F451606

General Info

Members Datasets Scaffolds Average Seq Length
476 263 952 202

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_111629_c1|nmdc:mga08x19_111629_c1_391_1125
Length 244
Sequence VRAWKKWEILSYFAAFLAAVSCPQFRPRSFMPKDSNSKQQQMRARIAAVAARLMAEDGLDDFALAKRKAARQLGAESTQSLPKNEEIETELRAYQSLYQGEEQRERIRYLRTRALEAMHLLDRFRPHLAGAVLRGTAGRYSDIDLQLFTDDGKAVEHFLLSQNIAYDVSDERRFAGDQARAVSVLKLDWQGVPVNLAIYTLKEERGILKATPTGRPIERAGIQAVAQLLSGPENAESDPAWAVK

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0
Rhizoplane 0.42
Rhizosphere 96.64
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_111629_c1 3300050514 Bacteria 1824
2 Ga0065712_10019861 3300005290 Bacteria 1920
3 Ga0070658_10007089 3300005327 Bacteria 9046
4 Ga0070658_10026491 3300005327 Bacteria 4652
5 Ga0070658_10039331 3300005327 Bacteria 3814
6 Ga0070658_11022460 3300005327 Bacteria 719
7 Ga0070683_100214834 3300005329 Bacteria 1827
8 Ga0070683_100446757 3300005329 Bacteria 1234
9 Ga0070690_100124236 3300005330 Bacteria 1735
10 Ga0070690_100184188 3300005330 Bacteria 1444
11 Ga0070690_100254331 3300005330 Bacteria 1244
12 Ga0070690_100435698 3300005330 Bacteria 969
13 Ga0070670_100356643 3300005331 Bacteria 1285
14 Ga0070670_100659641 3300005331 Bacteria 939
15 Ga0070677_10080121 3300005333 Bacteria 1395
16 Ga0068869_100104320 3300005334 Bacteria 2149
17 Ga0068869_101066414 3300005334 Bacteria 706
18 Ga0070680_100095803 3300005336 Bacteria 2461
19 Ga0070682_100574887 3300005337 Bacteria 886
20 Ga0068868_100062826 3300005338 Bacteria 2945
21 Ga0068868_100419824 3300005338 Bacteria 1158
22 Ga0070660_100026449 3300005339 Bacteria 4319
23 Ga0070660_100248248 3300005339 Bacteria 1451
24 Ga0070689_100003205 3300005340 Bacteria 10840
25 Ga0070689_100135158 3300005340 Bacteria 1980
26 Ga0070689_100187245 3300005340 Bacteria 1684
27 Ga0070689_100229113 3300005340 Bacteria 1527
28 Ga0070687_100325878 3300005343 Bacteria 983
29 Ga0070687_100395076 3300005343 Bacteria 905
30 Ga0070661_100194427 3300005344 Bacteria 1548
31 Ga0070661_100271284 3300005344 Bacteria 1314
32 Ga0070692_10302759 3300005345 Bacteria 977
33 Ga0070669_100748551 3300005353 Unclassified 828
34 Ga0070675_100001954 3300005354 Bacteria 15249
35 Ga0070675_100142312 3300005354 Bacteria 2051
36 Ga0070675_100397138 3300005354 Bacteria 1229
37 Ga0070675_100410397 3300005354 Bacteria 1209
38 Ga0070674_100062139 3300005356 Bacteria 2609
39 Ga0070674_100086603 3300005356 Bacteria 2250
40 Ga0070674_100222216 3300005356 Bacteria 1470
41 Ga0070673_100015039 3300005364 Bacteria 5416
42 Ga0070673_100140754 3300005364 Bacteria 2035
43 Ga0070673_100820299 3300005364 Bacteria 860
44 Ga0070688_100002581 3300005365 Bacteria 9178
45 Ga0070688_100081573 3300005365 Bacteria 2095
46 Ga0070688_100109808 3300005365 Bacteria 1832
47 Ga0070688_100195472 3300005365 Bacteria 1412
48 Ga0070659_100202349 3300005366 Bacteria 1635
49 Ga0070714_100022663 3300005435 Bacteria 5150
50 Ga0070713_100012221 3300005436 Bacteria 6289
51 Ga0070701_10244863 3300005438 Bacteria 1080
52 Ga0070711_100353538 3300005439 Bacteria 1182
53 Ga0070711_100669448 3300005439 Bacteria 872
54 Ga0070700_101012412 3300005441 Unclassified 684
55 Ga0070694_100616273 3300005444 Bacteria 875
56 Ga0070678_100127367 3300005456 Bacteria 2018
57 Ga0070678_101172191 3300005456 Unclassified 711
58 Ga0070681_10023535 3300005458 Bacteria 6195
59 Ga0070681_10071266 3300005458 Bacteria 3440
60 Ga0068867_100299109 3300005459 Bacteria 1326
61 Ga0070685_10015530 3300005466 Bacteria 4045
62 Ga0070698_101115272 3300005471 Bacteria 737
63 Ga0070699_100017685 3300005518 Bacteria 6121
64 Ga0070699_100476980 3300005518 Bacteria 1132
65 Ga0070679_100036110 3300005530 Bacteria 4904
66 Ga0070679_100369257 3300005530 Bacteria 1382
67 Ga0070684_100288720 3300005535 Bacteria 1504
68 Ga0070697_100819178 3300005536 Bacteria 824
69 Ga0068853_100046588 3300005539 Bacteria 3718
70 Ga0068853_100242889 3300005539 Bacteria 1651
71 Ga0070672_100115806 3300005543 Bacteria 2189
72 Ga0070672_100389942 3300005543 Bacteria 1192
73 Ga0070695_100182658 3300005545 Bacteria 1487
74 Ga0070696_100004456 3300005546 Bacteria 9346
75 Ga0070693_100030813 3300005547 Bacteria 2936
76 Ga0070693_100636309 3300005547 Bacteria 774
77 Ga0070665_100038925 3300005548 Bacteria 4780
78 Ga0070665_100130338 3300005548 Bacteria 2517
79 Ga0070704_100098051 3300005549 Bacteria 2201
80 Ga0070704_100141401 3300005549 Bacteria 1880
81 Ga0068855_100192184 3300005563 Bacteria 2302
82 Ga0068855_100193385 3300005563 Bacteria 2293
