F451601

General Info

Members Datasets Scaffolds Average Seq Length
476 236 952 314

Family's Representative Sequence

Representative Sequence 3300049663|Ga0501223_004313|Ga0501223_004313_1747_2694
Length 290
Sequence MSAIKETHFKLPGQTNFYKGKVRDVYTIGDKLLVMVVSDRISAFDVVLPEPIPFKGQVLNQIAAKFLNATQDIVPNWVLDVPDPSVTVGKICEPFKVEMVIRGYLAGHAWREYSAGRREVCGVKLPEGLKENDKLPEPIITPTTKASVGHDEDILYQRGTELAAERGLILVDTKYEFGKNEGRIHLIDEIHTPDSSRYFYKEGYAELQDKGLPQRQLSKEFVRKWLIENGFQGKDGQKVPEMNFELVESISNRYIELYEHITGESFIRSDSPEIYKRVEKNIIESLNRLN

Samples

Sample ID Description Type Environment
1 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
119 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
120 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
121 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
187 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
193 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
196 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
197 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
198 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
199 2738541284 Pedobacter sp. YR016 Isolate Unclassified
200 2738541302 Pedobacter sp. CF074 Isolate Unclassified
201 2738543023 Pedobacter sp. OK628 Isolate Unclassified
202 2739367651 Pedobacter sp. OK291 Isolate Unclassified
203 2739367656 Pedobacter sp. CF523 Isolate Unclassified
204 2739367663 Pedobacter sp. YR510 Isolate Unclassified
205 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
206 2818991437 Pedobacter terrae 518 Isolate Unclassified
207 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
208 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
209 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
210 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
211 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
212 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
213 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
214 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
215 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
216 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
217 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
218 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
219 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
220 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
221 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
222 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
223 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
224 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
225 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
226 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
227 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
228 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
229 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
230 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
231 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
232 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
233 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
234 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
235 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
236 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.39
Metatranscriptomes 0
Isolates 8.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.98
Nodule 0
Rhizoplane 0.63
Rhizosphere 81.72
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501223_004313 3300049663 Bacteria 3057
2 SwRhRL2b_contig_3465298 2162886007 Bacteria 2901
3 JGI24740J21852_10011033 3300001979 Bacteria 3455
4 JGI24737J22298_10001721 3300001990 Bacteria 7796
5 JGI24737J22298_10002039 3300001990 Bacteria 7227
6 JGI24737J22298_10004539 3300001990 Bacteria 4832
7 JGI24735J21928_10000002 3300002067 Bacteria 624895
8 JGI24744J21845_10001999 3300002077 Bacteria 4119
9 JGI25162J39368_1000024 3300002737 Bacteria 229507
10 JGI25162J39368_1002079 3300002737 Bacteria 8582
11 JGI25164J39214_1000915 3300002772 Bacteria 9818
12 JGI25152J39213_1000305 3300002773 Bacteria 31834
13 JGI25150J39212_1000009 3300002774 Bacteria 249509
14 JGI25151J46595_10000017 3300003187 Bacteria 249509
15 JGI25153J46596_10000023 3300003215 Bacteria 249509
16 rootH1_10003751 3300003316 Bacteria 5454
17 rootH2_10002858 3300003320 Bacteria 54174
18 rootH2_10035181 3300003320 Bacteria 29518
19 rootH2_10222511 3300003320 Bacteria 2070
20 rootH2_10271918 3300003320 Bacteria 3788
21 rootL2_10330908 3300003322 Bacteria 3081
22 rootL2_10352556 3300003322 Bacteria 1512
23 rootH1_10012846 3300003323 Bacteria 47357
24 rootH1_10233974 3300003323 Bacteria 2543
25 Ga0055536_1000011 3300003781 Bacteria 275969
26 Ga0055531_10000023 3300003794 Bacteria 165025
27 Ga0065714_10002919 3300005288 Bacteria 20677
28 Ga0065714_10004347 3300005288 Bacteria 8211
