F451623

General Info

Members Datasets Scaffolds Average Seq Length
476 316 952 546

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055266321|8055270902
Length 574
Sequence LARNGAQPGRRFHYFLQRMNGDRVMSAKAYSHGLEKNAANHVPLTPLTFLDRTADVYPDRTAIIHGDFRQTWAETRERCYRLASALVQLGIEPGDTVSIIAPNTPAMLEAHFGVPLSGAVLNAVNCRLDADGVAFILRHGECKLLLVDREFAPLVEKALQSVPNSPRVIDINDHEAPDGTAIGETDYESLLASGDPAFAGCHPVDEWTPIALNYTSGTTGDPKGVVPSHRGTYLMSLVQMTNWPLPRAPIYLWTLPMFHANGWCFTWAITAAAGTHVCLRKVNAANVLSAIAKHGVDHFCAAPIVLSGIASMHQSEWQPLPRRVRVLTAGSPAPAAVLEAVGAMGFDVDHVFGITEISGTPISCAWHDEWDALPAEQQGKLKARQGVRAAAFEKMSVADLATLEPVPADSKSSGEVLVQGNTVMMGYLKNPEATAKAFDGGWFHTGDIAVVHPDGYIQITDRSKDVIISGGENISSVEVEEVIYRMSGVLNAAVVAQPDDKWGETPCAFIELKADAPSITEEDVISFCRQRLAHFKCPRRVVFGELPKTATGKIQKFRLREQAGSRVAITRLAQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
95 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
96 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
115 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
118 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
119 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
120 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
121 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
122 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
123 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
124 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
125 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
126 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
127 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
128 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
189 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
212 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
215 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
226 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
229 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
230 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
233 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
234 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
235 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
236 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
237 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
238 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
239 2511231022 Pseudomonas sp. GM79 Isolate Nodule
240 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
241 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
242 2547132374 Acidovorax radicis N35 Isolate Unclassified
243 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
244 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
245 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
246 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
247 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
248 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
249 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
250 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
251 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
252 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
253 2643221609 Acidovorax sp. Root217 Isolate Unclassified
254 2643221611 Acidovorax sp. Root219 Isolate Unclassified
255 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
256 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
257 2643221645 Massilia sp. Root351 Isolate Unclassified
258 2643221658 Variovorax sp. Root411 Isolate Unclassified
259 2643221672 Variovorax sp. Root434 Isolate Unclassified
260 2643221683 Variovorax sp. Root473 Isolate Unclassified
261 2643221717 Acidovorax sp. Root267 Isolate Unclassified
262 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
263 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
264 2738541280 Massilia sp. GV090 Isolate Unclassified
265 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
266 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
267 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
268 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
269 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
270 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
271 2738543012 Acidovorax sp. CF301 Isolate Unclassified
272 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
273 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
274 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
275 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
276 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
277 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
278 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
279 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
280 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
281 2816332133 Acidovorax radicis 2721A Isolate Unclassified
282 2818991450 Burkholderia sp. 604 Isolate Unclassified
283 2842677519 Variovorax sp. R-72495 Isolate Unclassified
284 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
285 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
286 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
287 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