83 Ga0068855_100423064 3300005563 Bacteria 1457
84 Ga0070664_100211273 3300005564 Bacteria 1734
85 Ga0068854_100227031 3300005578 Bacteria 1480
86 Ga0068856_100182231 3300005614 Bacteria 2113
87 Ga0068856_100542853 3300005614 Bacteria 1184
88 Ga0070702_100260188 3300005615 Bacteria 1181
89 Ga0068852_100000366 3300005616 Bacteria 30499
90 Ga0068852_100007113 3300005616 Bacteria 8152
91 Ga0068852_100050317 3300005616 Bacteria 3570
92 Ga0068852_100186355 3300005616 Bacteria 1955
93 Ga0068852_101218439 3300005616 Bacteria 774
94 Ga0068859_100007911 3300005617 Bacteria 10782
95 Ga0068859_100050457 3300005617 Bacteria 4179
96 Ga0068859_100205253 3300005617 Bacteria 2056
97 Ga0068859_100242936 3300005617 Bacteria 1890
98 Ga0068864_100543749 3300005618 Bacteria 1122
99 Ga0068861_100386971 3300005719 Bacteria 1237
100 Ga0068851_10000790 3300005834 Bacteria 13643
101 Ga0068870_10030500 3300005840 Bacteria 2725
102 Ga0068870_10326113 3300005840 Bacteria 977
103 Ga0068863_100283704 3300005841 Bacteria 1605
104 Ga0068858_100005000 3300005842 Bacteria 12990
105 Ga0068858_100109446 3300005842 Bacteria 2579
106 Ga0068858_101016436 3300005842 Bacteria 813
107 Ga0068862_101695200 3300005844 Bacteria 640
108 Ga0081539_10096095 3300005985 Bacteria 1520
109 Ga0075364_10006055 3300006051 Bacteria 7080
110 Ga0075364_10132784 3300006051 Bacteria 1672
111 Ga0075366_10020832 3300006195 Bacteria 3807
112 Ga0075366_10065946 3300006195 Bacteria 2153
113 Ga0097621_100004700 3300006237 Bacteria 9541
114 Ga0097621_100048609 3300006237 Bacteria 3442
115 Ga0097621_100099487 3300006237 Bacteria 2444
116 Ga0097621_100311617 3300006237 Bacteria 1392
117 Ga0097621_100564046 3300006237 Bacteria 1037
118 Ga0075370_10223360 3300006353 Bacteria 1113
119 Ga0068871_100010300 3300006358 Bacteria 6815
120 Ga0068871_100014352 3300006358 Bacteria 5904
121 Ga0068871_100804428 3300006358 Bacteria 867
122 Ga0068871_101036277 3300006358 Bacteria 765
123 Ga0075428_100088702 3300006844 Bacteria 3374
124 Ga0075433_10050992 3300006852 Bacteria 3603
125 Ga0075433_10415133 3300006852 Bacteria 1187
126 Ga0068865_100085704 3300006881 Bacteria 2273
127 Ga0068865_100192934 3300006881 Bacteria 1577
128 Ga0068865_100854266 3300006881 Bacteria 789
129 Ga0075436_100029782 3300006914 Bacteria 3754
130 Ga0075436_100154795 3300006914 Bacteria 1614
131 Ga0097620_100007911 3300006931 Bacteria 10782
132 Ga0097620_100050458 3300006931 Bacteria 4179
133 Ga0097620_100205258 3300006931 Bacteria 2056
134 Ga0097620_100242955 3300006931 Bacteria 1890
135 Ga0075435_100165096 3300007076 Bacteria 1867
136 Ga0099794_10073727 3300007265 Bacteria 1675
137 Ga0105240_10059300 3300009093 Bacteria 4777
138 Ga0105240_10110110 3300009093 Bacteria 3334
139 Ga0105240_10175112 3300009093 Bacteria 2537
140 Ga0105240_10503000 3300009093 Bacteria 1347
141 Ga0111539_10002062 3300009094 Bacteria 26871
142 Ga0105245_10064593 3300009098 Bacteria 3308
143 Ga0105245_10173256 3300009098 Bacteria 2056
144 Ga0105243_10134343 3300009148 Bacteria 2103
145 Ga0105243_10471047 3300009148 Bacteria 1183
146 Ga0105243_10786456 3300009148 Bacteria 936
147 Ga0105241_10007768 3300009174 Bacteria 7886
148 Ga0105241_10060241 3300009174 Bacteria 2920
149 Ga0105242_10008681 3300009176 Bacteria 7798
150 Ga0105242_10029077 3300009176 Bacteria 4405
151 Ga0105242_10030291 3300009176 Bacteria 4320
152 Ga0105242_10377726 3300009176 Bacteria 1316
153 Ga0105242_10596679 3300009176 Bacteria 1066
154 Ga0105248_10015684 3300009177 Bacteria 8350
155 Ga0105248_10157638 3300009177 Bacteria 2561
156 Ga0105248_10719575 3300009177 Bacteria 1126
157 Ga0105248_10900257 3300009177 Bacteria 999
158 Ga0105237_10883225 3300009545 Bacteria 901
159 Ga0105238_10059168 3300009551 Bacteria 3839
160 Ga0105238_10144769 3300009551 Bacteria 2353
161 Ga0105238_10149048 3300009551 Bacteria 2315
162 Ga0105238_10450208 3300009551 Bacteria 1284
163 Ga0105238_10518514 3300009551 Bacteria 1194
164 Ga0105249_10765095 3300009553 Bacteria 1028
165 Ga0105249_11033348 3300009553 Bacteria 891
166 Ga0105239_10374316 3300010375 Bacteria 1610
167 Ga0105239_11059979 3300010375 Bacteria 933
168 Ga0105239_11683904 3300010375 Bacteria 734
169 Ga0105246_10824949 3300011119 Bacteria 825
170 Ga0157370_10010759 3300013104 Bacteria 9623
171 Ga0157370_10263856 3300013104 Bacteria 1591
172 Ga0157370_10753596 3300013104 Bacteria 887
173 Ga0157369_10019668 3300013105 Bacteria 7557
174 Ga0157369_10625311 3300013105 Bacteria 1111
175 Ga0157374_10069076 3300013296 Bacteria 3326