29 Ga0065714_10065450 3300005288 Bacteria 10008
30 Ga0065714_10067540 3300005288 Bacteria 5395
31 Ga0065714_10070992 3300005288 Bacteria 3697
32 Ga0065714_10077047 3300005288 Bacteria 2727
33 Ga0065704_10000238 3300005289 Bacteria 87424
34 Ga0065704_10001253 3300005289 Bacteria 8928
35 Ga0065704_10077771 3300005289 Bacteria 4626
36 Ga0065704_10086594 3300005289 Bacteria 3103
37 Ga0070658_10000011 3300005327 Bacteria 294396
38 Ga0070658_10150386 3300005327 Bacteria 1949
39 Ga0070676_10018038 3300005328 Bacteria 3908
40 Ga0070683_100161856 3300005329 Bacteria 2123
41 Ga0070680_100004089 3300005336 Bacteria 10926
42 Ga0068868_100033298 3300005338 Bacteria 3971
43 Ga0068868_100085106 3300005338 Bacteria 2540
44 Ga0070660_100035518 3300005339 Bacteria 3773
45 Ga0070660_100171009 3300005339 Bacteria 1755
46 Ga0070660_100191242 3300005339 Bacteria 1658
47 Ga0070668_100129928 3300005347 Bacteria 2021
48 Ga0070671_100006251 3300005355 Bacteria 9487
49 Ga0070673_100007272 3300005364 Bacteria 7290
50 Ga0070659_100000920 3300005366 Bacteria 21557
51 Ga0070659_100001700 3300005366 Bacteria 15810
52 Ga0070659_100015915 3300005366 Bacteria 5641
53 Ga0070694_100156949 3300005444 Bacteria 1666
54 Ga0070663_100023539 3300005455 Bacteria 4130
55 Ga0070662_100002169 3300005457 Bacteria 12029
56 Ga0070662_100170744 3300005457 Bacteria 1708
57 Ga0070679_100026195 3300005530 Bacteria 5725
58 Ga0070679_100028754 3300005530 Bacteria 5483
59 Ga0070679_100212628 3300005530 Bacteria 1897
60 Ga0068853_100018105 3300005539 Bacteria 5825
61 Ga0068853_100256153 3300005539 Bacteria 1607
62 Ga0070672_100181330 3300005543 Bacteria 1755
63 Ga0070665_100000003 3300005548 Bacteria 811857
64 Ga0068855_100000134 3300005563 Bacteria 94864
65 Ga0068855_100001554 3300005563 Bacteria 28837
66 Ga0068855_100060043 3300005563 Bacteria 4448
67 Ga0068855_100109465 3300005563 Bacteria 3173
68 Ga0068855_100111589 3300005563 Bacteria 3139
69 Ga0068855_100126703 3300005563 Bacteria 2919
70 Ga0068855_100176375 3300005563 Bacteria 2418
71 Ga0068855_100244643 3300005563 Bacteria 2003
72 Ga0068855_100319240 3300005563 Bacteria 1717
73 Ga0068857_100067595 3300005577 Bacteria 3181
74 Ga0068857_100090443 3300005577 Bacteria 2739
75 Ga0068854_100197554 3300005578 Bacteria 1579
76 Ga0068856_100001155 3300005614 Bacteria 27745
77 Ga0068856_100005924 3300005614 Bacteria 12032
78 Ga0068856_100053928 3300005614 Bacteria 3965
79 Ga0068856_100130947 3300005614 Bacteria 2513
80 Ga0068856_100285592 3300005614 Bacteria 1667
81 Ga0068852_100002395 3300005616 Bacteria 12919
82 Ga0068852_100241933 3300005616 Bacteria 1725
83 Ga0068858_100421052 3300005842 Bacteria 1284
84 Ga0068862_100032189 3300005844 Bacteria 4430
85 Ga0075367_10094222 3300006178 Bacteria 1825
86 Ga0075366_10001161 3300006195 Bacteria 13031
87 Ga0075366_10096759 3300006195 Bacteria 1770
88 Ga0097621_100000033 3300006237 Bacteria 69289
89 Ga0068871_100000020 3300006358 Bacteria 84930
90 Ga0068865_100000138 3300006881 Bacteria 38207
91 Ga0105244_10047045 3300009036 Bacteria 2214
92 Ga0105240_10000068 3300009093 Bacteria 207756
93 Ga0105240_10004790 3300009093 Bacteria 20399
94 Ga0105240_10080404 3300009093 Bacteria 4008
95 Ga0105240_10085251 3300009093 Bacteria 3871
96 Ga0105240_10120727 3300009093 Bacteria 3156
97 Ga0105240_10124018 3300009093 Bacteria 3107
98 Ga0105240_10217713 3300009093 Bacteria 2226
99 Ga0105240_10266114 3300009093 Bacteria 1976
100 Ga0105243_10000043 3300009148 Bacteria 158809
101 Ga0105243_10154820 3300009148 Bacteria 1970
102 Ga0105241_10007200 3300009174 Bacteria 8187
103 Ga0105241_10037105 3300009174 Bacteria 3671
104 Ga0105241_10071600 3300009174 Bacteria 2691
105 Ga0105241_10080311 3300009174 Bacteria 2552
106 Ga0105241_10205342 3300009174 Bacteria 1648
107 Ga0105242_10105849 3300009176 Bacteria 2390
108 Ga0105242_10487940 3300009176 Bacteria 1169
109 Ga0105237_10000274 3300009545 Bacteria 72354
110 Ga0105237_10000803 3300009545 Bacteria 42892
111 Ga0105237_10001914 3300009545 Bacteria 26581
112 Ga0105237_10011972 3300009545 Bacteria 9168
113 Ga0105237_10184432 3300009545 Bacteria 2087
114 Ga0105237_10191206 3300009545 Bacteria 2047
115 Ga0105238_10002195 3300009551 Bacteria 19712
116 Ga0105238_10246472 3300009551 Bacteria 1764
117 Ga0105239_10000005 3300010375 Bacteria 496066
118 Ga0105239_10000013 3300010375 Bacteria 327371
119 Ga0105239_10001207 3300010375 Bacteria 35283
120 Ga0105239_10005491 3300010375 Bacteria 14869
121 Ga0105239_10012287 3300010375 Bacteria 9537
122 Ga0105239_10025930 3300010375 Bacteria 6455
123 Ga0105239_10036215 3300010375 Bacteria 5419
124 Ga0105239_10052523 3300010375 Bacteria 4469
125 Ga0105239_10061388 3300010375 Bacteria 4125
126 Ga0105246_10042927 3300011119 Bacteria 3065
127 Ga0157373_10000597 3300013100 Bacteria 28042
128 Ga0157373_10001101 3300013100 Bacteria 20720
