F451616

General Info

Members Datasets Scaffolds Average Seq Length
476 337 952 451

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991450|2819620716
Length 496
Sequence EPMSATNATNATNATNATNATNATNATNATNAMNATNATNATAWPAGLLLAYYGDDFTGSTDAMEAMQAAGVPTVLCLQKPTRELLARFPEVRCVGMAGSSRGRSSAWIDDELADAFASLAALGAPILQYKVCSTFDSSAEVGSIGRAIDIGVKHSPGHWSPMVIGAPRLKRYQMFGNLFAAVDGVGYRLDRHPTMSRHPVTPMNEADLRLHLARQTARRIELIDMLQLRGADVASRVRALSAPDTPVVLIDVLDEATLAAAGRLVWEQRGGGIFTASSSGLQYALAAHWRACGLLPPTPSLPVADPVQAIAAVSGSCSPVTAAQIGWARAHGFHTERLDLPRALDSRDGAAEIERVVMAATQALNRGVSVIVHSAEGPDDPAVSGFDAIACAAGLARHDAARQVGRALAEVMRRLLDSVALTRVVVAGGDSSGEVASALGIDALSVVAGLAPGAPLCRAWSAEPRRDGLQIVLKGGQIGDAAFFGAVREGRVSAI

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
135 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
136 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
137 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
261 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
262 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
263 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
264 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
265 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
275 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
279 2818991450 Burkholderia sp. 604 Isolate Unclassified
280 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
281 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
282 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
283 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
284 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
285 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
286 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
287 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
288 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
289 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
290 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
291 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
292 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
293 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
294 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
295 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
296 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
297 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
298 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
299 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
300 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
301 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
302 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
303 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
304 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
305 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
306 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
307 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
308 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
309 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
310 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
311 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
312 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
313 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
314 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
315 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
316 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
317 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
318 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
319 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
320 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
321 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
322 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
323 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
324 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
325 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
326 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
327 2929520902 Variovorax beijingensis 502 Isolate Unclassified
328 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
329 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
330 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
331 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
332 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
333 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
334 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
335 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
336 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere
337 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.61
Metatranscriptomes 0
Isolates 12.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 1.89
Rhizoplane 4.41
Rhizosphere 69.33
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000039 3300002704 Bacteria 91670
2 JGI25155J39150_1000270 3300002704 Bacteria 19032
3 JGI25156J39149_1000427 3300002705 Bacteria 26123
4 JGI25156J39149_1000746 3300002705 Bacteria 17077
5 JGI25154J39366_1000077 3300002738 Bacteria 90455
6 JGI25154J39366_1000148 3300002738 Bacteria 54914
7 JGI25157J39369_1000065 3300002741 Bacteria 98536
8 rootL2_10048108 3300003322 Bacteria 2514
9 Ga0055538_1000013 3300003751 Bacteria 348596
10 Ga0055538_1000696 3300003751 Bacteria 10257
11 Ga0055539_1000018 3300003752 Bacteria 348596