176 Ga0157374_10159980 3300013296 Bacteria 2193
177 Ga0157378_10009764 3300013297 Bacteria 8366
178 Ga0157378_10153444 3300013297 Bacteria 2147
179 Ga0157378_10243944 3300013297 Bacteria 1717
180 Ga0163162_10017340 3300013306 Bacteria 7046
181 Ga0163162_10765288 3300013306 Bacteria 1084
182 Ga0163162_10944765 3300013306 Bacteria 973
183 Ga0157372_10000909 3300013307 Bacteria 32178
184 Ga0157372_10166770 3300013307 Bacteria 2547
185 Ga0157372_10311025 3300013307 Bacteria 1834
186 Ga0157372_10674316 3300013307 Bacteria 1203
187 Ga0157375_10327434 3300013308 Bacteria 1697
188 Ga0157375_10404137 3300013308 Bacteria 1532
189 Ga0157375_10675339 3300013308 Bacteria 1188
190 Ga0157375_11807982 3300013308 Bacteria 724
191 Ga0163163_10577798 3300014325 Bacteria 1187
192 Ga0157380_10006799 3300014326 Bacteria 8082
193 Ga0157380_10102395 3300014326 Bacteria 2388
194 Ga0157380_11133996 3300014326 Bacteria 823
195 Ga0157377_10001108 3300014745 Bacteria 11388
196 Ga0157379_10042221 3300014968 Bacteria 4071
197 Ga0157379_10112846 3300014968 Bacteria 2443
198 Ga0157376_10039856 3300014969 Bacteria 3835
199 Ga0157376_10134858 3300014969 Bacteria 2208
200 Ga0157376_10213990 3300014969 Bacteria 1781
201 Ga0157376_10505461 3300014969 Bacteria 1188
202 Ga0207656_10000272 3300025321 Bacteria 17950
203 Ga0207692_10116941 3300025898 Bacteria 1487
204 Ga0207685_10133983 3300025905 Bacteria 1103
205 Ga0207643_10032440 3300025908 Bacteria 2917
206 Ga0207643_10145313 3300025908 Bacteria 1419
207 Ga0207705_10007047 3300025909 Bacteria 8292
208 Ga0207705_10037090 3300025909 Bacteria 3488
209 Ga0207705_10076386 3300025909 Bacteria 2435
210 Ga0207654_10053854 3300025911 Bacteria 2324
211 Ga0207707_10019864 3300025912 Bacteria 5864
212 Ga0207695_10042419 3300025913 Bacteria 4860
213 Ga0207695_10098086 3300025913 Bacteria 2930
214 Ga0207695_10344932 3300025913 Bacteria 1377
215 Ga0207693_10207416 3300025915 Bacteria 1541
216 Ga0207663_10428514 3300025916 Bacteria 1016
217 Ga0207660_10077894 3300025917 Bacteria 2428
218 Ga0207662_10116330 3300025918 Bacteria 1672
219 Ga0207662_10178439 3300025918 Bacteria 1366
220 Ga0207657_10049148 3300025919 Bacteria 3678
221 Ga0207657_10431841 3300025919 Bacteria 1035
222 Ga0207649_10819150 3300025920 Bacteria 727
223 Ga0207652_10025768 3300025921 Bacteria 4893
224 Ga0207652_10085612 3300025921 Bacteria 2762
225 Ga0207646_11026846 3300025922 Bacteria 728
226 Ga0207681_10239021 3300025923 Bacteria 1413
227 Ga0207681_10411595 3300025923 Bacteria 1094
228 Ga0207694_10048290 3300025924 Bacteria 3293
229 Ga0207694_10097883 3300025924 Bacteria 2322
230 Ga0207694_10161876 3300025924 Bacteria 1808
231 Ga0207659_10004053 3300025926 Bacteria 8840
232 Ga0207659_10070562 3300025926 Bacteria 2548
233 Ga0207659_10088709 3300025926 Bacteria 2304
234 Ga0207687_10009127 3300025927 Bacteria 6485
235 Ga0207700_10044050 3300025928 Bacteria 3282
236 Ga0207700_10060484 3300025928 Bacteria 2869
237 Ga0207664_10091101 3300025929 Bacteria 2500
238 Ga0207690_10353886 3300025932 Bacteria 1162
239 Ga0207690_10474207 3300025932 Bacteria 1009
240 Ga0207706_10172855 3300025933 Bacteria 1898
241 Ga0207686_10001762 3300025934 Bacteria 12037
242 Ga0207686_10027836 3300025934 Bacteria 3314
243 Ga0207709_10170743 3300025935 Bacteria 1526
244 Ga0207709_10284036 3300025935 Bacteria 1223
245 Ga0207670_10001574 3300025936 Bacteria 11941
246 Ga0207670_10549535 3300025936 Unclassified 943
247 Ga0207669_10124279 3300025937 Bacteria 1759
248 Ga0207669_10205800 3300025937 Bacteria 1432
249 Ga0207704_10024393 3300025938 Bacteria 3279
250 Ga0207704_10352092 3300025938 Bacteria 1147
251 Ga0207691_10004014 3300025940 Bacteria 14270
252 Ga0207691_10175596 3300025940 Bacteria 1874
253 Ga0207711_10161710 3300025941 Bacteria 2027
254 Ga0207711_10564047 3300025941 Bacteria 1062
255 Ga0207689_10084768 3300025942 Bacteria 2604
256 Ga0207689_10843742 3300025942 Bacteria 773
257 Ga0207661_10551207 3300025944 Bacteria 1056
258 Ga0207679_10201487 3300025945 Bacteria 1663
259 Ga0207667_10017595 3300025949 Bacteria 8038
260 Ga0207667_10123105 3300025949 Bacteria 2672
261 Ga0207667_10318529 3300025949 Bacteria 1588
262 Ga0207651_10036785 3300025960 Bacteria 3200
263 Ga0207651_10265754 3300025960 Bacteria 1411
264 Ga0207712_10472279 3300025961 Bacteria 1067
265 Ga0207677_10395630 3300026023 Bacteria 1170
266 Ga0207703_10003555 3300026035 Bacteria 13026
267 Ga0207703_10033977 3300026035 Bacteria 4045
268 Ga0207703_10762445 3300026035 Bacteria 922