288 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
289 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
290 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
291 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
292 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
293 2904456579 Variovorax sp. 2002 Isolate Unclassified
294 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
295 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
296 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
297 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
298 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
299 2928163908 Burkholderia sp. 567 Isolate Unclassified
300 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
301 2929520902 Variovorax beijingensis 502 Isolate Unclassified
302 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
303 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
304 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
305 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
306 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
307 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
308 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
309 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
310 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
311 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
312 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
313 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
314 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
315 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
316 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.77
Metatranscriptomes 0
Isolates 17.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.39
Nodule 2.1
Rhizoplane 4.2
Rhizosphere 70.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_279 2124908027 Bacteria 8187
2 JGI24740J21852_10002078 3300001979 Bacteria 9143
3 JGI24739J22299_10015148 3300001989 Bacteria 2802
4 JGI24739J22299_10015870 3300001989 Bacteria 2732
5 JGI24739J22299_10015892 3300001989 Bacteria 2731
6 JGI24738J21930_10003768 3300002075 Bacteria 3790
7 JGI24751J29686_10001377 3300002459 Bacteria 5111
8 Ga0055537_1000010 3300003773 Bacteria 138059
9 Ga0055524_1015694 3300003775 Bacteria 2750
10 Ga0055536_1000496 3300003781 Bacteria 27262
11 Ga0055534_1000015 3300003784 Bacteria 148531
12 Ga0055528_1000908 3300003790 Bacteria 19991
13 Ga0055530_10000165 3300003791 Bacteria 60120
14 Ga0055530_10004125 3300003791 Bacteria 7709
15 Ga0055540_1000142 3300003792 Bacteria 71685
16 Ga0055540_1000186 3300003792 Bacteria 60120
17 Ga0055531_10000424 3300003794 Bacteria 40020
18 Ga0065714_10003364 3300005288 Bacteria 12768
19 Ga0065714_10004687 3300005288 Bacteria 4780
20 Ga0068869_100128015 3300005334 Bacteria 1949
21 Ga0068868_100018748 3300005338 Bacteria 5176
22 Ga0070660_100000057 3300005339 Bacteria 66715
23 Ga0070691_10033276 3300005341 Bacteria 2425
24 Ga0070669_100036597 3300005353 Bacteria 3557
25 Ga0070674_100063155 3300005356 Bacteria 2591
26 Ga0070659_100000097 3300005366 Bacteria 66243
27 Ga0070667_100005568 3300005367 Bacteria 10514
28 Ga0070663_100021610 3300005455 Bacteria 4284
29 Ga0068867_100005410 3300005459 Bacteria 9031
30 Ga0070707_100011109 3300005468 Bacteria 8388
31 Ga0070698_100051917 3300005471 Bacteria 4174
32 Ga0070699_100030058 3300005518 Bacteria 4688
33 Ga0068852_100003155 3300005616 Bacteria 11496
34 Ga0068859_100023623 3300005617 Bacteria 6170
35 Ga0068859_100058010 3300005617 Bacteria 3899
36 Ga0068863_100001695 3300005841 Bacteria 21824
37 Ga0068863_100070037 3300005841 Bacteria 3316
38 Ga0068858_100165999 3300005842 Bacteria 2080
39 Ga0068862_100004065 3300005844 Bacteria 12404
40 Ga0081540_1000012 3300005983 Bacteria 189939
41 Ga0075363_100027457 3300006048 Bacteria 2919
42 Ga0075432_10000324 3300006058 Bacteria 13530
43 Ga0075432_10015014 3300006058 Bacteria 2639
44 Ga0075432_10021049 3300006058 Bacteria 2231
45 Ga0075362_10002885 3300006177 Bacteria 5884
46 Ga0075362_10004800 3300006177 Bacteria 4883
47 Ga0075362_10021514 3300006177 Bacteria 2708
48 Ga0075362_10048524 3300006177 Bacteria 1895
49 Ga0075369_10014537 3300006186 Bacteria 3146
50 Ga0075370_10000369 3300006353 Bacteria 16488
51 Ga0075431_100001585 3300006847 Bacteria 21156
52 Ga0097620_100023623 3300006931 Bacteria 6170
53 Ga0097620_100058012 3300006931 Bacteria 3899
54 Ga0079104_1015227 3300006946 Bacteria 2286
55 Ga0099826_10003210 3300006948 Bacteria 11008
56 Ga0105251_10000029 3300009011 Bacteria 125097
57 Ga0105244_10010292 3300009036 Bacteria 5679
58 Ga0105244_10010883 3300009036 Bacteria 5488
59 Ga0105250_10030261 3300009092 Bacteria 2177
60 Ga0105240_10004687 3300009093 Bacteria 20679
61 Ga0105243_10000604 3300009148 Bacteria 35803
62 Ga0105243_10013471 3300009148 Bacteria 6185
63 Ga0105243_10275946 3300009148 Bacteria 1512
64 Ga0105248_10054862 3300009177 Bacteria 4470
65 Ga0105237_10004028 3300009545 Bacteria 17166
66 Ga0105237_10008715 3300009545 Bacteria 10953
67 Ga0105237_10074193 3300009545 Bacteria 3394
68 Ga0105238_10097613 3300009551 Bacteria 2923