12 Ga0055533_1000022 3300003756 Bacteria 348596
13 Ga0055532_1000005 3300003758 Bacteria 458107
14 Ga0055525_1000024 3300003759 Bacteria 348596
15 Ga0055541_1000013 3300003841 Bacteria 348596
16 Ga0055541_1009290 3300003841 Bacteria 1526
17 Ga0065165_1000339 3300005262 Bacteria 76812
18 Ga0065714_10070164 3300005288 Bacteria 3950
19 Ga0070658_10000096 3300005327 Bacteria 77523
20 Ga0070658_10009782 3300005327 Bacteria 7701
21 Ga0070658_10032978 3300005327 Unclassified 4165
22 Ga0070676_10017719 3300005328 Bacteria 3942
23 Ga0070670_100038967 3300005331 Bacteria 4086
24 Ga0068869_100003500 3300005334 Bacteria 9622
25 Ga0068869_100034545 3300005334 Bacteria 3577
26 Ga0068869_100141806 3300005334 Bacteria 1856
27 Ga0070680_100046405 3300005336 Bacteria 3534
28 Ga0070660_100000484 3300005339 Bacteria 26562
29 Ga0070689_100001735 3300005340 Bacteria 13949
30 Ga0070691_10022422 3300005341 Unclassified 2929
31 Ga0070692_10034422 3300005345 Bacteria 2559
32 Ga0070675_100066177 3300005354 Bacteria 2989
33 Ga0070674_100027719 3300005356 Bacteria 3714
34 Ga0070673_100139454 3300005364 Bacteria 2044
35 Ga0070659_100000283 3300005366 Bacteria 39665
36 Ga0070700_100000629 3300005441 Bacteria 17515
37 Ga0070700_100029784 3300005441 Bacteria 3257
38 Ga0070663_100015977 3300005455 Bacteria 4860
39 Ga0070678_100013211 3300005456 Bacteria 5169
40 Ga0070681_10087219 3300005458 Bacteria 3074
41 Ga0068867_100004244 3300005459 Bacteria 10087
42 Ga0068867_100096642 3300005459 Bacteria 2249
43 Ga0070706_100093960 3300005467 Bacteria 2783
44 Ga0070679_100075932 3300005530 Bacteria 3350
45 Ga0070684_100083829 3300005535 Bacteria 2825
46 Ga0068853_100001980 3300005539 Bacteria 15101
47 Ga0068853_100007462 3300005539 Bacteria 8753
48 Ga0068853_100008515 3300005539 Bacteria 8243
49 Ga0070686_100001090 3300005544 Bacteria 15641
50 Ga0070696_100004741 3300005546 Bacteria 9090
51 Ga0068855_100001483 3300005563 Bacteria 29355
52 Ga0068855_100170224 3300005563 Bacteria 2467
53 Ga0068857_100033920 3300005577 Bacteria 4515
54 Ga0068856_100001623 3300005614 Bacteria 23549
55 Ga0068856_100132545 3300005614 Bacteria 2497
56 Ga0068856_100178223 3300005614 Bacteria 2138
57 Ga0070702_100000117 3300005615 Bacteria 24144
58 Ga0068859_100000381 3300005617 Bacteria 44189
59 Ga0068859_100041774 3300005617 Bacteria 4605
60 Ga0068864_100072054 3300005618 Unclassified 3010
61 Ga0068866_10000515 3300005718 Bacteria 17880
62 Ga0068870_10015547 3300005840 Bacteria 3614
63 Ga0068858_100007798 3300005842 Bacteria 10334
64 Ga0068860_100028244 3300005843 Bacteria 5400
65 Ga0068860_100136373 3300005843 Bacteria 2357
66 Ga0068862_100074738 3300005844 Bacteria 2930
67 Ga0068862_100127273 3300005844 Bacteria 2250
68 Ga0068862_100335032 3300005844 Bacteria 1400
69 Ga0081455_10034402 3300005937 Bacteria 4539
70 Ga0081455_10040183 3300005937 Bacteria 4127
71 Ga0081540_1001161 3300005983 Bacteria 23188
72 Ga0081539_10009256 3300005985 Bacteria 8286
73 Ga0081539_10010502 3300005985 Bacteria 7510
74 Ga0075366_10017023 3300006195 Bacteria 4179
75 Ga0097621_100002682 3300006237 Bacteria 12178
76 Ga0075370_10005566 3300006353 Bacteria 6277
77 Ga0075430_100062793 3300006846 Bacteria 3120
78 Ga0075429_100005423 3300006880 Bacteria 10984
79 Ga0068865_100000773 3300006881 Bacteria 17950
80 Ga0097620_100000381 3300006931 Bacteria 44189
81 Ga0097620_100041775 3300006931 Bacteria 4605
82 Ga0105251_10000150 3300009011 Bacteria 71228
83 Ga0105251_10012309 3300009011 Bacteria 4846
84 Ga0105240_10001449 3300009093 Bacteria 40535
85 Ga0105240_10007921 3300009093 Bacteria 15323
86 Ga0105240_10030759 3300009093 Bacteria 6973
87 Ga0105240_10142741 3300009093 Bacteria 2861
88 Ga0105240_10185740 3300009093 Bacteria 2449
89 Ga0105240_10279216 3300009093 Bacteria 1920
90 Ga0105245_10000368 3300009098 Bacteria 42262
91 Ga0105245_10039026 3300009098 Bacteria 4226
92 Ga0105243_10002735 3300009148 Bacteria 14665
93 Ga0105241_10061165 3300009174 Bacteria 2899
94 Ga0105241_10069921 3300009174 Bacteria 2723
95 Ga0105248_10063159 3300009177 Bacteria 4156
96 Ga0105237_10000882 3300009545 Bacteria 40534
97 Ga0105237_10007517 3300009545 Bacteria 11915
98 Ga0105237_10073122 3300009545 Bacteria 3421
99 Ga0105237_10305738 3300009545 Bacteria 1593
100 Ga0105238_10005910 3300009551 Bacteria 12125
101 Ga0105238_10054050 3300009551 Bacteria 4034
102 Ga0105239_10002179 3300010375 Bacteria 25167
103 Ga0105239_10002956 3300010375 Bacteria 21199
104 Ga0105239_10004379 3300010375 Bacteria 16910
105 Ga0105239_10026696 3300010375 Bacteria 6356
106 Ga0105246_10011944 3300011119 Bacteria 5404
107 Ga0157371_10011735 3300013102 Bacteria 6732
108 Ga0157370_10011886 3300013104 Bacteria 9081
109 Ga0157370_10080551 3300013104 Bacteria 3065
110 Ga0157369_10001781 3300013105 Bacteria 26087
111 Ga0157369_10008530 3300013105 Bacteria 11754
112 Ga0157369_10065547 3300013105 Bacteria 3909
113 Ga0157374_10002960 3300013296 Bacteria 14224
114 Ga0157374_10046159 3300013296 Bacteria 4034
115 Ga0157378_10002007 3300013297 Bacteria 18205
116 Ga0157378_10088624 3300013297 Bacteria 2808
117 Ga0163162_10007726 3300013306 Bacteria 10477
118 Ga0157372_10000021 3300013307 Bacteria 207801
119 Ga0157372_10016640 3300013307 Bacteria 7893
120 Ga0157375_10064191 3300013308 Bacteria 3655
121 Ga0157375_10078797 3300013308 Bacteria 3329
122 Ga0157380_10000610 3300014326 Bacteria 22041
123 Ga0157379_10032419 3300014968 Bacteria 4658