129 Ga0157373_10003455 3300013100 Bacteria 11955
130 Ga0157373_10027077 3300013100 Bacteria 4137
131 Ga0157373_10086720 3300013100 Bacteria 2206
132 Ga0157371_10000009 3300013102 Bacteria 392895
133 Ga0157371_10006726 3300013102 Bacteria 9400
134 Ga0157371_10009908 3300013102 Bacteria 7462
135 Ga0157371_10011053 3300013102 Bacteria 6992
136 Ga0157371_10015094 3300013102 Bacteria 5806
137 Ga0157371_10021642 3300013102 Bacteria 4718
138 Ga0157371_10048438 3300013102 Bacteria 3020
139 Ga0157371_10073410 3300013102 Bacteria 2423
140 Ga0157370_10021758 3300013104 Bacteria 6388
141 Ga0157370_10035402 3300013104 Bacteria 4852
142 Ga0157370_10085468 3300013104 Bacteria 2964
143 Ga0157370_10119289 3300013104 Bacteria 2463
144 Ga0157370_10120880 3300013104 Bacteria 2445
145 Ga0157369_10000006 3300013105 Bacteria 412230
146 Ga0157369_10004541 3300013105 Bacteria 16330
147 Ga0157369_10454130 3300013105 Bacteria 1327
148 Ga0157374_10000349 3300013296 Bacteria 42687
149 Ga0157374_10000950 3300013296 Bacteria 25156
150 Ga0157378_10007782 3300013297 Bacteria 9354
151 Ga0157378_10037249 3300013297 Bacteria 4307
152 Ga0163162_10000066 3300013306 Bacteria 100009
153 Ga0163162_10000126 3300013306 Bacteria 68238
154 Ga0163162_10004715 3300013306 Bacteria 13147
155 Ga0163162_10459196 3300013306 Bacteria 1405
156 Ga0157372_10000001 3300013307 Bacteria 791349
157 Ga0157372_10000730 3300013307 Bacteria 35818
158 Ga0157372_10001042 3300013307 Bacteria 30342
159 Ga0157372_10002233 3300013307 Bacteria 21015
160 Ga0157372_10003847 3300013307 Bacteria 16131
161 Ga0157372_10013624 3300013307 Bacteria 8691
162 Ga0157372_10062766 3300013307 Bacteria 4164
163 Ga0157375_10006708 3300013308 Bacteria 10029
164 Ga0157375_10086135 3300013308 Bacteria 3192
165 Ga0163163_10040830 3300014325 Bacteria 4533
166 Ga0182008_10000010 3300014497 Bacteria 301527
167 Ga0182008_10121878 3300014497 Bacteria 1296
168 Ga0182008_10130963 3300014497 Bacteria 1250
169 Ga0157376_10195977 3300014969 Bacteria 1855
170 Ga0157376_10232671 3300014969 Bacteria 1713
171 Ga0182006_1001802 3300015261 Bacteria 12350
172 Ga0182006_1002437 3300015261 Bacteria 10164
173 Ga0182006_1002897 3300015261 Bacteria 9111
174 Ga0182006_1003732 3300015261 Bacteria 7696
175 Ga0182007_10000001 3300015262 Bacteria 1127301
176 Ga0183373_1006 3300015682 Bacteria 328276
177 Ga0163161_10000908 3300017792 Bacteria 22914
178 Ga0163161_10028158 3300017792 Bacteria 3988
179 Ga0163161_10106214 3300017792 Bacteria 2095
180 Ga0163161_10112228 3300017792 Bacteria 2039
181 Ga0213876_10100621 3300021384 Bacteria 1532
182 Ga0207427_101537 3300025231 Bacteria 8070
183 Ga0209437_100017 3300025233 Bacteria 694471
184 Ga0209437_100052 3300025233 Bacteria 380548
185 Ga0207425_1000007 3300025245 Bacteria 777411
186 Ga0209026_1001668 3300025250 Bacteria 9372
187 Ga0209026_1002004 3300025250 Bacteria 8091
188 Ga0209026_1003364 3300025250 Bacteria 5302
189 Ga0209129_1000006 3300025258 Bacteria 777761
190 Ga0209129_1007615 3300025258 Bacteria 3180
191 Ga0209233_1000067 3300025261 Bacteria 380554
192 Ga0209233_1002062 3300025261 Bacteria 7612
193 Ga0209233_1004960 3300025261 Bacteria 4473
194 Ga0209233_1011090 3300025261 Bacteria 2667
195 Ga0209676_1000001 3300025292 Bacteria 1852142
196 Ga0209025_1000025 3300025294 Bacteria 524454
197 Ga0209758_1000016 3300025297 Bacteria 778557
198 Ga0209050_1000016 3300025298 Bacteria 729149
199 Ga0209257_1000013 3300025304 Bacteria 1047305
200 Ga0207647_10000665 3300025904 Bacteria 26867
201 Ga0207647_10003255 3300025904 Bacteria 12193
202 Ga0207647_10007550 3300025904 Bacteria 7844
203 Ga0207645_10000131 3300025907 Bacteria 56813
204 Ga0207705_10000015 3300025909 Bacteria 382901
205 Ga0207654_10002377 3300025911 Bacteria 9633
206 Ga0207654_10002510 3300025911 Bacteria 9323
207 Ga0207695_10000131 3300025913 Bacteria 223762
208 Ga0207695_10003136 3300025913 Bacteria 23615
209 Ga0207695_10019218 3300025913 Bacteria 7868
210 Ga0207695_10101200 3300025913 Bacteria 2876
211 Ga0207695_10167357 3300025913 Bacteria 2125
212 Ga0207671_10000787 3300025914 Bacteria 40182
213 Ga0207671_10001653 3300025914 Bacteria 25337
214 Ga0207671_10004792 3300025914 Bacteria 12745
215 Ga0207671_10017823 3300025914 Bacteria 5463
216 Ga0207671_10065135 3300025914 Bacteria 2710
217 Ga0207671_10110040 3300025914 Bacteria 2095
218 Ga0207657_10085247 3300025919 Bacteria 2646
219 Ga0207652_10064528 3300025921 Bacteria 3169
220 Ga0207694_10167603 3300025924 Bacteria 1777
221 Ga0207700_10121586 3300025928 Bacteria 2118
222 Ga0207644_10003897 3300025931 Bacteria 9670
223 Ga0207690_10002508 3300025932 Bacteria 11093
224 Ga0207690_10007018 3300025932 Bacteria 6678
225 Ga0207690_10008351 3300025932 Bacteria 6146
226 Ga0207690_10205845 3300025932 Bacteria 1497
227 Ga0207706_10000126 3300025933 Bacteria 82630
228 Ga0207706_10195774 3300025933 Bacteria 1773