269 Ga0207639_10177162 3300026041 Bacteria 1811
270 Ga0207708_10630523 3300026075 Unclassified 911
271 Ga0207702_10308454 3300026078 Bacteria 1504
272 Ga0207641_10192374 3300026088 Bacteria 1876
273 Ga0207648_10020236 3300026089 Bacteria 5997
274 Ga0207648_10144651 3300026089 Bacteria 2097
275 Ga0207648_10201072 3300026089 Bacteria 1767
276 Ga0207648_10387949 3300026089 Bacteria 1264
277 Ga0207676_10642506 3300026095 Unclassified 1023
278 Ga0207674_10023170 3300026116 Bacteria 6656
279 Ga0207683_10032807 3300026121 Bacteria 4511
280 Ga0207698_10003287 3300026142 Bacteria 9717
281 Ga0207698_10078652 3300026142 Bacteria 2649
282 Ga0207698_10096550 3300026142 Bacteria 2436
283 Ga0207698_10204628 3300026142 Bacteria 1771
284 Ga0207698_10283155 3300026142 Bacteria 1534
285 Ga0207698_11219386 3300026142 Bacteria 766
286 Ga0209588_1008040 3300027671 Bacteria 3122
287 Ga0207428_10002330 3300027907 Bacteria 19019
288 Ga0268266_10035336 3300028379 Bacteria 4251
289 Ga0268266_10135151 3300028379 Bacteria 2208
290 Ga0265339_10060580 3300031249 Bacteria 2040
291 Ga0307408_100175503 3300031548 Bacteria 1714
292 Ga0307408_100353179 3300031548 Bacteria 1248
293 Ga0265314_10038197 3300031711 Bacteria 3472
294 Ga0307412_10162027 3300031911 Bacteria 1663
295 Ga0307412_10329003 3300031911 Bacteria 1219
296 Ga0307412_10362808 3300031911 Bacteria 1167
297 Ga0307416_100008259 3300032002 Bacteria 6699
298 Ga0307416_100125194 3300032002 Bacteria 2301
299 Ga0307416_100269896 3300032002 Bacteria 1669
300 Ga0307416_100375716 3300032002 Bacteria 1449
301 Ga0373958_0086347 3300034819 Bacteria 717
302 Ga0373926_0015259 3300035083 Bacteria 2618
303 Ga0373929_0005438 3300035085 Bacteria 2292
304 Ga0373934_0016724 3300035086 Bacteria 2790
305 Ga0373944_0056375 3300035089 Bacteria 1250
306 Ga0373923_0000227 3300035111 Bacteria 11834
307 Ga0373923_0415673 3300035111 Bacteria 649
308 Ga0373936_0011811 3300035113 Bacteria 3312
309 Ga0373953_0009268 3300035117 Bacteria 3379
310 Ga0373954_0006526 3300035118 Bacteria 5086
311 Ga0373954_0007980 3300035118 Bacteria 4639
312 Ga0373954_0073577 3300035118 Bacteria 1626
313 Ga0373954_0094981 3300035118 Bacteria 1435
314 Ga0373956_0000006 3300035119 Bacteria 65782
315 Ga0373956_0003174 3300035119 Bacteria 6648
316 Ga0373957_0000479 3300035120 Bacteria 10076
317 Ga0373957_0012708 3300035120 Bacteria 2840
318 Ga0373957_0038619 3300035120 Bacteria 1788
319 Ga0373946_0007280 3300035171 Bacteria 4040
320 Ga0373955_0001760 3300035172 Bacteria 9294
321 Ga0373955_0002956 3300035172 Bacteria 7446
322 Ga0373955_0120285 3300035172 Bacteria 1526
323 Ga0373955_0247867 3300035172 Bacteria 1067
324 Ga0373924_0004449 3300035410 Bacteria 4894
325 Ga0373924_0103875 3300035410 Bacteria 1224
326 Ga0373931_0027015 3300035691 Bacteria 2926
327 Ga0373931_0044867 3300035691 Bacteria 2333
328 Ga0373935_0047768 3300035692 Bacteria 2707
329 Ga0373935_0546373 3300035692 Bacteria 844
330 Ga0373927_0041027 3300035695 Bacteria 3002
331 Ga0373927_0133438 3300035695 Bacteria 1622
332 Ga0373933_0000217 3300035724 Bacteria 37933
333 Ga0373933_0037120 3300035724 Bacteria 2857
334 Ga0373933_0077767 3300035724 Bacteria 2028
335 Ga0373947_0114902 3300035725 Bacteria 1705
336 Ga0373947_0141200 3300035725 Bacteria 1545
337 Ga0373937_0000205 3300036401 Bacteria 57080
338 Ga0373937_0001850 3300036401 Bacteria 17770
339 Ga0373937_0017442 3300036401 Bacteria 6396
340 Ga0373937_0050033 3300036401 Bacteria 3827
341 Ga0373937_0055760 3300036401 Bacteria 3629
342 Ga0373925_0029741 3300037068 Bacteria 4007
343 Ga0373925_0301261 3300037068 Bacteria 1294
344 Ga0395899_0019690 3300037312 Bacteria 5124
345 Ga0395900_0338483 3300037418 Bacteria 1481
346 Ga0395898_1046029 3300037466 Bacteria 751
347 Ga0395905_0004647 3300037471 Bacteria 14196
348 Ga0436364_0094986 3300037853 Bacteria 1372
349 Ga0395901_0026329 3300038443 Bacteria 5972
350 Ga0439439_0034326 3300041406 Bacteria 1300
351 Ga0439446_0026629 3300042156 Bacteria 1657
352 Ga0439435_0053349 3300042436 Bacteria 1162
353 Ga0451577_0366137 3300042876 Bacteria 1308
354 Ga0466966_0073466 3300044684 Bacteria 2139
355 Ga0495592_0003264 3300046454 Bacteria 11625
356 Ga0495592_0007883 3300046454 Bacteria 7984
357 Ga0495592_0019652 3300046454 Bacteria 5138
358 Ga0495592_0241407 3300046454 Bacteria 1198
359 Ga0495629_0011462 3300046459 Bacteria 6441
360 Ga0495641_0006075 3300046461 Bacteria 7932
361 Ga0495651_0022270 3300046462 Bacteria 4925
362 Ga0495651_0114509 3300046462 Bacteria 1990