69 Ga0105249_10022692 3300009553 Bacteria 5624
70 Ga0105249_10118897 3300009553 Bacteria 2509
71 Ga0105239_10181559 3300010375 Bacteria 2354
72 Ga0105246_10001560 3300011119 Bacteria 13630
73 Ga0105246_10046545 3300011119 Bacteria 2959
74 Ga0157373_10000665 3300013100 Bacteria 26863
75 Ga0157373_10000941 3300013100 Bacteria 22534
76 Ga0157371_10017628 3300013102 Bacteria 5298
77 Ga0157370_10066498 3300013104 Bacteria 3409
78 Ga0157378_10292073 3300013297 Bacteria 1575
79 Ga0157375_10021779 3300013308 Bacteria 5886
80 Ga0157375_10054361 3300013308 Bacteria 3943
81 Ga0182008_10027527 3300014497 Bacteria 2878
82 Ga0182008_10059620 3300014497 Bacteria 1883
83 Ga0157379_10224551 3300014968 Bacteria 1702
84 Ga0182006_1006454 3300015261 Bacteria 5449
85 Ga0182007_10004049 3300015262 Bacteria 6748
86 Ga0182007_10008668 3300015262 Bacteria 4161
87 Ga0163161_10012160 3300017792 Bacteria 5970
88 Ga0163161_10014172 3300017792 Bacteria 5552
89 Ga0163161_10027508 3300017792 Bacteria 4035
90 Ga0209759_1001698 3300025256 Bacteria 11430
91 Ga0209565_1000025 3300025263 Bacteria 377969
92 Ga0209673_1000149 3300025273 Bacteria 148659
93 Ga0209673_1001197 3300025273 Bacteria 27836
94 Ga0209675_1000017 3300025291 Bacteria 378002
95 Ga0209675_1002159 3300025291 Bacteria 10364
96 Ga0209676_1000152 3300025292 Bacteria 166700
97 Ga0209676_1004034 3300025292 Bacteria 8455
98 Ga0209676_1005576 3300025292 Bacteria 6509
99 Ga0209050_1000037 3300025298 Bacteria 415612
100 Ga0209050_1000210 3300025298 Bacteria 129834
101 Ga0209256_1001148 3300025299 Bacteria 30046
102 Ga0209051_1000040 3300025303 Bacteria 315055
103 Ga0209051_1000074 3300025303 Bacteria 208667
104 Ga0209051_1000302 3300025303 Bacteria 77692
105 Ga0209051_1005550 3300025303 Bacteria 7337
106 Ga0209257_1000072 3300025304 Bacteria 332791
107 Ga0209257_1002314 3300025304 Bacteria 19259
108 Ga0207696_1014498 3300025711 Bacteria 2701
109 Ga0207655_1010066 3300025728 Bacteria 5783
110 Ga0207655_1019077 3300025728 Bacteria 3605
111 Ga0207713_1000112 3300025735 Bacteria 133341
112 Ga0207680_10034856 3300025903 Bacteria 2883
113 Ga0207647_10014916 3300025904 Bacteria 5340
114 Ga0207647_10024205 3300025904 Bacteria 4005
115 Ga0207657_10000118 3300025919 Bacteria 78669
116 Ga0207687_10035035 3300025927 Bacteria 3412
117 Ga0207690_10000025 3300025932 Bacteria 179019
118 Ga0207706_10014947 3300025933 Bacteria 7029
119 Ga0207709_10000411 3300025935 Bacteria 41804
120 Ga0207689_10027801 3300025942 Bacteria 4733
121 Ga0207712_10004346 3300025961 Bacteria 8954
122 Ga0207712_10049557 3300025961 Bacteria 2927
123 Ga0207668_10023058 3300025972 Bacteria 3995
124 Ga0207658_10003430 3300025986 Bacteria 11221
125 Ga0207678_10000409 3300026067 Bacteria 38784
126 Ga0207678_10091826 3300026067 Bacteria 2595
127 Ga0207648_10036370 3300026089 Bacteria 4338
128 Ga0207698_10082982 3300026142 Bacteria 2592
129 Ga0209282_1000340 3300027666 Bacteria 23191
130 Ga0207428_10013429 3300027907 Bacteria 7153
131 Ga0207428_10094348 3300027907 Bacteria 2320
132 Ga0268265_10002917 3300028380 Bacteria 12539
133 Ga0268265_10169051 3300028380 Bacteria 1866
134 Ga0268264_10040209 3300028381 Bacteria 3863
135 Ga0316177_1007315 3300030731 Bacteria 2294
136 Ga0314311_1093467 3300030733 Bacteria 19086
137 Ga0316183_1057192 3300030742 Bacteria 6511
138 Ga0265340_10023163 3300031247 Bacteria 3168
139 Ga0307513_10004128 3300031456 Bacteria 19469
140 Ga0307408_100000206 3300031548 Bacteria 63271
141 Ga0307408_100027008 3300031548 Bacteria 3951
142 Ga0307508_10023985 3300031616 Bacteria 5536
143 Ga0307405_10017224 3300031731 Bacteria 3960
144 Ga0307405_10040987 3300031731 Bacteria 2808
145 Ga0307413_10054039 3300031824 Bacteria 2435
146 Ga0307406_10000450 3300031901 Bacteria 24010
147 Ga0307407_10072537 3300031903 Bacteria 2054
148 Ga0307412_10000002 3300031911 Bacteria 743446
149 Ga0307412_10001734 3300031911 Bacteria 12053
150 Ga0307416_100104299 3300032002 Bacteria 2478
151 Ga0395899_0000005 3300037312 Bacteria 772966
152 Ga0395900_0000003 3300037418 Bacteria 587648
153 Ga0395900_0172735 3300037418 Bacteria 2199
154 Ga0395898_0000003 3300037466 Bacteria 772986
155 Ga0395905_0004495 3300037471 Bacteria 14462
156 Ga0395905_0014934 3300037471 Bacteria 7408
157 Ga0395905_0031046 3300037471 Bacteria 5031
158 Ga0395901_0000055 3300038443 Bacteria 157964
159 Ga0439447_000025 3300041407 Bacteria 50859
160 Ga0439466_0000532 3300041411 Bacteria 14397
161 Ga0439466_0002660 3300041411 Bacteria 6979
162 Ga0439431_0004711 3300041997 Bacteria 3001
163 Ga0439433_0003095 3300041999 Bacteria 3557
164 Ga0439432_000961 3300042006 Bacteria 10889
165 Ga0439432_002431 3300042006 Bacteria 7011
166 Ga0439452_019771 3300042010 Bacteria 1776
167 Ga0450920_008289 3300042122 Bacteria 1897
168 Ga0450922_001746 3300042124 Bacteria 2107
169 Ga0450923_000327 3300042125 Bacteria 4864
170 Ga0450890_000917 3300042127 Bacteria 4258
171 Ga0450898_004493 3300042134 Bacteria 2065
172 Ga0450902_000008 3300042137 Bacteria 18232
173 Ga0450906_005301 3300042145 Bacteria 2659
174 Ga0450907_000039 3300042146 Bacteria 57175
175 Ga0450907_000904 3300042146 Bacteria 7078