124 Ga0157379_10043761 3300014968 Bacteria 3998
125 Ga0157379_10258344 3300014968 Bacteria 1582
126 Ga0157376_10161317 3300014969 Bacteria 2033
127 Ga0182006_1000551 3300015261 Bacteria 28238
128 Ga0182007_10006654 3300015262 Bacteria 4942
129 Ga0163161_10079643 3300017792 Bacteria 2409
130 Ga0209435_100043 3300025206 Bacteria 102049
131 Ga0209435_100050 3300025206 Bacteria 91356
132 Ga0209435_100092 3300025206 Bacteria 40616
133 Ga0209784_100005 3300025224 Bacteria 1040422
134 Ga0209566_100005 3300025225 Bacteria 1040422
135 Ga0209566_100416 3300025225 Bacteria 33309
136 Ga0209674_100009 3300025226 Bacteria 1040422
137 Ga0209147_100011 3300025229 Bacteria 702140
138 Ga0209563_100012 3300025230 Bacteria 1040422
139 Ga0209437_100259 3300025233 Bacteria 82489
140 Ga0209258_100385 3300025242 Bacteria 56396
141 Ga0209646_1000105 3300025246 Bacteria 163453
142 Ga0209646_1000161 3300025246 Bacteria 91356
143 Ga0209026_1000173 3300025250 Bacteria 98585
144 Ga0209026_1001604 3300025250 Bacteria 9688
145 Ga0209677_100006 3300025253 Bacteria 1040422
146 Ga0209759_1000169 3300025256 Bacteria 110110
147 Ga0209759_1000426 3300025256 Bacteria 51309
148 Ga0209759_1015017 3300025256 Bacteria 2018
149 Ga0209233_1009111 3300025261 Bacteria 3036
150 Ga0209676_1000232 3300025292 Bacteria 120363
151 Ga0207426_1005740 3300025302 Bacteria 5590
152 Ga0207713_1013715 3300025735 Bacteria 4255
153 Ga0207642_10000836 3300025899 Bacteria 9580
154 Ga0207645_10026544 3300025907 Bacteria 3743
155 Ga0207643_10020484 3300025908 Bacteria 3630
156 Ga0207705_10000141 3300025909 Bacteria 77000
157 Ga0207684_10128078 3300025910 Bacteria 2179
158 Ga0207654_10046158 3300025911 Bacteria 2483
159 Ga0207654_10108415 3300025911 Bacteria 1723
160 Ga0207707_10057163 3300025912 Bacteria 3396
161 Ga0207695_10039305 3300025913 Bacteria 5086
162 Ga0207695_10084258 3300025913 Bacteria 3210
163 Ga0207695_10095459 3300025913 Bacteria 2977
164 Ga0207695_10192723 3300025913 Bacteria 1955
165 Ga0207671_10055716 3300025914 Bacteria 2929
166 Ga0207671_10144172 3300025914 Bacteria 1836
167 Ga0207657_10002890 3300025919 Bacteria 18447
168 Ga0207657_10136884 3300025919 Bacteria 2003
169 Ga0207694_10004462 3300025924 Bacteria 10924
170 Ga0207694_10114810 3300025924 Bacteria 2145
171 Ga0207659_10040562 3300025926 Bacteria 3256
172 Ga0207687_10023792 3300025927 Bacteria 4086
173 Ga0207690_10002858 3300025932 Bacteria 10408
174 Ga0207686_10001174 3300025934 Bacteria 15148
175 Ga0207709_10019044 3300025935 Bacteria 3852
176 Ga0207670_10021704 3300025936 Bacteria 3966
177 Ga0207704_10000449 3300025938 Bacteria 18375
178 Ga0207665_10113851 3300025939 Bacteria 1904
179 Ga0207689_10000088 3300025942 Bacteria 74315
180 Ga0207689_10035563 3300025942 Bacteria 4138
181 Ga0207667_10011758 3300025949 Bacteria 10150
182 Ga0207667_10040991 3300025949 Bacteria 4928
183 Ga0207667_10069976 3300025949 Bacteria 3653
184 Ga0207667_10109446 3300025949 Unclassified 2849
185 Ga0207640_10130973 3300025981 Bacteria 1813
186 Ga0207658_10183578 3300025986 Bacteria 1733
187 Ga0207639_10014111 3300026041 Bacteria 5610
188 Ga0207678_10027705 3300026067 Bacteria 4946
189 Ga0207708_10000090 3300026075 Bacteria 71734
190 Ga0207702_10002362 3300026078 Bacteria 18028
191 Ga0207648_10000202 3300026089 Bacteria 63315
192 Ga0207648_10084264 3300026089 Bacteria 2772
193 Ga0207674_10045214 3300026116 Bacteria 4530
194 Ga0207675_100001897 3300026118 Bacteria 20889
195 Ga0207683_10042316 3300026121 Bacteria 3979
196 Ga0268265_10144942 3300028380 Bacteria 1994
197 Ga0268264_10006452 3300028381 Bacteria 9876
198 Ga0268264_10112866 3300028381 Bacteria 2383
199 Ga0307517_10045823 3300028786 Bacteria 4582
200 Ga0307515_10000002 3300028794 Bacteria 1231751
201 Ga0307515_10000006 3300028794 Bacteria 725810
202 Ga0307515_10000071 3300028794 Bacteria 238152
203 Ga0307515_10031909 3300028794 Bacteria 8751
204 Ga0316177_1081319 3300030731 Bacteria 13007
205 Ga0316176_1072615 3300030732 Bacteria 9235
206 Ga0316183_1009917 3300030742 Bacteria 46001
207 Ga0316181_1061266 3300030744 Bacteria 10114
208 Ga0265331_10029125 3300031250 Unclassified 2758
209 Ga0265327_10000600 3300031251 Bacteria 59726
210 Ga0307509_10045269 3300031507 Bacteria 4747
211 Ga0307509_10085713 3300031507 Bacteria 3241
212 Ga0307408_100006632 3300031548 Bacteria 7678
213 Ga0307408_100026357 3300031548 Bacteria 3992
214 Ga0307508_10000062 3300031616 Bacteria 123066
215 Ga0307508_10002665 3300031616 Bacteria 18710
216 Ga0307508_10208467 3300031616 Bacteria 1555
217 Ga0307405_10033454 3300031731 Bacteria 3049
218 Ga0307518_10147877 3300031838 Unclassified 1629
219 Ga0307406_10014355 3300031901 Bacteria 4556
220 Ga0307407_10087404 3300031903 Bacteria 1902
221 Ga0307412_10000015 3300031911 Bacteria 333589
222 Ga0307412_10077433 3300031911 Bacteria 2287
223 Ga0307416_100161021 3300032002 Unclassified 2074
224 Ga0307414_10000323 3300032004 Bacteria 27329
225 Ga0307414_10002736 3300032004 Bacteria 9281
226 Ga0307415_100133466 3300032126 Bacteria 1884
227 Ga0373929_0000115 3300035085 Bacteria 13422
228 Ga0373944_0012395 3300035089 Bacteria 2348
229 Ga0373949_0002090 3300035090 Bacteria 5269
230 Ga0373951_0010643 3300035091 Bacteria 2066
231 Ga0373932_0000003 3300035112 Bacteria 459351
232 Ga0373954_0027734 3300035118 Bacteria 2601
233 Ga0373931_0000011 3300035691 Bacteria 304643
234 Ga0373935_0010758 3300035692 Bacteria 5496
235 Ga0373925_0000527 3300037068 Bacteria 37900