229 Ga0207709_10000021 3300025935 Bacteria 386722
230 Ga0207709_10124436 3300025935 Bacteria 1746
231 Ga0207704_10000109 3300025938 Bacteria 45314
232 Ga0207661_10131122 3300025944 Bacteria 2147
233 Ga0207667_10000020 3300025949 Bacteria 374770
234 Ga0207667_10001127 3300025949 Bacteria 33693
235 Ga0207667_10005980 3300025949 Bacteria 14801
236 Ga0207667_10057566 3300025949 Bacteria 4080
237 Ga0207667_10103526 3300025949 Bacteria 2936
238 Ga0207667_10188030 3300025949 Bacteria 2119
239 Ga0207667_10386910 3300025949 Bacteria 1425
240 Ga0207640_10215993 3300025981 Bacteria 1465
241 Ga0207677_10010526 3300026023 Bacteria 5238
242 Ga0207677_10014631 3300026023 Bacteria 4589
243 Ga0207677_10261604 3300026023 Bacteria 1411
244 Ga0207703_10508204 3300026035 Bacteria 1132
245 Ga0207639_10052686 3300026041 Bacteria 3102
246 Ga0207678_10008598 3300026067 Bacteria 8996
247 Ga0207702_10011441 3300026078 Bacteria 7396
248 Ga0207702_10012211 3300026078 Bacteria 7148
249 Ga0207702_10028114 3300026078 Bacteria 4672
250 Ga0207702_10067058 3300026078 Bacteria 3079
251 Ga0207648_10000155 3300026089 Bacteria 69524
252 Ga0207674_10018890 3300026116 Bacteria 7475
253 Ga0207674_10102510 3300026116 Bacteria 2842
254 Ga0207698_10012144 3300026142 Bacteria 5621
255 Ga0207698_10084618 3300026142 Bacteria 2572
256 Ga0207698_10286190 3300026142 Bacteria 1527
257 Ga0268266_10000052 3300028379 Bacteria 296230
258 Ga0268265_10088588 3300028380 Bacteria 2466
259 Ga0307517_10045196 3300028786 Bacteria 4634
260 Ga0307515_10000794 3300028794 Bacteria 72827
261 Ga0307515_10014388 3300028794 Bacteria 14675
262 Ga0307515_10035890 3300028794 Bacteria 8046
263 Ga0307515_10104015 3300028794 Bacteria 3398
264 Ga0265338_10003902 3300028800 Bacteria 20592
265 Ga0265338_10175193 3300028800 Bacteria 1640
266 Ga0316177_1206954 3300030731 Bacteria 3258
267 Ga0316176_1036636 3300030732 Bacteria 8285
268 Ga0316183_1052145 3300030742 Bacteria 6019
269 Ga0316181_1257525 3300030744 Bacteria 3916
270 Ga0316181_1289097 3300030744 Bacteria 2457
271 Ga0265327_10000098 3300031251 Bacteria 190693
272 Ga0265327_10110151 3300031251 Bacteria 1317
273 Ga0307509_10133513 3300031507 Bacteria 2432
274 Ga0307408_100000361 3300031548 Bacteria 42263
275 Ga0307408_100002588 3300031548 Bacteria 12612
276 Ga0307408_100077815 3300031548 Bacteria 2470
277 Ga0307408_100092653 3300031548 Bacteria 2284
278 Ga0316579_10062682 3300031691 Bacteria 1751
279 Ga0316576_10030287 3300031727 Unclassified 3831
280 Ga0316578_10015538 3300031728 Bacteria 4096
281 Ga0316578_10015833 3300031728 Bacteria 4066
282 Ga0316578_10033405 3300031728 Unclassified 2947
283 Ga0307405_10000010 3300031731 Bacteria 250978
284 Ga0316577_10126994 3300031733 Bacteria 1434
285 Ga0316577_10129563 3300031733 Bacteria 1419
286 Ga0307407_10000009 3300031903 Bacteria 188746
287 Ga0307412_10000018 3300031911 Bacteria 284374
288 Ga0307416_100000019 3300032002 Bacteria 199706
289 Ga0307414_10001246 3300032004 Bacteria 13119
290 Ga0307414_10006456 3300032004 Bacteria 6540
291 Ga0307414_10008047 3300032004 Bacteria 5959
292 Ga0307414_10032550 3300032004 Bacteria 3434
293 Ga0307414_10056670 3300032004 Bacteria 2750
294 Ga0307414_10064516 3300032004 Bacteria 2608
295 Ga0307414_10071442 3300032004 Bacteria 2503
296 Ga0307414_10111535 3300032004 Bacteria 2083
297 Ga0307414_10114764 3300032004 Bacteria 2058
298 Ga0316585_10015384 3300032137 Bacteria 2294
299 Ga0307507_10000064 3300033179 Bacteria 161226
300 Ga0307510_10032848 3300033180 Bacteria 5842
301 Ga0316574_0069642 3300035398 Bacteria 2221
302 Ga0316582_0011549 3300036647 Bacteria 4888
303 Ga0316584_0192264 3300036712 Bacteria 1508
304 Ga0395899_0000001 3300037312 Bacteria 1750322
305 Ga0395899_0000435 3300037312 Bacteria 47985
306 Ga0395899_0004805 3300037312 Bacteria 10519
307 Ga0395900_0000014 3300037418 Bacteria 386513
308 Ga0395900_0000873 3300037418 Bacteria 39536
309 Ga0395900_0037412 3300037418 Bacteria 5004
310 Ga0395900_0203852 3300037418 Bacteria 2000
311 Ga0395900_0222475 3300037418 Bacteria 1902
312 Ga0395905_0000037 3300037471 Bacteria 261808
313 Ga0395905_0000516 3300037471 Bacteria 52868
314 Ga0395901_0000166 3300038443 Bacteria 86352
315 Ga0395901_0046427 3300038443 Bacteria 4512
316 Ga0400483_046378 3300039062 Bacteria 16370
317 Ga0436365_0829770 3300039437 Bacteria 1795
318 Ga0436361_1061278 3300039447 Bacteria 5717
319 Ga0451855_0709033 3300041511 Bacteria 1296
320 Ga0439448_0023518 3300042005 Bacteria 1923
321 Ga0451577_0000946 3300042876 Bacteria 42577
322 Ga0451577_0010632 3300042876 Bacteria 8772
323 Ga0451577_0082551 3300042876 Bacteria 2867
324 Ga0451577_0128362 3300042876 Bacteria 2273
325 Ga0451577_0160053 3300042876 Bacteria 2027
326 Ga0451577_0272144 3300042876 Bacteria 1534
327 Ga0451577_0333338 3300042876 Unclassified 1376
328 Ga0451577_0445790 3300042876 Bacteria 1175