363 Ga0495653_0000752 3300046463 Bacteria 24793
364 Ga0495580_0032479 3300046472 Bacteria 3767
365 Ga0495582_0015849 3300046473 Bacteria 4133
366 Ga0495639_0002294 3300046475 Bacteria 8387
367 Ga0495662_0005928 3300046476 Bacteria 6106
368 Ga0495664_0357254 3300046477 Unclassified 879
369 Ga0495608_0101900 3300046511 Bacteria 1850
370 Ga0495608_0202575 3300046511 Unclassified 1250
371 Ga0495618_0043780 3300046514 Bacteria 2824
372 Ga0495628_0004940 3300046516 Bacteria 11726
373 Ga0495628_0005550 3300046516 Bacteria 11043
374 Ga0495628_0041169 3300046516 Bacteria 3689
375 Ga0495628_0093179 3300046516 Bacteria 2330
376 Ga0495630_0010109 3300046517 Bacteria 6800
377 Ga0495666_0001547 3300046526 Bacteria 11307
378 Ga0495652_0238954 3300046529 Bacteria 1353
379 Ga0495652_0684626 3300046529 Bacteria 691
380 Ga0495640_0000860 3300046533 Bacteria 23259
381 Ga0495586_0006143 3300046535 Bacteria 6418
382 Ga0495586_0035161 3300046535 Bacteria 2691
383 Ga0495587_0007435 3300046536 Bacteria 7091
384 Ga0495587_0015945 3300046536 Bacteria 4678
385 Ga0495598_0090286 3300046537 Bacteria 998
386 Ga0495598_0161832 3300046537 Bacteria 788
387 Ga0495621_0007651 3300046539 Bacteria 3207
388 Ga0495621_0018481 3300046539 Bacteria 2263
389 Ga0495645_0000371 3300046543 Bacteria 31266
390 Ga0495645_0004304 3300046543 Bacteria 9726
391 Ga0495645_0085448 3300046543 Bacteria 2258
392 Ga0495622_0077315 3300046557 Bacteria 1533
393 Ga0495667_0010704 3300046559 Bacteria 6202
394 Ga0495634_0057610 3300046642 Bacteria 2592
395 Ga0495635_0004893 3300046663 Bacteria 9323
396 Ga0495657_0002680 3300046675 Bacteria 14884
397 Ga0495657_0057516 3300046675 Bacteria 2585
398 Ga0495599_0003472 3300046678 Bacteria 9227
399 Ga0495599_0046394 3300046678 Bacteria 2725
400 Ga0495599_0110771 3300046678 Bacteria 1710
401 Ga0495623_0004175 3300046679 Bacteria 9519
402 Ga0495647_0000191 3300046681 Bacteria 16254
403 Ga0495658_0015802 3300046683 Bacteria 3877
404 Ga0495658_0103620 3300046683 Bacteria 1702
405 Ga0495658_0498059 3300046683 Bacteria 779
406 Ga0495613_0013698 3300046689 Bacteria 6016
407 Ga0495613_0511050 3300046689 Bacteria 808
408 Ga0495600_0000613 3300046809 Bacteria 18436
409 Ga0495581_0045624 3300047315 Bacteria 2533
410 Ga0495604_0131030 3300047317 Bacteria 1802
411 Ga0495674_0070265 3300047319 Bacteria 3026
412 Ga0495680_0001500 3300047322 Bacteria 25019
413 Ga0495680_0050240 3300047322 Bacteria 3262
414 Ga0495675_0130677 3300047444 Bacteria 1561
415 Ga0495684_0005127 3300047471 Bacteria 10222
416 Ga0495593_0095206 3300047673 Bacteria 1531
417 Ga0496104_0001840 3300048907 Bacteria 18346
418 Ga0496112_0455037 3300048915 Bacteria 1218
419 Ga0501036_0048430 3300049572 Bacteria 3598
420 Ga0501038_0098881 3300049574 Bacteria 2432
421 Ga0501038_0206496 3300049574 Bacteria 1574
422 Ga0501039_0004818 3300049575 Bacteria 10219
423 Ga0501039_0425914 3300049575 Bacteria 1042
424 Ga0501041_0313876 3300049577 Bacteria 988
425 Ga0501041_0416080 3300049577 Bacteria 852
426 Ga0501042_0081825 3300049578 Bacteria 2314
427 Ga0501047_0032761 3300049581 Bacteria 5016
428 Ga0501047_0279587 3300049581 Bacteria 1514
429 Ga0501047_0330208 3300049581 Bacteria 1364
430 Ga0501048_0003905 3300049582 Bacteria 11323
431 Ga0501068_0051930 3300049584 Bacteria 2481
432 Ga0501069_0025895 3300049585 Bacteria 3209
433 Ga0501070_0000922 3300049586 Bacteria 26611
434 Ga0501071_0101311 3300049587 Bacteria 2123
435 Ga0501071_0205454 3300049587 Bacteria 1480
436 Ga0501072_0006990 3300049588 Bacteria 8570
437 Ga0501073_0000119 3300049589 Bacteria 50663
438 Ga0501073_0225230 3300049589 Bacteria 1295
439 Ga0501074_0000634 3300049590 Bacteria 21786
440 Ga0501075_0000588 3300049591 Bacteria 22147
441 Ga0501075_0035743 3300049591 Bacteria 3707
442 Ga0501076_0000031 3300049592 Bacteria 73431
443 Ga0501076_0042822 3300049592 Bacteria 3566
444 Ga0501077_0125159 3300049593 Bacteria 1629
445 Ga0501079_0000732 3300049741 Bacteria 22206
446 Ga0501079_0032733 3300049741 Bacteria 3998
447 Ga0501079_0459476 3300049741 Bacteria 1000
448 Ga0501080_0002188 3300049742 Bacteria 16986
449 Ga0501080_0040751 3300049742 Bacteria 4331
450 Ga0501081_0020865 3300049743 Bacteria 4371
451 Ga0501083_0000505 3300049744 Bacteria 24911
452 Ga0501035_0104028 3300049822 Bacteria 2490
453 Ga0501044_0043837 3300049823 Bacteria 4646
454 Ga0501045_0007091 3300049824 Bacteria 7770
455 nmdc:mga03683_92929_c1 3300050489 Bacteria 1317
456 nmdc:mga00v17_339323_c1 3300050491 Bacteria 977
457 nmdc:mga0k408_155074_c1 3300050493 Bacteria 1364
