Ga0207698_102698882 134
421 3300026142 Ga0207698_11847040 Ga0207698_118470402 134
422 3300027907 Ga0207428_10007862 Ga0207428_100078627 134
423 3300028379 Ga0268266_10013489 Ga0268266_100134894 134
424 3300028381 Ga0268264_10160098 Ga0268264_101600982 134
425 3300037312 Ga0395899_0432662 Ga0395899_0432662_53_457 134
426 3300037466 Ga0395898_0801932 Ga0395898_0801932_201_605 134
427 3300038443 Ga0395901_0263204 Ga0395901_0263204_1016_1420 134
428 3300042005 Ga0439448_0325651 Ga0439448_0325651_44_457 134
429 3300042008 Ga0439450_025606 Ga0439450_025606_734_1138 134
430 3300042012 Ga0439455_0033538 Ga0439455_0033538_415_819 134
431 3300042016 Ga0439463_031072 Ga0439463_031072_348_752 134
432 3300042120 Ga0450917_023995 Ga0450917_023995_28_432 134
433 3300042137 Ga0450902_020096 Ga0450902_020096_229_633 134
434 3300042138 Ga0450903_048552 Ga0450903_048552_114_518 134
435 3300042438 Ga0439459_0005269 Ga0439459_0005269_592_996 134
436 3300044693 Ga0466961_0029103 Ga0466961_0029103_555_1067 134
437 3300045049 Ga0466959_0141985 Ga0466959_0141985_701_1213 134
438 3300045051 Ga0451576_0146835 Ga0451576_0146835_1744_2157 134
439 3300045836 Ga0466958_0004224 Ga0466958_0004224_5167_5679 134
440 3300046461 Ga0495641_0096217 Ga0495641_0096217_436_927 134
441 3300048904 Ga0496101_0012930 Ga0496101_0012930_4363_4767 134
442 3300048905 Ga0496102_0010568 Ga0496102_0010568_6110_6523 134
443 3300048905 Ga0496102_0011361 Ga0496102_0011361_1347_1751 134
444 3300048906 Ga0496103_0097951 Ga0496103_0097951_303_716 134
445 3300048906 Ga0496103_0204905 Ga0496103_0204905_724_1128 134
446 3300048908 Ga0496105_0000691 Ga0496105_0000691_2603_3007 134
447 3300048909 Ga0496106_0001744 Ga0496106_0001744_3755_4159 134
448 3300048911 Ga0496108_0007397 Ga0496108_0007397_2081_2485 134
449 3300048912 Ga0496109_0021019 Ga0496109_0021019_1318_1731 134
450 3300048913 Ga0496110_0001017 Ga0496110_0001017_17249_17653 134
451 3300048914 Ga0496111_0003398 Ga0496111_0003398_4662_5066 134
452 3300048914 Ga0496111_0006385 Ga0496111_0006385_2852_3265 134
453 3300048915 Ga0496112_1087089 Ga0496112_1087089_205_618 134
454 3300048916 Ga0496113_0018270 Ga0496113_0018270_2163_2567 134
455 3300048917 Ga0496114_0072342 Ga0496114_0072342_2015_2419 134
456 3300048921 Ga0496118_0088358 Ga0496118_0088358_723_1139 134
457 3300049569 Ga0501032_0071236 Ga0501032_0071236_623_1051 134
458 3300049571 Ga0501034_0170994 Ga0501034_0170994_1460_1888 134
459 3300049572 Ga0501036_0190241 Ga0501036_0190241_1021_1449 134
460 3300049574 Ga0501038_0012965 Ga0501038_0012965_6718_7146 134
461 3300049579 Ga0501043_0801185 Ga0501043_0801185_173_601 134
462 3300049581 Ga0501047_0159206 Ga0501047_0159206_1183_1611 134
463 3300049582 Ga0501048_0302332 Ga0501048_0302332_447_875 134
464 3300049589 Ga0501073_1246512 Ga0501073_1246512_35_463 134
465 3300049590 Ga0501074_0047597 Ga0501074_0047597_1609_2037 134
466 3300050507 nmdc:mga05p37_159628_c1 nmdc:mga05p37_159628_c1_30_434 134
467 3300050510 nmdc:mga06r32_13170_c1 nmdc:mga06r32_13170_c1_3728_4135 134
468 3300050510 nmdc:mga06r32_893511_c1 nmdc:mga06r32_893511_c1_130_534 134
469 3300050511 nmdc:mga08y16_8110_c1 nmdc:mga08y16_8110_c1_4554_4958 134
470 3300050512 nmdc:mga0n895_14220_c1 nmdc:mga0n895_14220_c1_53_457 134
471 3300050513 nmdc:mga0rr50_4269_c1 nmdc:mga0rr50_4269_c1_5731_6135 134
472 3300050514 nmdc:mga08x19_7096_c1 nmdc:mga08x19_7096_c1_376_780 134
473 3300050515 nmdc:mga0a205_21209_c1 nmdc:mga0a205_21209_c1_5443_5847 134
474 3300061719 Ga0466962_0204455 Ga0466962_0204455_32_544 134
475 iso_pu_bacteria 2835188231 2835191078 134
476 iso_pu_bacteria 2887443736 2887447209 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

6

111

0.82

PF08211

dCMP_cyt_deam_2

Cytidine and deoxycytidylate deaminase zinc-binding region

2

90

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kw6-assembly1.cif.gz_A crystal structure of cytidine deaminase from streptomyces noursei 0.9653 4 122
3r2n-assembly1.cif.gz_C crystal structure of cytidine deaminase from mycobacterium leprae 0.9636 4 121
4f3w-assembly1.cif.gz_C crystal structure of cytidine deaminase cdd from mycobacterium marinum 0.9629 4 121
6kw6-assembly1.cif.gz_A crystal structure of cytidine deaminase from streptomyces noursei 0.9573 4 122
3r2n-assembly1.cif.gz_C crystal structure of cytidine deaminase from mycobacterium leprae 0.9478 4 121
ID Description Score Start End Superfamily
1ctuA02 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9288 7 80 3.40.140.10
4wigA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9216 4 127 3.40.140.10
af_Q9S7S2_9_133_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9065 15 76 3.40.140.10
4wigA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9001 4 127 3.40.140.10
af_Q9S789_14_154_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8756 7 120 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A259SAC9-F1-model_v4 Cytidine deaminase 0.982 4 92 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A6B3G8F7-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9806 19 111 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A7J9Y1T5-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9803 1 96 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A656L360-F1-model_v4 deleted 0.9748 1 99
AF-A0A3S3EDI6-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9742 1 96 GO:0004126
GO:0005829
GO:0008270
GO:0009972

Feature Viewer

pLDDT pTM Quality
91.68 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map