329 Ga0466969_0026733 3300044656 Bacteria 2959
330 Ga0453683_0000061 3300044673 Bacteria 185470
331 Ga0453683_0000148 3300044673 Bacteria 103686
332 Ga0453683_0013359 3300044673 Bacteria 5365
333 Ga0453683_0038616 3300044673 Bacteria 3001
334 Ga0453683_0118857 3300044673 Bacteria 1664
335 Ga0453683_0134905 3300044673 Bacteria 1556
336 Ga0453683_0138742 3300044673 Bacteria 1534
337 Ga0453683_0396640 3300044673 Bacteria 889
338 Ga0466966_0014442 3300044684 Bacteria 5228
339 Ga0466961_0049499 3300044693 Bacteria 2686
340 Ga0453684_0000353 3300044712 Bacteria 191059
341 Ga0453684_0000608 3300044712 Bacteria 131904
342 Ga0453684_0001620 3300044712 Bacteria 61605
343 Ga0453684_0005017 3300044712 Bacteria 26881
344 Ga0453684_0009864 3300044712 Bacteria 16528
345 Ga0453684_0018496 3300044712 Bacteria 10689
346 Ga0453684_0026966 3300044712 Bacteria 8271
347 Ga0453684_0027794 3300044712 Bacteria 8096
348 Ga0453684_0031997 3300044712 Bacteria 7376
349 Ga0453684_0032369 3300044712 Bacteria 7320
350 Ga0453684_0033162 3300044712 Bacteria 7205
351 Ga0453684_0034362 3300044712 Bacteria 7038
352 Ga0453684_0035589 3300044712 Bacteria 6878
353 Ga0453684_0039365 3300044712 Bacteria 6444
354 Ga0453684_0053745 3300044712 Bacteria 5254
355 Ga0453684_0070105 3300044712 Bacteria 4441
356 Ga0453684_0082354 3300044712 Bacteria 4009
357 Ga0453684_0092189 3300044712 Bacteria 3736
358 Ga0453684_0182438 3300044712 Bacteria 2463
359 Ga0453684_0190118 3300044712 Bacteria 2402
360 Ga0453684_0563791 3300044712 Unclassified 1253
361 Ga0453684_0607026 3300044712 Bacteria 1198
362 Ga0451576_0001207 3300045051 Bacteria 46109
363 Ga0451576_0018238 3300045051 Bacteria 7697
364 Ga0451576_0030297 3300045051 Bacteria 5783
365 Ga0451576_0039968 3300045051 Bacteria 4966
366 Ga0451576_0044192 3300045051 Bacteria 4698
367 Ga0451576_0089336 3300045051 Bacteria 3204
368 Ga0451576_0166085 3300045051 Bacteria 2304
369 Ga0451576_0423077 3300045051 Unclassified 1398
370 Ga0451576_0461442 3300045051 Bacteria 1334
371 Ga0451576_0544920 3300045051 Bacteria 1219
372 Ga0451576_0661141 3300045051 Bacteria 1098
373 Ga0466958_0082537 3300045836 Bacteria 1980
374 Ga0495592_0144477 3300046454 Bacteria 1651
375 Ga0495651_0089457 3300046462 Bacteria 2311
376 Ga0495651_0178019 3300046462 Bacteria 1508
377 Ga0495650_0000003 3300046471 Bacteria 900730
378 Ga0495585_0000079 3300046492 Bacteria 100159
379 Ga0495585_0000315 3300046492 Bacteria 48036
380 Ga0495596_0018071 3300046500 Bacteria 2910
381 Ga0495583_0038965 3300046506 Bacteria 2242
382 Ga0495606_0000163 3300046507 Bacteria 117268
383 Ga0495606_0054497 3300046507 Bacteria 2590
384 Ga0495610_0000028 3300046512 Bacteria 272572
385 Ga0495610_0001494 3300046512 Bacteria 20548
386 Ga0495610_0003905 3300046512 Bacteria 11308
387 Ga0495610_0080029 3300046512 Bacteria 1503
388 Ga0495616_0003711 3300046513 Bacteria 9739
389 Ga0495616_0004582 3300046513 Bacteria 8698
390 Ga0495648_0002715 3300046524 Bacteria 15984
391 Ga0495648_0032230 3300046524 Bacteria 3442
392 Ga0495652_0139503 3300046529 Bacteria 1908
393 Ga0495609_0035707 3300046538 Bacteria 2249
394 Ga0495633_0000056 3300046558 Bacteria 149334
395 Ga0495633_0016933 3300046558 Bacteria 3739
396 Ga0495633_0053305 3300046558 Bacteria 1904
397 Ga0495668_0000044 3300046616 Bacteria 227585
398 Ga0495625_0000159 3300046660 Bacteria 104355
399 Ga0495625_0022826 3300046660 Bacteria 4788
400 Ga0495625_0082950 3300046660 Bacteria 2228
401 Ga0495625_0084483 3300046660 Bacteria 2204
402 Ga0495625_0093975 3300046660 Bacteria 2069
403 Ga0495625_0286554 3300046660 Bacteria 1058
404 Ga0495661_0001324 3300046665 Bacteria 21027
405 Ga0495661_0080660 3300046665 Bacteria 1877
406 Ga0495658_0023724 3300046683 Bacteria 3260
407 Ga0495649_0000003 3300046694 Bacteria 880817
408 Ga0495649_0048032 3300046694 Bacteria 2320
409 Ga0495683_0052742 3300047323 Bacteria 2030
410 Ga0495687_000527 3300047443 Bacteria 45682
411 Ga0495687_038454 3300047443 Bacteria 2123
412 Ga0495686_0000160 3300047472 Bacteria 128437
413 Ga0495686_0002432 3300047472 Bacteria 17594
414 Ga0495686_0061589 3300047472 Bacteria 2330
415 Ga0496101_0167813 3300048904 Bacteria 1686
416 Ga0496114_0018524 3300048917 Bacteria 5631
417 Ga0496116_0001728 3300048919 Bacteria 23852
418 Ga0496117_0003269 3300048920 Bacteria 19047
419 Ga0496121_0001160 3300048924 Bacteria 46200
420 Ga0496122_0006115 3300048925 Bacteria 14014
421 Ga0496125_0116479 3300048928 Bacteria 1919
422 Ga0495678_010125 3300049459 Bacteria 4599
423 Ga0501245_010308 3300049708 Bacteria 1349
424 Ga0501241_002856 3300049758 Bacteria 3315
425 nmdc:mga0k408_111_c1 3300050493 Bacteria 39614
426 nmdc:mga0k408_88_c1 3300050493 Bacteria 43334
427 nmdc:mga06z11_74070_c1 3300050494 Bacteria 1809
428 Ga0500635_0001310 3300053080 Bacteria 5947
429 Ga0500651_0000250 3300053093 Bacteria 32639