458 nmdc:mga0k408_2758_c1 3300050493 Bacteria 9333
459 nmdc:mga0k408_61288_c1 3300050493 Bacteria 2186
460 nmdc:mga0k408_77896_c2 3300050493 Bacteria 1492
461 nmdc:mga07m45_205724_c1 3300050496 Bacteria 1145
462 nmdc:mga08y16_1048_c1 3300050511 Bacteria 27140
463 nmdc:mga0rr50_325743_c1 3300050513 Bacteria 1289
464 nmdc:mga08x19_203723_c1 3300050514 Bacteria 1357
465 nmdc:mga0a205_95524_c2 3300050515 Bacteria 2069
466 Ga0495601_0000484 3300053077 Bacteria 20924
467 Ga0495601_0001143 3300053077 Bacteria 14531
468 Ga0495601_0057667 3300053077 Bacteria 2460
469 Ga0495595_0000562 3300053084 Bacteria 14187
470 Ga0495619_0003780 3300053085 Bacteria 9738
471 Ga0500646_0242369 3300053090 Bacteria 632
472 Ga0501084_0039139 3300054114 Bacteria 3966
473 Ga0501082_0001097 3300060353 Bacteria 23938
474 Ga0501082_0255038 3300060353 Bacteria 1526
475 Ga0530510_0000348 3300061734 Bacteria 29825
476 Ga0530510_0815113 3300061734 Bacteria 712
477 nmdc:mga08x19_111629_c1
478 Ga0065712_10019861
479 Ga0070658_10007089
480 Ga0070658_10026491
481 Ga0070658_10039331
482 Ga0070658_11022460
483 Ga0070683_100214834
484 Ga0070683_100446757
485 Ga0070690_100124236
486 Ga0070690_100184188
487 Ga0070690_100254331
488 Ga0070690_100435698
489 Ga0070670_100356643
490 Ga0070670_100659641
491 Ga0070677_10080121
492 Ga0068869_100104320
493 Ga0068869_101066414
494 Ga0070680_100095803
495 Ga0070682_100574887
496 Ga0068868_100062826
497 Ga0068868_100419824
498 Ga0070660_100026449
499 Ga0070660_100248248
500 Ga0070689_100003205
501 Ga0070689_100135158
502 Ga0070689_100187245
503 Ga0070689_100229113
504 Ga0070687_100325878
505 Ga0070687_100395076
506 Ga0070661_100194427
507 Ga0070661_100271284
508 Ga0070692_10302759
509 Ga0070669_100748551
510 Ga0070675_100001954
511 Ga0070675_100142312
512 Ga0070675_100397138
513 Ga0070675_100410397
514 Ga0070674_100062139
515 Ga0070674_100086603
516 Ga0070674_100222216
517 Ga0070673_100015039
518 Ga0070673_100140754
519 Ga0070673_100820299
520 Ga0070688_100002581
521 Ga0070688_100081573
522 Ga0070688_100109808
523 Ga0070688_100195472
524 Ga0070659_100202349
525 Ga0070714_100022663
526 Ga0070713_100012221
527 Ga0070701_10244863
528 Ga0070711_100353538
529 Ga0070711_100669448
530 Ga0070700_101012412
531 Ga0070694_100616273
532 Ga0070678_100127367
533 Ga0070678_101172191
534 Ga0070681_10023535
535 Ga0070681_10071266
536 Ga0068867_100299109
537 Ga0070685_10015530
538 Ga0070698_101115272
539 Ga0070699_100017685
540 Ga0070699_100476980
541 Ga0070679_100036110
542 Ga0070679_100369257
543 Ga0070684_100288720
544 Ga0070697_100819178
545 Ga0068853_100046588
546 Ga0068853_100242889
547 Ga0070672_100115806
548 Ga0070672_100389942
549 Ga0070695_100182658
550 Ga0070696_100004456
551 Ga0070693_100030813
552 Ga0070693_100636309
553 Ga0070665_100038925
554 Ga0070665_100130338
555 Ga0070704_100098051
556 Ga0070704_100141401
557 Ga0068855_100192184
558 Ga0068855_100193385
559 Ga0068855_100423064
560 Ga0070664_100211273
561 Ga0068854_100227031
562 Ga0068856_100182231
563 Ga0068856_100542853
564 Ga0070702_100260188
565 Ga0068852_100000366
566 Ga0068852_100007113
567 Ga0068852_100050317
568 Ga0068852_100186355
569 Ga0068852_101218439
570 Ga0068859_100007911
571 Ga0068859_100050457
572 Ga0068859_100205253
573 Ga0068859_100242936
574 Ga0068864_100543749
575 Ga0068861_100386971
576 Ga0068851_10000790
577 Ga0068870_10030500
578 Ga0068870_10326113
579 Ga0068863_100283704
580 Ga0068858_100005000
581 Ga0068858_100109446
582 Ga0068858_101016436
583 Ga0068862_101695200
584 Ga0081539_10096095
585 Ga0075364_10006055
586 Ga0075364_10132784
587 Ga0075366_10020832
588 Ga0075366_10065946
589 Ga0097621_100004700
590 Ga0097621_100048609
591 Ga0097621_100099487
592 Ga0097621_100311617
593 Ga0097621_100564046
594 Ga0075370_10223360
595 Ga0068871_100010300
596 Ga0068871_100014352
597 Ga0068871_100804428
598 Ga0068871_101036277
599 Ga0075428_100088702
600 Ga0075433_10050992
601 Ga0075433_10415133
602 Ga0068865_100085704
603 Ga0068865_100192934
604 Ga0068865_100854266
605 Ga0075436_100029782
606 Ga0075436_100154795
607 Ga0097620_100007911
608 Ga0097620_100050458
609 Ga0097620_100205258
610 Ga0097620_100242955
611 Ga0075435_100165096
612 Ga0099794_10073727
613 Ga0105240_10059300
614 Ga0105240_10110110
615 Ga0105240_10175112
616 Ga0105240_10503000
617 Ga0111539_10002062
618 Ga0105245_10064593
619 Ga0105245_10173256
620 Ga0105243_10134343
621 Ga0105243_10471047
622 Ga0105243_10786456
623 Ga0105241_10007768
624 Ga0105241_10060241
625 Ga0105242_10008681