176 Ga0450910_000003 3300042147 Bacteria 81243
177 Ga0450908_003080 3300042184 Bacteria 3246
178 Ga0450893_0004831 3300042532 Bacteria 2152
179 Ga0466966_0047281 3300044684 Bacteria 2744
180 Ga0495617_000553 3300046452 Bacteria 19272
181 Ga0495617_002778 3300046452 Bacteria 6754
182 Ga0495603_0000009 3300046455 Bacteria 72869
183 Ga0495603_0004175 3300046455 Bacteria 8608
184 Ga0495603_0022410 3300046455 Bacteria 3824
185 Ga0495590_0002317 3300046457 Bacteria 7918
186 Ga0495629_0000235 3300046459 Bacteria 48444
187 Ga0495629_0001133 3300046459 Bacteria 21076
188 Ga0495629_0112683 3300046459 Bacteria 1896
189 Ga0495638_0015634 3300046460 Bacteria 5093
190 Ga0495638_0031655 3300046460 Bacteria 3398
191 Ga0495653_0000627 3300046463 Bacteria 26951
192 Ga0495653_0003966 3300046463 Bacteria 11951
193 Ga0495653_0004762 3300046463 Bacteria 10989
194 Ga0495580_0005556 3300046472 Bacteria 10397
195 Ga0495580_0008556 3300046472 Bacteria 8123
196 Ga0495580_0011047 3300046472 Bacteria 7000
197 Ga0495580_0029319 3300046472 Bacteria 3995
198 Ga0495580_0034436 3300046472 Bacteria 3646
199 Ga0495605_0000889 3300046474 Bacteria 20561
200 Ga0495605_0002073 3300046474 Bacteria 12635
201 Ga0495605_0004952 3300046474 Bacteria 7783
202 Ga0495605_0005213 3300046474 Bacteria 7577
203 Ga0495605_0008319 3300046474 Bacteria 5865
204 Ga0495664_0000252 3300046477 Bacteria 25891
205 Ga0495584_0000213 3300046491 Bacteria 41737
206 Ga0495584_0037597 3300046491 Bacteria 2447
207 Ga0495585_0002452 3300046492 Bacteria 13281
208 Ga0495585_0011323 3300046492 Bacteria 5281
209 Ga0495594_0002731 3300046499 Bacteria 9155
210 Ga0495596_0026995 3300046500 Bacteria 2312
211 Ga0495596_0045061 3300046500 Bacteria 1734
212 Ga0495607_0003184 3300046501 Bacteria 12674
213 Ga0495607_0008673 3300046501 Bacteria 6930
214 Ga0495607_0013805 3300046501 Bacteria 5278
215 Ga0495607_0070116 3300046501 Bacteria 1960
216 Ga0495583_0000040 3300046506 Bacteria 236558
217 Ga0495583_0000805 3300046506 Bacteria 38685
218 Ga0495583_0003411 3300046506 Bacteria 12120
219 Ga0495583_0007121 3300046506 Bacteria 7127
220 Ga0495583_0009937 3300046506 Bacteria 5620
221 Ga0495583_0038308 3300046506 Bacteria 2265
222 Ga0495610_0009495 3300046512 Bacteria 6144
223 Ga0495610_0040038 3300046512 Bacteria 2365
224 Ga0495616_0001101 3300046513 Bacteria 19244
225 Ga0495616_0029058 3300046513 Bacteria 2921
226 Ga0495628_0005523 3300046516 Bacteria 11063
227 Ga0495628_0013588 3300046516 Bacteria 6846
228 Ga0495630_0045482 3300046517 Bacteria 3281
229 Ga0495631_0000007 3300046518 Bacteria 130158
230 Ga0495632_0000406 3300046519 Bacteria 40685
231 Ga0495637_0019240 3300046520 Bacteria 3159
232 Ga0495643_0000141 3300046522 Bacteria 115660
233 Ga0495644_0000141 3300046523 Bacteria 34630
234 Ga0495648_0002752 3300046524 Bacteria 15878
235 Ga0495648_0005450 3300046524 Bacteria 10562
236 Ga0495648_0007995 3300046524 Bacteria 8387
237 Ga0495648_0009953 3300046524 Bacteria 7296
238 Ga0495648_0029040 3300046524 Bacteria 3675
239 Ga0495666_0001709 3300046526 Bacteria 10848
240 Ga0495642_0000036 3300046528 Bacteria 79741
241 Ga0495654_0002604 3300046530 Bacteria 11509
242 Ga0495654_0003814 3300046530 Bacteria 9117
243 Ga0495665_0000205 3300046531 Bacteria 30190
244 Ga0495665_0002813 3300046531 Bacteria 9387
245 Ga0495665_0050859 3300046531 Bacteria 2196
246 Ga0495609_0000310 3300046538 Bacteria 43799
247 Ga0495609_0001830 3300046538 Bacteria 13629
248 Ga0495609_0002674 3300046538 Bacteria 10792
249 Ga0495609_0013607 3300046538 Bacteria 3840
250 Ga0495597_0006782 3300046542 Bacteria 5892
251 Ga0495622_0005580 3300046557 Bacteria 5834
252 Ga0495633_0014566 3300046558 Bacteria 4106
253 Ga0495656_0006187 3300046615 Bacteria 4187
254 Ga0495611_0000611 3300046648 Bacteria 20600
255 Ga0495625_0000056 3300046660 Bacteria 186024
256 Ga0495625_0004514 3300046660 Bacteria 13131
257 Ga0495625_0006100 3300046660 Bacteria 10803
258 Ga0495625_0020458 3300046660 Bacteria 5109
259 Ga0495635_0005280 3300046663 Bacteria 8985
260 Ga0495659_0000348 3300046664 Bacteria 18131
261 Ga0495659_0000356 3300046664 Bacteria 17886
262 Ga0495659_0001849 3300046664 Bacteria 6993
263 Ga0495661_0007489 3300046665 Bacteria 7613
264 Ga0495661_0011439 3300046665 Bacteria 6023
265 Ga0495661_0023297 3300046665 Bacteria 4020
266 Ga0495588_0009901 3300046674 Bacteria 4418
267 Ga0495588_0022146 3300046674 Bacteria 3139
268 Ga0495623_0002428 3300046679 Bacteria 12352
269 Ga0495658_0003299 3300046683 Bacteria 8018
270 Ga0495669_0001326 3300046684 Bacteria 10238
271 Ga0495624_0000868 3300046690 Bacteria 23979
272 Ga0495624_0001065 3300046690 Bacteria 21634
273 Ga0495624_0001651 3300046690 Bacteria 17117
274 Ga0495670_0000107 3300046691 Bacteria 36797
275 Ga0495670_0000322 3300046691 Bacteria 22906
276 Ga0495670_0005304 3300046691 Bacteria 6342
277 Ga0495671_0000159 3300046692 Bacteria 59318
278 Ga0495671_0001185 3300046692 Bacteria 17838
279 Ga0495671_0002137 3300046692 Bacteria 12623
280 Ga0495671_0003162 3300046692 Bacteria 10232
281 Ga0495671_0059679 3300046692 Bacteria 1884
282 Ga0495649_0005109 3300046694 Bacteria 8422
283 Ga0495649_0010313 3300046694 Bacteria 5518