236 Ga0395899_0000001 3300037312 Bacteria 1750322
237 Ga0395899_0001857 3300037312 Bacteria 17464
238 Ga0395900_0000585 3300037418 Bacteria 50049
239 Ga0395898_0208147 3300037466 Bacteria 1866
240 Ga0395905_0002829 3300037471 Bacteria 18995
241 Ga0395905_0004989 3300037471 Bacteria 13674
242 Ga0395905_0053246 3300037471 Bacteria 3788
243 Ga0436361_0057018 3300039447 Bacteria 1905
244 Ga0439449_0010820 3300042007 Bacteria 3443
245 Ga0439458_0001801 3300042157 Bacteria 5331
246 Ga0466969_0000052 3300044656 Bacteria 60425
247 Ga0466969_0006281 3300044656 Bacteria 6319
248 Ga0466966_0000591 3300044684 Bacteria 23091
249 Ga0466966_0013290 3300044684 Bacteria 5450
250 Ga0466966_0014558 3300044684 Bacteria 5206
251 Ga0466957_0012559 3300044842 Bacteria 4903
252 Ga0466959_0014160 3300045049 Bacteria 5789
253 Ga0466959_0086658 3300045049 Bacteria 2253
254 Ga0451576_0228897 3300045051 Bacteria 1941
255 Ga0466958_0082742 3300045836 Bacteria 1977
256 Ga0495592_0037539 3300046454 Bacteria 3647
257 Ga0495603_0004073 3300046455 Bacteria 8704
258 Ga0495603_0005605 3300046455 Bacteria 7501
259 Ga0495590_0001049 3300046457 Bacteria 12169
260 Ga0495629_0001204 3300046459 Bacteria 20390
261 Ga0495629_0002609 3300046459 Bacteria 13818
262 Ga0495638_0008572 3300046460 Bacteria 7235
263 Ga0495638_0045299 3300046460 Bacteria 2768
264 Ga0495653_0003951 3300046463 Bacteria 11974
265 Ga0495653_0008812 3300046463 Bacteria 8262
266 Ga0495653_0072299 3300046463 Bacteria 2576
267 Ga0495650_0001318 3300046471 Bacteria 24990
268 Ga0495650_0005661 3300046471 Bacteria 8018
269 Ga0495580_0005247 3300046472 Bacteria 10767
270 Ga0495580_0008902 3300046472 Bacteria 7939
271 Ga0495582_0002872 3300046473 Bacteria 9632
272 Ga0495582_0103271 3300046473 Bacteria 1597
273 Ga0495605_0001158 3300046474 Bacteria 17488
274 Ga0495605_0009635 3300046474 Bacteria 5425
275 Ga0495662_0021468 3300046476 Bacteria 3120
276 Ga0495664_0001108 3300046477 Bacteria 13945
277 Ga0495664_0010659 3300046477 Bacteria 5160
278 Ga0495584_0048608 3300046491 Bacteria 2138
279 Ga0495585_0060115 3300046492 Bacteria 2092
280 Ga0495606_0010895 3300046507 Bacteria 7484
281 Ga0495610_0000447 3300046512 Bacteria 42590
282 Ga0495620_0012015 3300046515 Bacteria 4496
283 Ga0495628_0009942 3300046516 Bacteria 8096
284 Ga0495628_0010057 3300046516 Bacteria 8048
285 Ga0495628_0132616 3300046516 Bacteria 1904
286 Ga0495628_0156757 3300046516 Bacteria 1732
287 Ga0495630_0004604 3300046517 Bacteria 9666
288 Ga0495643_0016016 3300046522 Bacteria 4413
289 Ga0495666_0000778 3300046526 Bacteria 14730
290 Ga0495642_0003322 3300046528 Bacteria 6355
291 Ga0495642_0006317 3300046528 Bacteria 4544
292 Ga0495652_0003854 3300046529 Bacteria 14631
293 Ga0495652_0014671 3300046529 Bacteria 7025
294 Ga0495652_0129906 3300046529 Bacteria 1996
295 Ga0495665_0000439 3300046531 Bacteria 21025
296 Ga0495665_0055474 3300046531 Bacteria 2092
297 Ga0495640_0006476 3300046533 Bacteria 9260
298 Ga0495586_0002336 3300046535 Bacteria 10318
299 Ga0495587_0001001 3300046536 Bacteria 18582
300 Ga0495597_0021255 3300046542 Bacteria 3018
301 Ga0495645_0000635 3300046543 Bacteria 24184
302 Ga0495645_0027621 3300046543 Bacteria 4123
303 Ga0495622_0000020 3300046557 Bacteria 166839
304 Ga0495622_0004086 3300046557 Bacteria 6808
305 Ga0495634_0006155 3300046642 Bacteria 9135
306 Ga0495635_0006661 3300046663 Bacteria 8069
307 Ga0495635_0012180 3300046663 Bacteria 6030
308 Ga0495661_0025513 3300046665 Bacteria 3816
309 Ga0495599_0022665 3300046678 Bacteria 3921
310 Ga0495599_0098160 3300046678 Bacteria 1826
311 Ga0495599_0104925 3300046678 Bacteria 1760
312 Ga0495623_0070152 3300046679 Bacteria 2183
313 Ga0495646_0001430 3300046680 Bacteria 14199
314 Ga0495669_0003486 3300046684 Bacteria 6487
315 Ga0495613_0007449 3300046689 Bacteria 8156
316 Ga0495624_0002349 3300046690 Bacteria 14365
317 Ga0495624_0006315 3300046690 Bacteria 8421
318 Ga0495671_0026897 3300046692 Bacteria 2977
319 Ga0495581_0007707 3300047315 Bacteria 6230
320 Ga0495581_0027536 3300047315 Bacteria 3295
321 Ga0495604_0004458 3300047317 Bacteria 11089
322 Ga0495604_0008844 3300047317 Bacteria 7959
323 Ga0495636_0004979 3300047318 Bacteria 5210
324 Ga0495674_0007868 3300047319 Bacteria 10179
325 Ga0495674_0033941 3300047319 Bacteria 4617
326 Ga0495674_0035376 3300047319 Bacteria 4507
327 Ga0495674_0096227 3300047319 Bacteria 2523
328 Ga0495672_0004663 3300047320 Bacteria 11111
329 Ga0495672_0017676 3300047320 Bacteria 4763
330 Ga0495680_0003934 3300047322 Bacteria 14369
331 Ga0495683_0002421 3300047323 Bacteria 11280
332 Ga0495687_027705 3300047443 Bacteria 2647
333 Ga0495679_001011 3300047446 Bacteria 17278
334 Ga0495673_0020609 3300047469 Bacteria 3280
335 Ga0495681_0019903 3300047470 Bacteria 3651
336 Ga0495684_0006230 3300047471 Bacteria 9270
337 Ga0495686_0002820 3300047472 Bacteria 15735
338 Ga0495593_0000073 3300047673 Bacteria 42582
339 Ga0495593_0039615 3300047673 Bacteria 2540
340 Ga0495602_0000556 3300048088 Bacteria 34773
341 Ga0495602_0006317 3300048088 Bacteria 12431
342 Ga0495626_0019873 3300048091 Bacteria 3352
343 Ga0496100_0109916 3300048903 Bacteria 1913
344 Ga0496101_0003960 3300048904 Bacteria 9263
345 Ga0496102_0002050 3300048905 Bacteria 17373
346 Ga0496102_0028712 3300048905 Bacteria 4971
347 Ga0496102_0049459 3300048905 Bacteria 3825
348 Ga0496103_0014861 3300048906 Bacteria 4628