626 Ga0105242_10029077
627 Ga0105242_10030291
628 Ga0105242_10377726
629 Ga0105242_10596679
630 Ga0105248_10015684
631 Ga0105248_10157638
632 Ga0105248_10719575
633 Ga0105248_10900257
634 Ga0105237_10883225
635 Ga0105238_10059168
636 Ga0105238_10144769
637 Ga0105238_10149048
638 Ga0105238_10450208
639 Ga0105238_10518514
640 Ga0105249_10765095
641 Ga0105249_11033348
642 Ga0105239_10374316
643 Ga0105239_11059979
644 Ga0105239_11683904
645 Ga0105246_10824949
646 Ga0157370_10010759
647 Ga0157370_10263856
648 Ga0157370_10753596
649 Ga0157369_10019668
650 Ga0157369_10625311
651 Ga0157374_10069076
652 Ga0157374_10159980
653 Ga0157378_10009764
654 Ga0157378_10153444
655 Ga0157378_10243944
656 Ga0163162_10017340
657 Ga0163162_10765288
658 Ga0163162_10944765
659 Ga0157372_10000909
660 Ga0157372_10166770
661 Ga0157372_10311025
662 Ga0157372_10674316
663 Ga0157375_10327434
664 Ga0157375_10404137
665 Ga0157375_10675339
666 Ga0157375_11807982
667 Ga0163163_10577798
668 Ga0157380_10006799
669 Ga0157380_10102395
670 Ga0157380_11133996
671 Ga0157377_10001108
672 Ga0157379_10042221
673 Ga0157379_10112846
674 Ga0157376_10039856
675 Ga0157376_10134858
676 Ga0157376_10213990
677 Ga0157376_10505461
678 Ga0207656_10000272
679 Ga0207692_10116941
680 Ga0207685_10133983
681 Ga0207643_10032440
682 Ga0207643_10145313
683 Ga0207705_10007047
684 Ga0207705_10037090
685 Ga0207705_10076386
686 Ga0207654_10053854
687 Ga0207707_10019864
688 Ga0207695_10042419
689 Ga0207695_10098086
690 Ga0207695_10344932
691 Ga0207693_10207416
692 Ga0207663_10428514
693 Ga0207660_10077894
694 Ga0207662_10116330
695 Ga0207662_10178439
696 Ga0207657_10049148
697 Ga0207657_10431841
698 Ga0207649_10819150
699 Ga0207652_10025768
700 Ga0207652_10085612
701 Ga0207646_11026846
702 Ga0207681_10239021
703 Ga0207681_10411595
704 Ga0207694_10048290
705 Ga0207694_10097883
706 Ga0207694_10161876
707 Ga0207659_10004053
708 Ga0207659_10070562
709 Ga0207659_10088709
710 Ga0207687_10009127
711 Ga0207700_10044050
712 Ga0207700_10060484
713 Ga0207664_10091101
714 Ga0207690_10353886
715 Ga0207690_10474207
716 Ga0207706_10172855
717 Ga0207686_10001762
718 Ga0207686_10027836
719 Ga0207709_10170743
720 Ga0207709_10284036
721 Ga0207670_10001574
722 Ga0207670_10549535
723 Ga0207669_10124279
724 Ga0207669_10205800
725 Ga0207704_10024393
726 Ga0207704_10352092
727 Ga0207691_10004014
728 Ga0207691_10175596
729 Ga0207711_10161710
730 Ga0207711_10564047
731 Ga0207689_10084768
732 Ga0207689_10843742
733 Ga0207661_10551207
734 Ga0207679_10201487
735 Ga0207667_10017595
736 Ga0207667_10123105
737 Ga0207667_10318529
738 Ga0207651_10036785
739 Ga0207651_10265754
740 Ga0207712_10472279
741 Ga0207677_10395630
742 Ga0207703_10003555
743 Ga0207703_10033977
744 Ga0207703_10762445
745 Ga0207639_10177162
746 Ga0207708_10630523
747 Ga0207702_10308454
748 Ga0207641_10192374
749 Ga0207648_10020236
750 Ga0207648_10144651
751 Ga0207648_10201072
752 Ga0207648_10387949
753 Ga0207676_10642506
754 Ga0207674_10023170
755 Ga0207683_10032807
756 Ga0207698_10003287
757 Ga0207698_10078652
758 Ga0207698_10096550
759 Ga0207698_10204628
760 Ga0207698_10283155
761 Ga0207698_11219386
762 Ga0209588_1008040
763 Ga0207428_10002330
764 Ga0268266_10035336
765 Ga0268266_10135151
766 Ga0265339_10060580
767 Ga0307408_100175503
768 Ga0307408_100353179
769 Ga0265314_10038197
770 Ga0307412_10162027
771 Ga0307412_10329003
772 Ga0307412_10362808
773 Ga0307416_100008259
774 Ga0307416_100125194
775 Ga0307416_100269896
776 Ga0307416_100375716
777 Ga0373958_0086347
778 Ga0373926_0015259
779 Ga0373929_0005438
780 Ga0373934_0016724
781 Ga0373944_0056375
782 Ga0373923_0000227
783 Ga0373923_0415673
784 Ga0373936_0011811
785 Ga0373953_0009268
786 Ga0373954_0006526
787 Ga0373954_0007980
788 Ga0373954_0073577
789 Ga0373954_0094981
790 Ga0373956_0000006
791 Ga0373956_0003174
792 Ga0373957_0000479
793 Ga0373957_0012708
794 Ga0373957_0038619
795 Ga0373946_0007280
796 Ga0373955_0001760
797 Ga0373955_0002956
798 Ga0373955_0120285
799 Ga0373955_0247867
800 Ga0373924_0004449
801 Ga0373924_0103875
802 Ga0373931_0027015
803 Ga0373931_0044867
804 Ga0373935_0047768
805 Ga0373935_0546373
806 Ga0373927_0041027
807 Ga0373927_0133438
808 Ga0373933_0000217
809 Ga0373933_0037120
810 Ga0373933_0077767
811 Ga0373947_0114902
812 Ga0373947_0141200
813 Ga0373937_0000205
814 Ga0373937_0001850
815 Ga0373937_0017442
816 Ga0373937_0050033
817 Ga0373937_0055760
818 Ga0373925_0029741
819 Ga0373925_0301261
820 Ga0395899_0019690
821 Ga0395900_0338483
822 Ga0395898_1046029