284 Ga0495589_0004803 3300046794 Bacteria 7183
285 Ga0495660_0001291 3300046810 Bacteria 17347
286 Ga0495660_0004375 3300046810 Bacteria 8557
287 Ga0495604_0008520 3300047317 Bacteria 8097
288 Ga0495604_0012301 3300047317 Bacteria 6803
289 Ga0495604_0092137 3300047317 Bacteria 2245
290 Ga0495636_0000859 3300047318 Bacteria 11232
291 Ga0495674_0000616 3300047319 Bacteria 33302
292 Ga0495674_0002864 3300047319 Bacteria 16763
293 Ga0495674_0010007 3300047319 Bacteria 8986
294 Ga0495672_0000116 3300047320 Bacteria 127119
295 Ga0495672_0000443 3300047320 Bacteria 49356
296 Ga0495672_0000507 3300047320 Bacteria 44916
297 Ga0495672_0000835 3300047320 Bacteria 32845
298 Ga0495672_0003525 3300047320 Bacteria 13336
299 Ga0495672_0010317 3300047320 Bacteria 6671
300 Ga0495672_0012616 3300047320 Bacteria 5883
301 Ga0495672_0016598 3300047320 Bacteria 4955
302 Ga0495676_0014139 3300047321 Bacteria 7147
303 Ga0495676_0123762 3300047321 Bacteria 1877
304 Ga0495680_0008823 3300047322 Bacteria 9128
305 Ga0495683_0000949 3300047323 Bacteria 20404
306 Ga0495683_0001063 3300047323 Bacteria 18985
307 Ga0495683_0001956 3300047323 Bacteria 12863
308 Ga0495687_000050 3300047443 Bacteria 200856
309 Ga0495687_000159 3300047443 Bacteria 101178
310 Ga0495687_000160 3300047443 Bacteria 100989
311 Ga0495687_000173 3300047443 Bacteria 95361
312 Ga0495687_016727 3300047443 Bacteria 3680
313 Ga0495677_0000681 3300047445 Bacteria 13766
314 Ga0495679_000183 3300047446 Bacteria 56008
315 Ga0495679_015311 3300047446 Bacteria 2809
316 Ga0495685_000124 3300047447 Bacteria 26703
317 Ga0495673_0000015 3300047469 Bacteria 598766
318 Ga0495673_0002000 3300047469 Bacteria 14998
319 Ga0495673_0003069 3300047469 Bacteria 11231
320 Ga0495673_0004139 3300047469 Bacteria 9179
321 Ga0495673_0007250 3300047469 Bacteria 6404
322 Ga0495681_0000838 3300047470 Bacteria 23671
323 Ga0495681_0001873 3300047470 Bacteria 15453
324 Ga0495681_0026926 3300047470 Bacteria 2982
325 Ga0495593_0000051 3300047673 Bacteria 47877
326 Ga0495593_0000564 3300047673 Bacteria 21049
327 Ga0495593_0001352 3300047673 Bacteria 14314
328 Ga0495593_0011892 3300047673 Bacteria 4990
329 Ga0495602_0000105 3300048088 Bacteria 80480
330 Ga0495614_0004544 3300048089 Bacteria 6255
331 Ga0495626_0009362 3300048091 Bacteria 5297
332 Ga0495626_0022876 3300048091 Bacteria 3084
333 Ga0496100_0007150 3300048903 Bacteria 6132
334 Ga0496100_0048240 3300048903 Bacteria 2748
335 Ga0496101_0047564 3300048904 Bacteria 3080
336 Ga0496102_0058525 3300048905 Bacteria 3521
337 Ga0496102_0201693 3300048905 Bacteria 1875
338 Ga0496104_0031261 3300048907 Bacteria 4951
339 Ga0496106_0152562 3300048909 Bacteria 1823
340 Ga0496110_0182053 3300048913 Bacteria 1908
341 Ga0496116_0007049 3300048919 Bacteria 10066
342 Ga0496116_0016164 3300048919 Bacteria 5856
343 Ga0496117_0004567 3300048920 Bacteria 15154
344 Ga0496117_0016852 3300048920 Bacteria 6136
345 Ga0496117_0053965 3300048920 Bacteria 2819
346 Ga0496118_0002082 3300048921 Bacteria 28141
347 Ga0496118_0002433 3300048921 Bacteria 25052
348 Ga0496118_0014372 3300048921 Bacteria 7417
349 Ga0496118_0014897 3300048921 Bacteria 7243
350 Ga0496118_0029614 3300048921 Bacteria 4587
351 Ga0496121_0003972 3300048924 Bacteria 20405
352 Ga0496121_0006629 3300048924 Bacteria 14258
353 Ga0496121_0037767 3300048924 Bacteria 4284
354 Ga0496124_0015512 3300048927 Bacteria 7295
355 Ga0496125_0005016 3300048928 Bacteria 14951
356 Ga0496125_0066976 3300048928 Bacteria 2833
357 Ga0495678_002624 3300049459 Bacteria 11991
358 Ga0495678_003490 3300049459 Bacteria 9685
359 Ga0495678_007470 3300049459 Bacteria 5656
360 Ga0495682_0000202 3300049460 Bacteria 47912
361 Ga0495682_0001271 3300049460 Bacteria 14154
362 Ga0495682_0001369 3300049460 Bacteria 13363
363 Ga0495682_0008951 3300049460 Bacteria 3927
364 Ga0501034_0000106 3300049571 Bacteria 153523
365 Ga0501227_002945 3300049665 Bacteria 3722
366 Ga0501249_002550 3300049679 Bacteria 3675
367 Ga0501225_0001936 3300049705 Bacteria 6482
368 Ga0501262_000018 3300049759 Bacteria 23886
369 Ga0501226_000161 3300049853 Bacteria 11694
370 nmdc:mga03683_10865_c1 3300050489 Bacteria 3275
371 nmdc:mga03683_11850_c1 3300050489 Bacteria 3169
372 nmdc:mga03683_997_c2 3300050489 Bacteria 5792
373 nmdc:mga03n38_6432_c1 3300050490 Bacteria 4079
374 nmdc:mga0k408_11603_c1 3300050493 Bacteria 4802
375 nmdc:mga0k408_28581_c1 3300050493 Bacteria 3171
376 nmdc:mga07m45_286_c1 3300050496 Bacteria 20367
377 nmdc:mga0sz30_3117_c1 3300050516 Bacteria 5941
378 Ga0500610_0000091 3300053079 Bacteria 27427
379 Ga0500610_0000460 3300053079 Bacteria 12558
380 Ga0500643_007027 3300053087 Bacteria 4615
381 Ga0500651_0000038 3300053093 Bacteria 101707
382 Ga0500566_0008492 3300053094 Bacteria 6072
383 Ga0500571_000091 3300053110 Bacteria 29044
384 Ga0500593_000115 3300053117 Bacteria 30964
385 Ga0500594_0001341 3300053118 Bacteria 5330
386 Ga0500597_001054 3300053120 Bacteria 6593
387 Ga0500607_001314 3300053121 Bacteria 22652
388 Ga0500655_004222 3300053133 Bacteria 2587
389 Ga0500658_0000732 3300053134 Bacteria 13527
390 Ga0500658_0004761 3300053134 Bacteria 5057
391 Ga0500574_000613 3300053141 Bacteria 4604