430 Ga0500608_000994 3300053122 Bacteria 10206
431 Ga0500608_010239 3300053122 Bacteria 4019
432 Ga0500618_000003 3300053125 Bacteria 338706
433 Ga0500618_023165 3300053125 Bacteria 1506
434 Ga0500622_0001498 3300053156 Bacteria 18574
435 Ga0500624_001881 3300053157 Bacteria 3036
436 2586207388 2585427687 Bacteria 5544917
437 2599478652 2599185184 Bacteria 6430550
438 2722726337 2721755487 Bacteria 6357185
439 2738760838 2738541284 Bacteria 5199923
440 2738853769 2738541302 Bacteria 5944758
441 2739304017 2738543023 Bacteria 6767879
442 2739588579 2739367651 Bacteria 6359826
443 2739615921 2739367656 Bacteria 5152243
444 2739645027 2739367663 Bacteria 5040914
445 2776613022 2775506987 Bacteria 5373360
446 2819549835 2818991437 Bacteria 5805520
447 2839992277 2839989709 Bacteria 3773432
448 2842723720 2842722452 Bacteria 6263924
449 2842905775 2842903701 Bacteria 6986368
450 2842910225 2842909656 Bacteria 6185908
451 2849285250 2849281842 Bacteria 6065644
452 2852623679 2852623160 Bacteria 4376875
453 2852627349 2852627209 Bacteria 5896285
454 2857628954 2857627736 Bacteria 5625397
455 2884937417 2884933994 Bacteria 4535041
456 2890739572 2890737413 Bacteria 4269751
457 2890805893 2890804823 Bacteria 3717572
458 2896319306 2896317667 Bacteria 4606601
459 2896346130 2896344016 Bacteria 3811746
460 2898716255 2898713307 Bacteria 4110805
461 2902051405 2902048731 Bacteria 4976191
462 2904445863 2904445276 Bacteria 5310396
463 2904783776 2904780799 Bacteria 5840761
464 2919181974 2919177583 Bacteria 5641607
465 2919187382 2919186247 Bacteria 6244071
466 2919441334 2919437846 Bacteria 6199444
467 2919694663 2919692658 Bacteria 5943958
468 2928080292 2928078545 Bacteria 6534839
469 2928149535 2928147474 Bacteria 6512076
470 2932083365 2932082852 Bacteria 6563563
471 2939665351 2939664404 Bacteria 6364494
472 2946000436 2945997725 Bacteria 6404843
473 2954017457 2954016120 Bacteria 6446024
474 2977236184 2977232053 Bacteria 5485925
475 3003234769 3003233435 Bacteria 4458031
476 8055589914 8055588893 Bacteria 3619545
477 Ga0501223_004313
478 SwRhRL2b_contig_3465298
479 JGI24740J21852_10011033
480 JGI24737J22298_10001721
481 JGI24737J22298_10002039
482 JGI24737J22298_10004539
483 JGI24735J21928_10000002
484 JGI24744J21845_10001999
485 JGI25162J39368_1000024
486 JGI25162J39368_1002079
487 JGI25164J39214_1000915
488 JGI25152J39213_1000305
489 JGI25150J39212_1000009
490 JGI25151J46595_10000017
491 JGI25153J46596_10000023
492 rootH1_10003751
493 rootH2_10002858
494 rootH2_10035181
495 rootH2_10222511
496 rootH2_10271918
497 rootL2_10330908
498 rootL2_10352556
499 rootH1_10012846
500 rootH1_10233974
501 Ga0055536_1000011
502 Ga0055531_10000023
503 Ga0065714_10002919
504 Ga0065714_10004347
505 Ga0065714_10065450
506 Ga0065714_10067540
507 Ga0065714_10070992
508 Ga0065714_10077047
509 Ga0065704_10000238
510 Ga0065704_10001253
511 Ga0065704_10077771
512 Ga0065704_10086594
513 Ga0070658_10000011
514 Ga0070658_10150386
515 Ga0070676_10018038
516 Ga0070683_100161856
517 Ga0070680_100004089
518 Ga0068868_100033298
519 Ga0068868_100085106
520 Ga0070660_100035518
521 Ga0070660_100171009
522 Ga0070660_100191242
523 Ga0070668_100129928
524 Ga0070671_100006251
525 Ga0070673_100007272
526 Ga0070659_100000920
527 Ga0070659_100001700
528 Ga0070659_100015915
529 Ga0070694_100156949
530 Ga0070663_100023539
531 Ga0070662_100002169
532 Ga0070662_100170744
533 Ga0070679_100026195
534 Ga0070679_100028754
535 Ga0070679_100212628
536 Ga0068853_100018105
537 Ga0068853_100256153
538 Ga0070672_100181330
539 Ga0070665_100000003
540 Ga0068855_100000134
541 Ga0068855_100001554
542 Ga0068855_100060043
543 Ga0068855_100109465
544 Ga0068855_100111589
545 Ga0068855_100126703
546 Ga0068855_100176375
547 Ga0068855_100244643
548 Ga0068855_100319240
549 Ga0068857_100067595
550 Ga0068857_100090443
551 Ga0068854_100197554
552 Ga0068856_100001155
553 Ga0068856_100005924
554 Ga0068856_100053928
555 Ga0068856_100130947
556 Ga0068856_100285592
557 Ga0068852_100002395
558 Ga0068852_100241933
559 Ga0068858_100421052
560 Ga0068862_100032189
561 Ga0075367_10094222
562 Ga0075366_10001161
563 Ga0075366_10096759
564 Ga0097621_100000033
565 Ga0068871_100000020
566 Ga0068865_100000138
567 Ga0105244_10047045
568 Ga0105240_10000068
569 Ga0105240_10004790
570 Ga0105240_10080404
571 Ga0105240_10085251
572 Ga0105240_10120727
573 Ga0105240_10124018
574 Ga0105240_10217713
575 Ga0105240_10266114
576 Ga0105243_10000043
577 Ga0105243_10154820
578 Ga0105241_10007200
579 Ga0105241_10037105
580 Ga0105241_10071600
581 Ga0105241_10080311
582 Ga0105241_10205342
583 Ga0105242_10105849
584 Ga0105242_10487940
585 Ga0105237_10000274
586 Ga0105237_10000803
587 Ga0105237_10001914
588 Ga0105237_10011972
589 Ga0105237_10184432
590 Ga0105237_10191206
591 Ga0105238_10002195
592 Ga0105238_10246472
593 Ga0105239_10000005
594 Ga0105239_10000013