349 Ga0496104_0029435 3300048907 Bacteria 5094
350 Ga0496106_0000001 3300048909 Bacteria 497458
351 Ga0496106_0028953 3300048909 Bacteria 4128
352 Ga0496107_0112232 3300048910 Bacteria 2004
353 Ga0496109_0081776 3300048912 Bacteria 2976
354 Ga0496110_0017211 3300048913 Bacteria 6044
355 Ga0496111_0010800 3300048914 Bacteria 6139
356 Ga0496112_0000634 3300048915 Bacteria 24373
357 Ga0496112_0048218 3300048915 Bacteria 4177
358 Ga0496113_0000937 3300048916 Bacteria 15487
359 Ga0496113_0065623 3300048916 Bacteria 2748
360 Ga0496114_0001946 3300048917 Bacteria 15701
361 Ga0496115_0010501 3300048918 Bacteria 6922
362 Ga0496116_0008586 3300048919 Bacteria 8841
363 Ga0496117_0024218 3300048920 Bacteria 4808
364 Ga0496117_0026910 3300048920 Bacteria 4491
365 Ga0496118_0000179 3300048921 Bacteria 113850
366 Ga0496118_0001342 3300048921 Bacteria 37314
367 Ga0496121_0002020 3300048924 Bacteria 32184
368 Ga0496121_0002655 3300048924 Bacteria 26819
369 Ga0496121_0004006 3300048924 Bacteria 20300
370 Ga0496121_0005367 3300048924 Bacteria 16474
371 Ga0496121_0042909 3300048924 Bacteria 3925
372 Ga0496121_0067631 3300048924 Bacteria 2894
373 Ga0496121_0074592 3300048924 Bacteria 2713
374 Ga0496121_0091537 3300048924 Bacteria 2374
375 Ga0496122_0017152 3300048925 Bacteria 6789
376 Ga0496122_0021135 3300048925 Bacteria 5840
377 Ga0496123_0007433 3300048926 Bacteria 10317
378 Ga0496124_0007755 3300048927 Bacteria 11341
379 Ga0496124_0024252 3300048927 Bacteria 5521
380 Ga0496125_0000256 3300048928 Bacteria 109696
381 Ga0496125_0002380 3300048928 Bacteria 24528
382 Ga0496125_0023234 3300048928 Bacteria 5728
383 Ga0496125_0023867 3300048928 Bacteria 5635
384 Ga0496126_0009457 3300048929 Bacteria 10345
385 Ga0496126_0036400 3300048929 Bacteria 4603
386 Ga0501031_0014491 3300049568 Bacteria 5125
387 Ga0501032_0014499 3300049569 Bacteria 5581
388 Ga0501033_0017934 3300049570 Bacteria 5345
389 Ga0501033_0073312 3300049570 Bacteria 2513
390 Ga0501037_0041959 3300049573 Bacteria 3363
391 Ga0501038_0158570 3300049574 Bacteria 1841
392 Ga0501039_0075566 3300049575 Bacteria 2619
393 Ga0501046_0017553 3300049580 Bacteria 5968
394 Ga0501047_0009689 3300049581 Bacteria 9107
395 Ga0501047_0025848 3300049581 Bacteria 5646
396 Ga0501047_0075395 3300049581 Bacteria 3246
397 Ga0501047_0081321 3300049581 Bacteria 3114
398 Ga0501201_000785 3300049651 Bacteria 2974
399 Ga0501202_019487 3300049652 Bacteria 1341
400 Ga0501217_002811 3300049661 Bacteria 3467
401 Ga0501223_014776 3300049663 Bacteria 1547
402 Ga0501243_004138 3300049675 Bacteria 2169
403 Ga0501249_000008 3300049679 Bacteria 197587
404 Ga0501035_0070895 3300049822 Bacteria 3086
405 nmdc:mga0k408_3789_c1 3300050493 Bacteria 8015
406 nmdc:mga07m45_218_c2 3300050496 Bacteria 22025
407 nmdc:mga09592_3774_c1 3300050508 Bacteria 12195
408 nmdc:mga0qj67_73151_c1 3300050509 Bacteria 2737
409 Ga0500578_0005051 3300053086 Bacteria 9072
410 Ga0500651_0002082 3300053093 Bacteria 10390
411 Ga0500641_0001307 3300053096 Bacteria 8846
412 Ga0500562_012868 3300053108 Bacteria 2130
413 Ga0500595_000216 3300053119 Bacteria 39384
414 Ga0500595_008039 3300053119 Bacteria 4328
415 Ga0500568_0039079 3300053139 Bacteria 1918
416 Ga0500616_0028342 3300053153 Unclassified 3086
417 Ga0500622_0002274 3300053156 Bacteria 14102
418 2819620716 2818991450 Bacteria 6962147
419 2510247720 2510065045 Bacteria 7761063
420 2512352978 2512047030 Bacteria 9031815
421 2513235227 2513020052 Bacteria 5120511
422 2515689195 2515154123 Bacteria 6387382
423 2516020935 2515154189 Bacteria 9629850
424 2521557288 2521172590 Bacteria 5047645
425 2522548724 2522125168 Bacteria 7376607
426 2553005360 2551306416 Bacteria 6152985
427 2563063721 2562617112 Bacteria 10918404
428 2599332708 2599185156 Bacteria 5403036
429 2713474607 2711768613 Bacteria 11048459
430 2719638110 2718217991 Bacteria 7829542
431 2738822778 2738541296 Bacteria 7285013
432 2738834985 2738541298 Bacteria 7286732
433 2738876464 2738541306 Bacteria 7284992
434 2739188408 2738543002 Bacteria 7284546
435 2739223060 2738543008 Bacteria 7282815
436 2739613501 2739367655 Bacteria 4051151
437 2765568400 2765235838 Bacteria 5445269
438 2792840874 2791355137 Bacteria 9654227
439 2808981165 2808606386 Bacteria 4471946
440 2809131782 2808606415 Bacteria 4576710
441 2809151406 2808606419 Bacteria 4576925
442 2819594569 2818991445 Bacteria 4955017
443 2833644041 2833640130 Bacteria 4858325
444 2839095362 2839094727 Bacteria 5534556
445 2842907653 2842903701 Bacteria 6986368
446 2842922983 2842922631 Bacteria 5824079
447 2852620887 2852618963 Bacteria 4577824
448 2883089166 2883087390 Bacteria 9532701
449 2883359249 2883354860 Bacteria 5865246
450 2884814459 2884811622 Bacteria 5552861
451 2884839218 2884836552 Bacteria 5219991
452 2884855509 2884852848 Bacteria 5221161
453 2896158984 2896154374 Bacteria 5221518
454 2904531077 2904530477 Bacteria 5876334
455 2904587278 2904584206 Bacteria 6028872
456 2904592687 2904589729 Bacteria 6113573
457 2904604530 2904601388 Bacteria 5884906
458 2919050306 2919046199 Bacteria 5567169
459 2919082352 2919079590 Bacteria 5946433
460 2919684726 2919683626 Bacteria 5534354
461 2923515950 2923510766 Bacteria 5926163
462 2928108682 2928108538 Bacteria 7360024
463 2928135906 2928135762 Bacteria 7259641
464 2928504327 2928503688 Bacteria 7268108
465 2929155991 2929154850 Bacteria 6753285
466 2929522140 2929520902 Bacteria 6765052