392 Ga0500634_0005260 3300053161 Bacteria 6113
393 Ga0500638_000631 3300053162 Bacteria 9119
394 Ga0500636_0026441 3300053177 Bacteria 3429
395 8055270902 8055266321 Bacteria 7999742
396 2509132118 2508501125 Bacteria 7208311
397 2511246963 2511231002 Bacteria 5042903
398 2511365165 2511231022 Bacteria 6719296
399 2513230723 2513020051 Bacteria 6053213
400 2514040431 2513237165 Bacteria 6771773
401 2548498717 2547132374 Bacteria 5530232
402 2550695954 2548876994 Bacteria 4904866
403 2599614655 2599185212 Bacteria 6765997
404 2599745035 2599185240 Bacteria 7968121
405 2599884432 2599185289 Bacteria 6778765
406 2599896389 2599185291 Bacteria 6775623
407 2600015998 2599185315 Bacteria 6771107
408 2600037233 2599185318 Bacteria 6961590
409 2600051204 2599185321 Bacteria 6764560
410 2600059533 2599185322 Bacteria 6763055
411 2600206784 2599185355 Bacteria 7968906
412 2644062090 2643221609 Bacteria 6756331
413 2644070380 2643221611 Bacteria 6820941
414 2644160123 2643221628 Bacteria 5745828
415 2644186612 2643221633 Bacteria 6733554
416 2644252576 2643221645 Bacteria 7207331
417 2644328247 2643221658 Bacteria 6064537
418 2644400110 2643221672 Bacteria 6322190
419 2644465274 2643221683 Bacteria 5749203
420 2644649448 2643221717 Bacteria 5676132
421 2671089084 2667528170 Bacteria 6786960
422 2676743237 2675903129 Bacteria 7964495
423 2738741314 2738541280 Bacteria 6630198
424 2738820544 2738541296 Bacteria 7285013
425 2738833024 2738541298 Bacteria 7286732
426 2738874551 2738541306 Bacteria 7284992
427 2739186181 2738543002 Bacteria 7284546
428 2739199641 2738543004 Bacteria 6381073
429 2739221149 2738543008 Bacteria 7282815
430 2739243962 2738543012 Bacteria 7115078
431 2808858661 2808606361 Bacteria 6136259
432 2808925571 2808606376 Bacteria 6248667
433 2808937991 2808606378 Bacteria 6177535
434 2808947745 2808606380 Bacteria 6248705
435 2808967166 2808606383 Bacteria 6138645
436 2808981100 2808606386 Bacteria 4471946
437 2809001976 2808606389 Bacteria 6138126
438 2809128320 2808606415 Bacteria 4576710
439 2809147941 2808606419 Bacteria 4576925
440 2816472795 2816332133 Bacteria 7249298
441 2819621192 2818991450 Bacteria 6962147
442 2842677705 2842677519 Bacteria 5615038
443 2842855191 2842854478 Bacteria 6143501
444 2852620646 2852618963 Bacteria 4577824
445 2884815902 2884811622 Bacteria 5552861
446 2884838710 2884836552 Bacteria 5219991
447 2884855002 2884852848 Bacteria 5221161
448 2885195084 2885192300 Bacteria 5882526
449 2896156330 2896154374 Bacteria 5221518
450 2901307421 2901300506 Bacteria 8463898
451 2901312717 2901300506 Bacteria 8463898
452 2904455921 2904449895 Bacteria 6927402
453 2904461682 2904456579 Bacteria 6819253
454 2904623155 2904615490 Bacteria 10047340
455 2919467043 2919462493 Bacteria 5817112
456 2928109292 2928108538 Bacteria 7360024
457 2928136514 2928135762 Bacteria 7259641
458 2928163532 2928157003 Bacteria 7522202
459 2928166581 2928163908 Bacteria 7561269
460 2928503706 2928503688 Bacteria 7268108
461 2929523093 2929520902 Bacteria 6765052
462 2945911363 2945909444 Bacteria 7065066
463 2945938675 2945934425 Bacteria 7444609
464 2945950034 2945945610 Bacteria 5951079
465 2945972243 2945972063 Bacteria 6086495
466 2945986349 2945984333 Bacteria 7358892
467 2974320387 2974320154 Bacteria 4571377
468 2981996572 2981990288 Bacteria 7590678
469 2990708674 2990703756 Bacteria 7715990
470 642426408 641736151 Bacteria 7477263
471 642414437 641736154 Bacteria 7689995
472 642596651 642555112 Bacteria 8676562
473 8003402525 8003400568 Bacteria 5535898
474 8020941476 8020938398 Bacteria 7472757
475 8020955442 8020953355 Bacteria 7439080
476 8056146683 8056143049 Bacteria 6307666
477 MRS2a_Contig_279
478 JGI24740J21852_10002078
479 JGI24739J22299_10015148
480 JGI24739J22299_10015870
481 JGI24739J22299_10015892
482 JGI24738J21930_10003768
483 JGI24751J29686_10001377
484 Ga0055537_1000010
485 Ga0055524_1015694
486 Ga0055536_1000496
487 Ga0055534_1000015
488 Ga0055528_1000908
489 Ga0055530_10000165
490 Ga0055530_10004125
491 Ga0055540_1000142
492 Ga0055540_1000186
493 Ga0055531_10000424
494 Ga0065714_10003364
495 Ga0065714_10004687
496 Ga0068869_100128015
497 Ga0068868_100018748
498 Ga0070660_100000057
499 Ga0070691_10033276
500 Ga0070669_100036597
501 Ga0070674_100063155
502 Ga0070659_100000097
503 Ga0070667_100005568
504 Ga0070663_100021610
505 Ga0068867_100005410
506 Ga0070707_100011109
507 Ga0070698_100051917
508 Ga0070699_100030058
509 Ga0068852_100003155
510 Ga0068859_100023623
511 Ga0068859_100058010
512 Ga0068863_100001695
513 Ga0068863_100070037
514 Ga0068858_100165999
515 Ga0068862_100004065
516 Ga0081540_1000012
517 Ga0075363_100027457
518 Ga0075432_10000324
519 Ga0075432_10015014
520 Ga0075432_10021049
521 Ga0075362_10002885
522 Ga0075362_10004800
523 Ga0075362_10021514
524 Ga0075362_10048524
525 Ga0075369_10014537
526 Ga0075370_10000369
527 Ga0075431_100001585
528 Ga0097620_100023623
529 Ga0097620_100058012
530 Ga0079104_1015227
531 Ga0099826_10003210
532 Ga0105251_10000029
533 Ga0105244_10010292
534 Ga0105244_10010883
535 Ga0105250_10030261
536 Ga0105240_10004687
537 Ga0105243_10000604