823 Ga0395905_0004647
824 Ga0436364_0094986
825 Ga0395901_0026329
826 Ga0439439_0034326
827 Ga0439446_0026629
828 Ga0439435_0053349
829 Ga0451577_0366137
830 Ga0466966_0073466
831 Ga0495592_0003264
832 Ga0495592_0007883
833 Ga0495592_0019652
834 Ga0495592_0241407
835 Ga0495629_0011462
836 Ga0495641_0006075
837 Ga0495651_0022270
838 Ga0495651_0114509
839 Ga0495653_0000752
840 Ga0495580_0032479
841 Ga0495582_0015849
842 Ga0495639_0002294
843 Ga0495662_0005928
844 Ga0495664_0357254
845 Ga0495608_0101900
846 Ga0495608_0202575
847 Ga0495618_0043780
848 Ga0495628_0004940
849 Ga0495628_0005550
850 Ga0495628_0041169
851 Ga0495628_0093179
852 Ga0495630_0010109
853 Ga0495666_0001547
854 Ga0495652_0238954
855 Ga0495652_0684626
856 Ga0495640_0000860
857 Ga0495586_0006143
858 Ga0495586_0035161
859 Ga0495587_0007435
860 Ga0495587_0015945
861 Ga0495598_0090286
862 Ga0495598_0161832
863 Ga0495621_0007651
864 Ga0495621_0018481
865 Ga0495645_0000371
866 Ga0495645_0004304
867 Ga0495645_0085448
868 Ga0495622_0077315
869 Ga0495667_0010704
870 Ga0495634_0057610
871 Ga0495635_0004893
872 Ga0495657_0002680
873 Ga0495657_0057516
874 Ga0495599_0003472
875 Ga0495599_0046394
876 Ga0495599_0110771
877 Ga0495623_0004175
878 Ga0495647_0000191
879 Ga0495658_0015802
880 Ga0495658_0103620
881 Ga0495658_0498059
882 Ga0495613_0013698
883 Ga0495613_0511050
884 Ga0495600_0000613
885 Ga0495581_0045624
886 Ga0495604_0131030
887 Ga0495674_0070265
888 Ga0495680_0001500
889 Ga0495680_0050240
890 Ga0495675_0130677
891 Ga0495684_0005127
892 Ga0495593_0095206
893 Ga0496104_0001840
894 Ga0496112_0455037
895 Ga0501036_0048430
896 Ga0501038_0098881
897 Ga0501038_0206496
898 Ga0501039_0004818
899 Ga0501039_0425914
900 Ga0501041_0313876
901 Ga0501041_0416080
902 Ga0501042_0081825
903 Ga0501047_0032761
904 Ga0501047_0279587
905 Ga0501047_0330208
906 Ga0501048_0003905
907 Ga0501068_0051930
908 Ga0501069_0025895
909 Ga0501070_0000922
910 Ga0501071_0101311
911 Ga0501071_0205454
912 Ga0501072_0006990
913 Ga0501073_0000119
914 Ga0501073_0225230
915 Ga0501074_0000634
916 Ga0501075_0000588
917 Ga0501075_0035743
918 Ga0501076_0000031
919 Ga0501076_0042822
920 Ga0501077_0125159
921 Ga0501079_0000732
922 Ga0501079_0032733
923 Ga0501079_0459476
924 Ga0501080_0002188
925 Ga0501080_0040751
926 Ga0501081_0020865
927 Ga0501083_0000505
928 Ga0501035_0104028
929 Ga0501044_0043837
930 Ga0501045_0007091
931 nmdc:mga03683_92929_c1
932 nmdc:mga00v17_339323_c1
933 nmdc:mga0k408_155074_c1
934 nmdc:mga0k408_2758_c1
935 nmdc:mga0k408_61288_c1
936 nmdc:mga0k408_77896_c2
937 nmdc:mga07m45_205724_c1
938 nmdc:mga08y16_1048_c1
939 nmdc:mga0rr50_325743_c1
940 nmdc:mga08x19_203723_c1
941 nmdc:mga0a205_95524_c2
942 Ga0495601_0000484
943 Ga0495601_0001143
944 Ga0495601_0057667
945 Ga0495595_0000562
946 Ga0495619_0003780
947 Ga0500646_0242369
948 Ga0501084_0039139
949 Ga0501082_0001097
950 Ga0501082_0255038
951 Ga0530510_0000348
952 Ga0530510_0815113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gne-assembly1.cif.gz_A catalytic domain of starch synthase iv from arabidopsis thaliana bound to adp and acarbose 0.7477 133 167
6gng-assembly1.cif.gz_A granule bound starch synthase i from cyanophora paradoxa bound to acarbose and adp 0.7062 139 167
5hdp-assembly5.cif.gz_E hydrolase stna mutant - s185a 0.6861 134 157
3vuf-assembly1.cif.gz_A crystal structure of rice granule bound starch synthase i catalytic domain in complex with adp 0.6793 139 167
7a59-assembly1.cif.gz_C crimean-congo hemorrhagic fever virus envelope glycoprotein gc w1191h/w1197a/w1199a mutant in postfusion conformation (orthorhombic crystal form) 0.6454 133 157
ID Description Score Start End Superfamily
af_K7K1B5_197_452_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8099 136 167 3.40.50.2000
af_Q58942_2_83_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7623 94 127 3.30.460.10
af_A0A0P0Y4W4_826_1030_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7601 138 167 3.90.70.10
af_Q9USK8_1136_1387_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7134 135 167 3.40.50.2000
af_Q54S65_4_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7085 154 172 3.40.50.300
ID Description Score Start End GO Terms
AF-Q5H3R2-F1-model_v4 Uncharacterized protein 0.9273 77 199
AF-A0A522RG31-F1-model_v4 Uncharacterized protein 0.9202 82 199
AF-F0C815-F1-model_v4 deleted 0.9031 86 199
AF-A0A537FY64-F1-model_v4 DUF302 domain-containing protein 0.8993 84 199
AF-A0A539DU14-F1-model_v4 Uncharacterized protein 0.8971 73 189

Map