467 2945939235 2945934425 Bacteria 7444609
468 2990706572 2990703756 Bacteria 7715990
469 642426443 641736151 Bacteria 7477263
470 643600146 643348564 Bacteria 8839022
471 8002321587 8002317523 Bacteria 8051857
472 8046998496 8046991243 Bacteria 8497463
473 8055266861 8055266321 Bacteria 7999742
474 8055308827 8055301274 Bacteria 8587385
475 8056443609 8056440228 Bacteria 4946504
476 8057977483 8057977335 Bacteria 5694872
477 JGI25155J39150_1000039
478 JGI25155J39150_1000270
479 JGI25156J39149_1000427
480 JGI25156J39149_1000746
481 JGI25154J39366_1000077
482 JGI25154J39366_1000148
483 JGI25157J39369_1000065
484 rootL2_10048108
485 Ga0055538_1000013
486 Ga0055538_1000696
487 Ga0055539_1000018
488 Ga0055533_1000022
489 Ga0055532_1000005
490 Ga0055525_1000024
491 Ga0055541_1000013
492 Ga0055541_1009290
493 Ga0065165_1000339
494 Ga0065714_10070164
495 Ga0070658_10000096
496 Ga0070658_10009782
497 Ga0070658_10032978
498 Ga0070676_10017719
499 Ga0070670_100038967
500 Ga0068869_100003500
501 Ga0068869_100034545
502 Ga0068869_100141806
503 Ga0070680_100046405
504 Ga0070660_100000484
505 Ga0070689_100001735
506 Ga0070691_10022422
507 Ga0070692_10034422
508 Ga0070675_100066177
509 Ga0070674_100027719
510 Ga0070673_100139454
511 Ga0070659_100000283
512 Ga0070700_100000629
513 Ga0070700_100029784
514 Ga0070663_100015977
515 Ga0070678_100013211
516 Ga0070681_10087219
517 Ga0068867_100004244
518 Ga0068867_100096642
519 Ga0070706_100093960
520 Ga0070679_100075932
521 Ga0070684_100083829
522 Ga0068853_100001980
523 Ga0068853_100007462
524 Ga0068853_100008515
525 Ga0070686_100001090
526 Ga0070696_100004741
527 Ga0068855_100001483
528 Ga0068855_100170224
529 Ga0068857_100033920
530 Ga0068856_100001623
531 Ga0068856_100132545
532 Ga0068856_100178223
533 Ga0070702_100000117
534 Ga0068859_100000381
535 Ga0068859_100041774
536 Ga0068864_100072054
537 Ga0068866_10000515
538 Ga0068870_10015547
539 Ga0068858_100007798
540 Ga0068860_100028244
541 Ga0068860_100136373
542 Ga0068862_100074738
543 Ga0068862_100127273
544 Ga0068862_100335032
545 Ga0081455_10034402
546 Ga0081455_10040183
547 Ga0081540_1001161
548 Ga0081539_10009256
549 Ga0081539_10010502
550 Ga0075366_10017023
551 Ga0097621_100002682
552 Ga0075370_10005566
553 Ga0075430_100062793
554 Ga0075429_100005423
555 Ga0068865_100000773
556 Ga0097620_100000381
557 Ga0097620_100041775
558 Ga0105251_10000150
559 Ga0105251_10012309
560 Ga0105240_10001449
561 Ga0105240_10007921
562 Ga0105240_10030759
563 Ga0105240_10142741
564 Ga0105240_10185740
565 Ga0105240_10279216
566 Ga0105245_10000368
567 Ga0105245_10039026
568 Ga0105243_10002735
569 Ga0105241_10061165
570 Ga0105241_10069921
571 Ga0105248_10063159
572 Ga0105237_10000882
573 Ga0105237_10007517
574 Ga0105237_10073122
575 Ga0105237_10305738
576 Ga0105238_10005910
577 Ga0105238_10054050
578 Ga0105239_10002179
579 Ga0105239_10002956
580 Ga0105239_10004379
581 Ga0105239_10026696
582 Ga0105246_10011944
583 Ga0157371_10011735
584 Ga0157370_10011886
585 Ga0157370_10080551
586 Ga0157369_10001781
587 Ga0157369_10008530
588 Ga0157369_10065547
589 Ga0157374_10002960
590 Ga0157374_10046159
591 Ga0157378_10002007
592 Ga0157378_10088624
593 Ga0163162_10007726
594 Ga0157372_10000021
595 Ga0157372_10016640
596 Ga0157375_10064191
597 Ga0157375_10078797
598 Ga0157380_10000610
599 Ga0157379_10032419
600 Ga0157379_10043761
601 Ga0157379_10258344
602 Ga0157376_10161317
603 Ga0182006_1000551
604 Ga0182007_10006654
605 Ga0163161_10079643
606 Ga0209435_100043
607 Ga0209435_100050
608 Ga0209435_100092
609 Ga0209784_100005
610 Ga0209566_100005
611 Ga0209566_100416
612 Ga0209674_100009
613 Ga0209147_100011
614 Ga0209563_100012
615 Ga0209437_100259
616 Ga0209258_100385
617 Ga0209646_1000105
618 Ga0209646_1000161
619 Ga0209026_1000173
620 Ga0209026_1001604
621 Ga0209677_100006
622 Ga0209759_1000169
623 Ga0209759_1000426
624 Ga0209759_1015017
625 Ga0209233_1009111
626 Ga0209676_1000232
627 Ga0207426_1005740
628 Ga0207713_1013715
629 Ga0207642_10000836
630 Ga0207645_10026544
631 Ga0207643_10020484
632 Ga0207705_10000141
633 Ga0207684_10128078
634 Ga0207654_10046158
635 Ga0207654_10108415
636 Ga0207707_10057163
637 Ga0207695_10039305
638 Ga0207695_10084258
639 Ga0207695_10095459
640 Ga0207695_10192723
641 Ga0207671_10055716
642 Ga0207671_10144172
643 Ga0207657_10002890
644 Ga0207657_10136884
645 Ga0207694_10004462
646 Ga0207694_10114810
647 Ga0207659_10040562
648 Ga0207687_10023792
649 Ga0207690_10002858
650 Ga0207686_10001174
651 Ga0207709_10019044
652 Ga0207670_10021704
653 Ga0207704_10000449
654 Ga0207665_10113851
655 Ga0207689_10000088
656 Ga0207689_10035563
657 Ga0207667_10011758
658 Ga0207667_10040991
659 Ga0207667_10069976
660 Ga0207667_10109446
661 Ga0207640_10130973
662 Ga0207658_10183578
663 Ga0207639_10014111
664 Ga0207678_10027705
665 Ga0207708_10000090
666 Ga0207702_10002362
667 Ga0207648_10000202
668 Ga0207648_10084264
669 Ga0207674_10045214
670 Ga0207675_100001897
671 Ga0207683_10042316
672 Ga0268265_10144942
673 Ga0268264_10006452
674 Ga0268264_10112866
675 Ga0307517_10045823
676 Ga0307515_10000002
677 Ga0307515_10000006
678 Ga0307515_10000071
679 Ga0307515_10031909
680 Ga0316177_1081319
681 Ga0316176_1072615
682 Ga0316183_1009917
683 Ga0316181_1061266
684 Ga0265331_10029125
685 Ga0265327_10000600
686 Ga0307509_10045269
687 Ga0307509_10085713
688 Ga0307408_100006632
689 Ga0307408_100026357
690 Ga0307508_10000062
691 Ga0307508_10002665
692 Ga0307508_10208467