538 Ga0105243_10013471
539 Ga0105243_10275946
540 Ga0105248_10054862
541 Ga0105237_10004028
542 Ga0105237_10008715
543 Ga0105237_10074193
544 Ga0105238_10097613
545 Ga0105249_10022692
546 Ga0105249_10118897
547 Ga0105239_10181559
548 Ga0105246_10001560
549 Ga0105246_10046545
550 Ga0157373_10000665
551 Ga0157373_10000941
552 Ga0157371_10017628
553 Ga0157370_10066498
554 Ga0157378_10292073
555 Ga0157375_10021779
556 Ga0157375_10054361
557 Ga0182008_10027527
558 Ga0182008_10059620
559 Ga0157379_10224551
560 Ga0182006_1006454
561 Ga0182007_10004049
562 Ga0182007_10008668
563 Ga0163161_10012160
564 Ga0163161_10014172
565 Ga0163161_10027508
566 Ga0209759_1001698
567 Ga0209565_1000025
568 Ga0209673_1000149
569 Ga0209673_1001197
570 Ga0209675_1000017
571 Ga0209675_1002159
572 Ga0209676_1000152
573 Ga0209676_1004034
574 Ga0209676_1005576
575 Ga0209050_1000037
576 Ga0209050_1000210
577 Ga0209256_1001148
578 Ga0209051_1000040
579 Ga0209051_1000074
580 Ga0209051_1000302
581 Ga0209051_1005550
582 Ga0209257_1000072
583 Ga0209257_1002314
584 Ga0207696_1014498
585 Ga0207655_1010066
586 Ga0207655_1019077
587 Ga0207713_1000112
588 Ga0207680_10034856
589 Ga0207647_10014916
590 Ga0207647_10024205
591 Ga0207657_10000118
592 Ga0207687_10035035
593 Ga0207690_10000025
594 Ga0207706_10014947
595 Ga0207709_10000411
596 Ga0207689_10027801
597 Ga0207712_10004346
598 Ga0207712_10049557
599 Ga0207668_10023058
600 Ga0207658_10003430
601 Ga0207678_10000409
602 Ga0207678_10091826
603 Ga0207648_10036370
604 Ga0207698_10082982
605 Ga0209282_1000340
606 Ga0207428_10013429
607 Ga0207428_10094348
608 Ga0268265_10002917
609 Ga0268265_10169051
610 Ga0268264_10040209
611 Ga0316177_1007315
612 Ga0314311_1093467
613 Ga0316183_1057192
614 Ga0265340_10023163
615 Ga0307513_10004128
616 Ga0307408_100000206
617 Ga0307408_100027008
618 Ga0307508_10023985
619 Ga0307405_10017224
620 Ga0307405_10040987
621 Ga0307413_10054039
622 Ga0307406_10000450
623 Ga0307407_10072537
624 Ga0307412_10000002
625 Ga0307412_10001734
626 Ga0307416_100104299
627 Ga0395899_0000005
628 Ga0395900_0000003
629 Ga0395900_0172735
630 Ga0395898_0000003
631 Ga0395905_0004495
632 Ga0395905_0014934
633 Ga0395905_0031046
634 Ga0395901_0000055
635 Ga0439447_000025
636 Ga0439466_0000532
637 Ga0439466_0002660
638 Ga0439431_0004711
639 Ga0439433_0003095
640 Ga0439432_000961
641 Ga0439432_002431
642 Ga0439452_019771
643 Ga0450920_008289
644 Ga0450922_001746
645 Ga0450923_000327
646 Ga0450890_000917
647 Ga0450898_004493
648 Ga0450902_000008
649 Ga0450906_005301
650 Ga0450907_000039
651 Ga0450907_000904
652 Ga0450910_000003
653 Ga0450908_003080
654 Ga0450893_0004831
655 Ga0466966_0047281
656 Ga0495617_000553
657 Ga0495617_002778
658 Ga0495603_0000009
659 Ga0495603_0004175
660 Ga0495603_0022410
661 Ga0495590_0002317
662 Ga0495629_0000235
663 Ga0495629_0001133
664 Ga0495629_0112683
665 Ga0495638_0015634
666 Ga0495638_0031655
667 Ga0495653_0000627
668 Ga0495653_0003966
669 Ga0495653_0004762
670 Ga0495580_0005556
671 Ga0495580_0008556
672 Ga0495580_0011047
673 Ga0495580_0029319
674 Ga0495580_0034436
675 Ga0495605_0000889
676 Ga0495605_0002073
677 Ga0495605_0004952
678 Ga0495605_0005213
679 Ga0495605_0008319
680 Ga0495664_0000252
681 Ga0495584_0000213
682 Ga0495584_0037597
683 Ga0495585_0002452
684 Ga0495585_0011323
685 Ga0495594_0002731
686 Ga0495596_0026995
687 Ga0495596_0045061
688 Ga0495607_0003184
689 Ga0495607_0008673
690 Ga0495607_0013805
691 Ga0495607_0070116
692 Ga0495583_0000040
693 Ga0495583_0000805
694 Ga0495583_0003411
695 Ga0495583_0007121
696 Ga0495583_0009937
697 Ga0495583_0038308
698 Ga0495610_0009495
699 Ga0495610_0040038
700 Ga0495616_0001101
701 Ga0495616_0029058
702 Ga0495628_0005523
703 Ga0495628_0013588
704 Ga0495630_0045482
705 Ga0495631_0000007
706 Ga0495632_0000406
707 Ga0495637_0019240
708 Ga0495643_0000141
709 Ga0495644_0000141
710 Ga0495648_0002752
711 Ga0495648_0005450
712 Ga0495648_0007995
713 Ga0495648_0009953
714 Ga0495648_0029040
715 Ga0495666_0001709
716 Ga0495642_0000036
717 Ga0495654_0002604
718 Ga0495654_0003814
719 Ga0495665_0000205
720 Ga0495665_0002813
721 Ga0495665_0050859
722 Ga0495609_0000310
723 Ga0495609_0001830
724 Ga0495609_0002674
725 Ga0495609_0013607
726 Ga0495597_0006782
727 Ga0495622_0005580
728 Ga0495633_0014566
729 Ga0495656_0006187
730 Ga0495611_0000611
731 Ga0495625_0000056
732 Ga0495625_0004514
733 Ga0495625_0006100
734 Ga0495625_0020458
735 Ga0495635_0005280
736 Ga0495659_0000348
737 Ga0495659_0000356
738 Ga0495659_0001849
739 Ga0495661_0007489
740 Ga0495661_0011439
741 Ga0495661_0023297
742 Ga0495588_0009901
743 Ga0495588_0022146
744 Ga0495623_0002428
745 Ga0495658_0003299
746 Ga0495669_0001326
747 Ga0495624_0000868
748 Ga0495624_0001065
749 Ga0495624_0001651
750 Ga0495670_0000107
751 Ga0495670_0000322
752 Ga0495670_0005304
753 Ga0495671_0000159
754 Ga0495671_0001185
755 Ga0495671_0002137
756 Ga0495671_0003162
757 Ga0495671_0059679
758 Ga0495649_0005109
759 Ga0495649_0010313
760 Ga0495589_0004803
761 Ga0495660_0001291
762 Ga0495660_0004375
763 Ga0495604_0008520
764 Ga0495604_0012301
765 Ga0495604_0092137
766 Ga0495636_0000859
767 Ga0495674_0000616
768 Ga0495674_0002864