595 Ga0105239_10001207
596 Ga0105239_10005491
597 Ga0105239_10012287
598 Ga0105239_10025930
599 Ga0105239_10036215
600 Ga0105239_10052523
601 Ga0105239_10061388
602 Ga0105246_10042927
603 Ga0157373_10000597
604 Ga0157373_10001101
605 Ga0157373_10003455
606 Ga0157373_10027077
607 Ga0157373_10086720
608 Ga0157371_10000009
609 Ga0157371_10006726
610 Ga0157371_10009908
611 Ga0157371_10011053
612 Ga0157371_10015094
613 Ga0157371_10021642
614 Ga0157371_10048438
615 Ga0157371_10073410
616 Ga0157370_10021758
617 Ga0157370_10035402
618 Ga0157370_10085468
619 Ga0157370_10119289
620 Ga0157370_10120880
621 Ga0157369_10000006
622 Ga0157369_10004541
623 Ga0157369_10454130
624 Ga0157374_10000349
625 Ga0157374_10000950
626 Ga0157378_10007782
627 Ga0157378_10037249
628 Ga0163162_10000066
629 Ga0163162_10000126
630 Ga0163162_10004715
631 Ga0163162_10459196
632 Ga0157372_10000001
633 Ga0157372_10000730
634 Ga0157372_10001042
635 Ga0157372_10002233
636 Ga0157372_10003847
637 Ga0157372_10013624
638 Ga0157372_10062766
639 Ga0157375_10006708
640 Ga0157375_10086135
641 Ga0163163_10040830
642 Ga0182008_10000010
643 Ga0182008_10121878
644 Ga0182008_10130963
645 Ga0157376_10195977
646 Ga0157376_10232671
647 Ga0182006_1001802
648 Ga0182006_1002437
649 Ga0182006_1002897
650 Ga0182006_1003732
651 Ga0182007_10000001
652 Ga0183373_1006
653 Ga0163161_10000908
654 Ga0163161_10028158
655 Ga0163161_10106214
656 Ga0163161_10112228
657 Ga0213876_10100621
658 Ga0207427_101537
659 Ga0209437_100017
660 Ga0209437_100052
661 Ga0207425_1000007
662 Ga0209026_1001668
663 Ga0209026_1002004
664 Ga0209026_1003364
665 Ga0209129_1000006
666 Ga0209129_1007615
667 Ga0209233_1000067
668 Ga0209233_1002062
669 Ga0209233_1004960
670 Ga0209233_1011090
671 Ga0209676_1000001
672 Ga0209025_1000025
673 Ga0209758_1000016
674 Ga0209050_1000016
675 Ga0209257_1000013
676 Ga0207647_10000665
677 Ga0207647_10003255
678 Ga0207647_10007550
679 Ga0207645_10000131
680 Ga0207705_10000015
681 Ga0207654_10002377
682 Ga0207654_10002510
683 Ga0207695_10000131
684 Ga0207695_10003136
685 Ga0207695_10019218
686 Ga0207695_10101200
687 Ga0207695_10167357
688 Ga0207671_10000787
689 Ga0207671_10001653
690 Ga0207671_10004792
691 Ga0207671_10017823
692 Ga0207671_10065135
693 Ga0207671_10110040
694 Ga0207657_10085247
695 Ga0207652_10064528
696 Ga0207694_10167603
697 Ga0207700_10121586
698 Ga0207644_10003897
699 Ga0207690_10002508
700 Ga0207690_10007018
701 Ga0207690_10008351
702 Ga0207690_10205845
703 Ga0207706_10000126
704 Ga0207706_10195774
705 Ga0207709_10000021
706 Ga0207709_10124436
707 Ga0207704_10000109
708 Ga0207661_10131122
709 Ga0207667_10000020
710 Ga0207667_10001127
711 Ga0207667_10005980
712 Ga0207667_10057566
713 Ga0207667_10103526
714 Ga0207667_10188030
715 Ga0207667_10386910
716 Ga0207640_10215993
717 Ga0207677_10010526
718 Ga0207677_10014631
719 Ga0207677_10261604
720 Ga0207703_10508204
721 Ga0207639_10052686
722 Ga0207678_10008598
723 Ga0207702_10011441
724 Ga0207702_10012211
725 Ga0207702_10028114
726 Ga0207702_10067058
727 Ga0207648_10000155
728 Ga0207674_10018890
729 Ga0207674_10102510
730 Ga0207698_10012144
731 Ga0207698_10084618
732 Ga0207698_10286190
733 Ga0268266_10000052
734 Ga0268265_10088588
735 Ga0307517_10045196
736 Ga0307515_10000794
737 Ga0307515_10014388
738 Ga0307515_10035890
739 Ga0307515_10104015
740 Ga0265338_10003902
741 Ga0265338_10175193
742 Ga0316177_1206954
743 Ga0316176_1036636
744 Ga0316183_1052145
745 Ga0316181_1257525
746 Ga0316181_1289097
747 Ga0265327_10000098
748 Ga0265327_10110151
749 Ga0307509_10133513
750 Ga0307408_100000361
751 Ga0307408_100002588
752 Ga0307408_100077815
753 Ga0307408_100092653
754 Ga0316579_10062682
755 Ga0316576_10030287
756 Ga0316578_10015538
757 Ga0316578_10015833
758 Ga0316578_10033405
759 Ga0307405_10000010
760 Ga0316577_10126994
761 Ga0316577_10129563
762 Ga0307407_10000009
763 Ga0307412_10000018
764 Ga0307416_100000019
765 Ga0307414_10001246
766 Ga0307414_10006456
767 Ga0307414_10008047
768 Ga0307414_10032550
769 Ga0307414_10056670
770 Ga0307414_10064516
771 Ga0307414_10071442
772 Ga0307414_10111535
773 Ga0307414_10114764
774 Ga0316585_10015384
775 Ga0307507_10000064
776 Ga0307510_10032848
777 Ga0316574_0069642
778 Ga0316582_0011549
779 Ga0316584_0192264
780 Ga0395899_0000001
781 Ga0395899_0000435
782 Ga0395899_0004805
783 Ga0395900_0000014
784 Ga0395900_0000873
785 Ga0395900_0037412
786 Ga0395900_0203852
787 Ga0395900_0222475
788 Ga0395905_0000037
789 Ga0395905_0000516
790 Ga0395901_0000166
791 Ga0395901_0046427
792 Ga0400483_046378
793 Ga0436365_0829770
794 Ga0436361_1061278
795 Ga0451855_0709033
796 Ga0439448_0023518
797 Ga0451577_0000946
798 Ga0451577_0010632
799 Ga0451577_0082551
800 Ga0451577_0128362
801 Ga0451577_0160053
802 Ga0451577_0272144
803 Ga0451577_0333338
804 Ga0451577_0445790
805 Ga0466969_0026733
806 Ga0453683_0000061