693 Ga0307405_10033454
694 Ga0307518_10147877
695 Ga0307406_10014355
696 Ga0307407_10087404
697 Ga0307412_10000015
698 Ga0307412_10077433
699 Ga0307416_100161021
700 Ga0307414_10000323
701 Ga0307414_10002736
702 Ga0307415_100133466
703 Ga0373929_0000115
704 Ga0373944_0012395
705 Ga0373949_0002090
706 Ga0373951_0010643
707 Ga0373932_0000003
708 Ga0373954_0027734
709 Ga0373931_0000011
710 Ga0373935_0010758
711 Ga0373925_0000527
712 Ga0395899_0000001
713 Ga0395899_0001857
714 Ga0395900_0000585
715 Ga0395898_0208147
716 Ga0395905_0002829
717 Ga0395905_0004989
718 Ga0395905_0053246
719 Ga0436361_0057018
720 Ga0439449_0010820
721 Ga0439458_0001801
722 Ga0466969_0000052
723 Ga0466969_0006281
724 Ga0466966_0000591
725 Ga0466966_0013290
726 Ga0466966_0014558
727 Ga0466957_0012559
728 Ga0466959_0014160
729 Ga0466959_0086658
730 Ga0451576_0228897
731 Ga0466958_0082742
732 Ga0495592_0037539
733 Ga0495603_0004073
734 Ga0495603_0005605
735 Ga0495590_0001049
736 Ga0495629_0001204
737 Ga0495629_0002609
738 Ga0495638_0008572
739 Ga0495638_0045299
740 Ga0495653_0003951
741 Ga0495653_0008812
742 Ga0495653_0072299
743 Ga0495650_0001318
744 Ga0495650_0005661
745 Ga0495580_0005247
746 Ga0495580_0008902
747 Ga0495582_0002872
748 Ga0495582_0103271
749 Ga0495605_0001158
750 Ga0495605_0009635
751 Ga0495662_0021468
752 Ga0495664_0001108
753 Ga0495664_0010659
754 Ga0495584_0048608
755 Ga0495585_0060115
756 Ga0495606_0010895
757 Ga0495610_0000447
758 Ga0495620_0012015
759 Ga0495628_0009942
760 Ga0495628_0010057
761 Ga0495628_0132616
762 Ga0495628_0156757
763 Ga0495630_0004604
764 Ga0495643_0016016
765 Ga0495666_0000778
766 Ga0495642_0003322
767 Ga0495642_0006317
768 Ga0495652_0003854
769 Ga0495652_0014671
770 Ga0495652_0129906
771 Ga0495665_0000439
772 Ga0495665_0055474
773 Ga0495640_0006476
774 Ga0495586_0002336
775 Ga0495587_0001001
776 Ga0495597_0021255
777 Ga0495645_0000635
778 Ga0495645_0027621
779 Ga0495622_0000020
780 Ga0495622_0004086
781 Ga0495634_0006155
782 Ga0495635_0006661
783 Ga0495635_0012180
784 Ga0495661_0025513
785 Ga0495599_0022665
786 Ga0495599_0098160
787 Ga0495599_0104925
788 Ga0495623_0070152
789 Ga0495646_0001430
790 Ga0495669_0003486
791 Ga0495613_0007449
792 Ga0495624_0002349
793 Ga0495624_0006315
794 Ga0495671_0026897
795 Ga0495581_0007707
796 Ga0495581_0027536
797 Ga0495604_0004458
798 Ga0495604_0008844
799 Ga0495636_0004979
800 Ga0495674_0007868
801 Ga0495674_0033941
802 Ga0495674_0035376
803 Ga0495674_0096227
804 Ga0495672_0004663
805 Ga0495672_0017676
806 Ga0495680_0003934
807 Ga0495683_0002421
808 Ga0495687_027705
809 Ga0495679_001011
810 Ga0495673_0020609
811 Ga0495681_0019903
812 Ga0495684_0006230
813 Ga0495686_0002820
814 Ga0495593_0000073
815 Ga0495593_0039615
816 Ga0495602_0000556
817 Ga0495602_0006317
818 Ga0495626_0019873
819 Ga0496100_0109916
820 Ga0496101_0003960
821 Ga0496102_0002050
822 Ga0496102_0028712
823 Ga0496102_0049459
824 Ga0496103_0014861
825 Ga0496104_0029435
826 Ga0496106_0000001
827 Ga0496106_0028953
828 Ga0496107_0112232
829 Ga0496109_0081776
830 Ga0496110_0017211
831 Ga0496111_0010800
832 Ga0496112_0000634
833 Ga0496112_0048218
834 Ga0496113_0000937
835 Ga0496113_0065623
836 Ga0496114_0001946
837 Ga0496115_0010501
838 Ga0496116_0008586
839 Ga0496117_0024218
840 Ga0496117_0026910
841 Ga0496118_0000179
842 Ga0496118_0001342
843 Ga0496121_0002020
844 Ga0496121_0002655
845 Ga0496121_0004006
846 Ga0496121_0005367
847 Ga0496121_0042909
848 Ga0496121_0067631
849 Ga0496121_0074592
850 Ga0496121_0091537
851 Ga0496122_0017152
852 Ga0496122_0021135
853 Ga0496123_0007433
854 Ga0496124_0007755
855 Ga0496124_0024252
856 Ga0496125_0000256
857 Ga0496125_0002380
858 Ga0496125_0023234
859 Ga0496125_0023867
860 Ga0496126_0009457
861 Ga0496126_0036400
862 Ga0501031_0014491
863 Ga0501032_0014499
864 Ga0501033_0017934
865 Ga0501033_0073312
866 Ga0501037_0041959
867 Ga0501038_0158570
868 Ga0501039_0075566
869 Ga0501046_0017553
870 Ga0501047_0009689
871 Ga0501047_0025848
872 Ga0501047_0075395
873 Ga0501047_0081321
874 Ga0501201_000785
875 Ga0501202_019487
876 Ga0501217_002811
877 Ga0501223_014776
878 Ga0501243_004138
879 Ga0501249_000008
880 Ga0501035_0070895
881 nmdc:mga0k408_3789_c1
882 nmdc:mga07m45_218_c2
883 nmdc:mga09592_3774_c1
884 nmdc:mga0qj67_73151_c1
885 Ga0500578_0005051
886 Ga0500651_0002082
887 Ga0500641_0001307
888 Ga0500562_012868
889 Ga0500595_000216
890 Ga0500595_008039
891 Ga0500568_0039079
892 Ga0500616_0028342
893 Ga0500622_0002274
894 2819620716
895 2510247720
896 2512352978
897 2513235227
898 2515689195
899 2516020935
900 2521557288
901 2522548724
902 2553005360
903 2563063721
904 2599332708
905 2713474607
906 2719638110
907 2738822778
908 2738834985
909 2738876464
910 2739188408
911 2739223060
912 2739613501
913 2765568400
914 2792840874
915 2808981165
916 2809131782
917 2809151406
918 2819594569
919 2833644041
920 2839095362
921 2842907653
922 2842922983
923 2852620887
924 2883089166
925 2883359249
926 2884814459
927 2884839218
928 2884855509
929 2896158984
930 2904531077
931 2904587278
932 2904592687
933 2904604530
934 2919050306
935 2919082352
936 2919684726
937 2923515950
938 2928108682
939 2928135906
940 2928504327
941 2929155991
942 2929522140
943 2945939235
944 2990706572
945 642426443
946 643600146
947 8002321587
948 8046998496
949 8055266861
950 8055308827
951 8056443609
952 8057977483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17042