769 Ga0495674_0010007
770 Ga0495672_0000116
771 Ga0495672_0000443
772 Ga0495672_0000507
773 Ga0495672_0000835
774 Ga0495672_0003525
775 Ga0495672_0010317
776 Ga0495672_0012616
777 Ga0495672_0016598
778 Ga0495676_0014139
779 Ga0495676_0123762
780 Ga0495680_0008823
781 Ga0495683_0000949
782 Ga0495683_0001063
783 Ga0495683_0001956
784 Ga0495687_000050
785 Ga0495687_000159
786 Ga0495687_000160
787 Ga0495687_000173
788 Ga0495687_016727
789 Ga0495677_0000681
790 Ga0495679_000183
791 Ga0495679_015311
792 Ga0495685_000124
793 Ga0495673_0000015
794 Ga0495673_0002000
795 Ga0495673_0003069
796 Ga0495673_0004139
797 Ga0495673_0007250
798 Ga0495681_0000838
799 Ga0495681_0001873
800 Ga0495681_0026926
801 Ga0495593_0000051
802 Ga0495593_0000564
803 Ga0495593_0001352
804 Ga0495593_0011892
805 Ga0495602_0000105
806 Ga0495614_0004544
807 Ga0495626_0009362
808 Ga0495626_0022876
809 Ga0496100_0007150
810 Ga0496100_0048240
811 Ga0496101_0047564
812 Ga0496102_0058525
813 Ga0496102_0201693
814 Ga0496104_0031261
815 Ga0496106_0152562
816 Ga0496110_0182053
817 Ga0496116_0007049
818 Ga0496116_0016164
819 Ga0496117_0004567
820 Ga0496117_0016852
821 Ga0496117_0053965
822 Ga0496118_0002082
823 Ga0496118_0002433
824 Ga0496118_0014372
825 Ga0496118_0014897
826 Ga0496118_0029614
827 Ga0496121_0003972
828 Ga0496121_0006629
829 Ga0496121_0037767
830 Ga0496124_0015512
831 Ga0496125_0005016
832 Ga0496125_0066976
833 Ga0495678_002624
834 Ga0495678_003490
835 Ga0495678_007470
836 Ga0495682_0000202
837 Ga0495682_0001271
838 Ga0495682_0001369
839 Ga0495682_0008951
840 Ga0501034_0000106
841 Ga0501227_002945
842 Ga0501249_002550
843 Ga0501225_0001936
844 Ga0501262_000018
845 Ga0501226_000161
846 nmdc:mga03683_10865_c1
847 nmdc:mga03683_11850_c1
848 nmdc:mga03683_997_c2
849 nmdc:mga03n38_6432_c1
850 nmdc:mga0k408_11603_c1
851 nmdc:mga0k408_28581_c1
852 nmdc:mga07m45_286_c1
853 nmdc:mga0sz30_3117_c1
854 Ga0500610_0000091
855 Ga0500610_0000460
856 Ga0500643_007027
857 Ga0500651_0000038
858 Ga0500566_0008492
859 Ga0500571_000091
860 Ga0500593_000115
861 Ga0500594_0001341
862 Ga0500597_001054
863 Ga0500607_001314
864 Ga0500655_004222
865 Ga0500658_0000732
866 Ga0500658_0004761
867 Ga0500574_000613
868 Ga0500634_0005260
869 Ga0500638_000631
870 Ga0500636_0026441
871 8055270902
872 2509132118
873 2511246963
874 2511365165
875 2513230723
876 2514040431
877 2548498717
878 2550695954
879 2599614655
880 2599745035
881 2599884432
882 2599896389
883 2600015998
884 2600037233
885 2600051204
886 2600059533
887 2600206784
888 2644062090
889 2644070380
890 2644160123
891 2644186612
892 2644252576
893 2644328247
894 2644400110
895 2644465274
896 2644649448
897 2671089084
898 2676743237
899 2738741314
900 2738820544
901 2738833024
902 2738874551
903 2739186181
904 2739199641
905 2739221149
906 2739243962
907 2808858661
908 2808925571
909 2808937991
910 2808947745
911 2808967166
912 2808981100
913 2809001976
914 2809128320
915 2809147941
916 2816472795
917 2819621192
918 2842677705
919 2842855191
920 2852620646
921 2884815902
922 2884838710
923 2884855002
924 2885195084
925 2896156330
926 2901307421
927 2901312717
928 2904455921
929 2904461682
930 2904623155
931 2919467043
932 2928109292
933 2928136514
934 2928163532
935 2928166581
936 2928503706
937 2929523093
938 2945911363
939 2945938675
940 2945950034
941 2945972243
942 2945986349
943 2974320387
944 2981996572
945 2990708674
946 642426408
947 642414437
948 642596651
949 8003402525
950 8020941476
951 8020955442
952 8056146683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

478

553

0.95

PF00501

AMP-binding

AMP-binding enzyme

50

428

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v26-assembly1.cif.gz_A crystal structure of tt0168 from thermus thermophilus hb8 0.8783 10 526
1v26-assembly1.cif.gz_B crystal structure of tt0168 from thermus thermophilus hb8 0.8749 10 530
1v26-assembly1.cif.gz_B crystal structure of tt0168 from thermus thermophilus hb8 0.8683 10 530
3ivr-assembly1.cif.gz_B crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009 0.8679 21 426
1v25-assembly1.cif.gz_B crystal structure of tt0168 from thermus thermophilus hb8 0.8665 10 530
ID Description Score Start End Superfamily
af_Q9LQS1_441_544_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9893 429 527 3.30.300.30
af_K7VHQ0_441_545_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9558 429 527 3.30.300.30
5buqA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9542 429 509 3.30.300.30
af_A0A1D6KNL0_124_190_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.952 433 495 3.30.300.30
af_I1JAL4_4_443_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9511 10 428 3.40.50.12780
ID Description Score Start End GO Terms
AF-A0A1F4E6F9-F1-model_v4 Acyl-CoA synthetase 0.9358 6 399 GO:0016874
AF-A0A0V0GIL0-F1-model_v4 Putative ovule protein 0.932 425 529 GO:0016874
AF-A0A3C0C8A4-F1-model_v4 AMP-binding enzyme C-terminal domain-containing protein 0.9204 439 523 GO:0016878
GO:0044550
AF-A0A1F4E6F9-F1-model_v4 Acyl-CoA synthetase 0.8917 6 399 GO:0016874
AF-A0A7N0TP75-F1-model_v4 AMP-dependent synthetase/ligase domain-containing protein 0.8878 8 208 GO:0016874

Map