807 Ga0453683_0000148
808 Ga0453683_0013359
809 Ga0453683_0038616
810 Ga0453683_0118857
811 Ga0453683_0134905
812 Ga0453683_0138742
813 Ga0453683_0396640
814 Ga0466966_0014442
815 Ga0466961_0049499
816 Ga0453684_0000353
817 Ga0453684_0000608
818 Ga0453684_0001620
819 Ga0453684_0005017
820 Ga0453684_0009864
821 Ga0453684_0018496
822 Ga0453684_0026966
823 Ga0453684_0027794
824 Ga0453684_0031997
825 Ga0453684_0032369
826 Ga0453684_0033162
827 Ga0453684_0034362
828 Ga0453684_0035589
829 Ga0453684_0039365
830 Ga0453684_0053745
831 Ga0453684_0070105
832 Ga0453684_0082354
833 Ga0453684_0092189
834 Ga0453684_0182438
835 Ga0453684_0190118
836 Ga0453684_0563791
837 Ga0453684_0607026
838 Ga0451576_0001207
839 Ga0451576_0018238
840 Ga0451576_0030297
841 Ga0451576_0039968
842 Ga0451576_0044192
843 Ga0451576_0089336
844 Ga0451576_0166085
845 Ga0451576_0423077
846 Ga0451576_0461442
847 Ga0451576_0544920
848 Ga0451576_0661141
849 Ga0466958_0082537
850 Ga0495592_0144477
851 Ga0495651_0089457
852 Ga0495651_0178019
853 Ga0495650_0000003
854 Ga0495585_0000079
855 Ga0495585_0000315
856 Ga0495596_0018071
857 Ga0495583_0038965
858 Ga0495606_0000163
859 Ga0495606_0054497
860 Ga0495610_0000028
861 Ga0495610_0001494
862 Ga0495610_0003905
863 Ga0495610_0080029
864 Ga0495616_0003711
865 Ga0495616_0004582
866 Ga0495648_0002715
867 Ga0495648_0032230
868 Ga0495652_0139503
869 Ga0495609_0035707
870 Ga0495633_0000056
871 Ga0495633_0016933
872 Ga0495633_0053305
873 Ga0495668_0000044
874 Ga0495625_0000159
875 Ga0495625_0022826
876 Ga0495625_0082950
877 Ga0495625_0084483
878 Ga0495625_0093975
879 Ga0495625_0286554
880 Ga0495661_0001324
881 Ga0495661_0080660
882 Ga0495658_0023724
883 Ga0495649_0000003
884 Ga0495649_0048032
885 Ga0495683_0052742
886 Ga0495687_000527
887 Ga0495687_038454
888 Ga0495686_0000160
889 Ga0495686_0002432
890 Ga0495686_0061589
891 Ga0496101_0167813
892 Ga0496114_0018524
893 Ga0496116_0001728
894 Ga0496117_0003269
895 Ga0496121_0001160
896 Ga0496122_0006115
897 Ga0496125_0116479
898 Ga0495678_010125
899 Ga0501245_010308
900 Ga0501241_002856
901 nmdc:mga0k408_111_c1
902 nmdc:mga0k408_88_c1
903 nmdc:mga06z11_74070_c1
904 Ga0500635_0001310
905 Ga0500651_0000250
906 Ga0500608_000994
907 Ga0500608_010239
908 Ga0500618_000003
909 Ga0500618_023165
910 Ga0500622_0001498
911 Ga0500624_001881
912 2586207388
913 2599478652
914 2722726337
915 2738760838
916 2738853769
917 2739304017
918 2739588579
919 2739615921
920 2739645027
921 2776613022
922 2819549835
923 2839992277
924 2842723720
925 2842905775
926 2842910225
927 2849285250
928 2852623679
929 2852627349
930 2857628954
931 2884937417
932 2890739572
933 2890805893
934 2896319306
935 2896346130
936 2898716255
937 2902051405
938 2904445863
939 2904783776
940 2919181974
941 2919187382
942 2919441334
943 2919694663
944 2928080292
945 2928149535
946 2932083365
947 2939665351
948 2946000436
949 2954017457
950 2977236184
951 3003234769
952 8055589914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

16

155

0.93

PF01259

SAICAR_synt

SAICAR synthetase

154

240

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u54-assembly1.cif.gz_A crystal structure (type-1) of saicar synthetase from pyrococcus horikoshii ot3 0.89 23 293
2yzl-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with adp from methanocaldococcus jannaschii 0.8849 18 287
2z02-assembly1.cif.gz_B crystal structure of phosphoribosylaminoimidazolesuccinocarboxamide synthase wit atp from methanocaldococcus jannaschii 0.8833 18 287
3u54-assembly1.cif.gz_A crystal structure (type-1) of saicar synthetase from pyrococcus horikoshii ot3 0.8826 23 293
2gqs-assembly1.cif.gz_B saicar synthetase complexed with cair-mg2+ and adp 0.8787 14 288
ID Description Score Start End Superfamily
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9673 95 236 3.30.470.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.935 95 236 3.30.470.20
af_P38025_96_184_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9281 6 93 3.30.200.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9268 93 230 3.30.470.20
af_P38025_96_184_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9083 6 93 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A3C1Y5A3-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9854 105 224 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A350MQF3-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9851 2 314 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A2N2XZY0-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9849 1 311 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A2E0NRW1-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9832 1 312 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A354S5F6-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9824 1 315 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Map