NBD_C

Nucleotide-binding C-terminal domain

312

485

0.94

PF07005

SBD_N

Sugar-binding N-terminal domain

50

286

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dqq-assembly2.cif.gz_B the crystal structure of the putative trna synthase from salmonella typhimurium lt2 0.7685 16 410
5dmh-assembly1.cif.gz_A crystal structure of a domain of unknown function (duf1537) from ralstonia eutropha h16 (h16_a1561), target efi-511666, complex with adp. 0.7474 14 418
5dmh-assembly2.cif.gz_B crystal structure of a domain of unknown function (duf1537) from ralstonia eutropha h16 (h16_a1561), target efi-511666, complex with adp. 0.7434 14 418
3dqq-assembly1.cif.gz_A-2 the crystal structure of the putative trna synthase from salmonella typhimurium lt2 0.742 13 410
3dqq-assembly2.cif.gz_B the crystal structure of the putative trna synthase from salmonella typhimurium lt2 0.7375 16 410
ID Description Score Start End Superfamily
3dqqB02 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;Four-carbon acid sugar kinase, nucleotide binding domain 0.7561 241 410 3.40.980.20
5dmhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Putative sugar-binding, N-terminal domain 0.7499 14 237 3.40.50.10840
5dmhA02 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;Four-carbon acid sugar kinase, nucleotide binding domain 0.7465 241 418 3.40.980.20
5dmhA02 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;Four-carbon acid sugar kinase, nucleotide binding domain 0.7314 241 418 3.40.980.20
5dmhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Putative sugar-binding, N-terminal domain 0.7234 14 237 3.40.50.10840
ID Description Score Start End GO Terms
AF-A0A436LN38-F1-model_v4 deleted 0.9574 11 99
AF-A0A2N7X002-F1-model_v4 Four-carbon acid sugar kinase family protein 0.9512 8 420 GO:0005524
GO:0016301
AF-A0A2E0LBY6-F1-model_v4 Type III effector 0.9501 13 418 GO:0005524
GO:0016301
AF-A0A530LL10-F1-model_v4 Four-carbon acid sugar kinase family protein 0.9496 11 111 GO:0016301
AF-A0A436LN38-F1-model_v4 deleted 0.9471 11 99

Map