F451702

General Info

Members Datasets Scaffolds Average Seq Length
477 254 955 276

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10422384|Ga0157372_104223842
Length 271
Sequence MKQIHAVHPEDFKKYDTATIRERFLLNDLFEKDKINFVYTHYDRMIAGGAMPTNRSLELPDFSILRADYFLERREMGIINVGGSGDEKFNLSKLDCLYIGKGSQKINFSSSDINQPAVFYILSAPAHTKYPTRLLQKKDAESTVLGALETSNQRTIYRYIHKNGIQSCQLVMGLTLLEKGSVWNTIPAHTHDRRMEVYFYFDVPENQIVFHYMGQQEETRHIVMKNYQAVASPPWSIHAGSATSNYGFIWGMAGENLEYSDMDVIQLNDLR

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
156 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
220 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
221 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
222 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
223 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
224 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
225 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
244 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
245 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
246 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
247 2818991444 Filimonas endophytica 3197 Isolate Unclassified
248 2842682962 Bacillus sp. R-72492 Isolate Unclassified
249 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
250 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
251 2914759650 Rhizosphaericola mali Isolate Rhizosphere
252 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
253 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
254 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.56
Nodule 0.21
Rhizoplane 0.63
Rhizosphere 89.1
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10422384 3300013307 Bacteria 1554
2 JGI24736J21556_1017597 3300001904 Bacteria 1133
3 JGI24739J22299_10013373 3300001989 Bacteria 2997
4 JGI24737J22298_10005749 3300001990 Bacteria 4269
5 JGI24735J21928_10000013 3300002067 Bacteria 208663
6 rootH1_10001050 3300003316 Bacteria 47333
7 rootL2_10032000 3300003322 Bacteria 5067
8 rootL2_10146929 3300003322 Bacteria 2945
9 rootH1_10024035 3300003316 Bacteria 8072
10 rootH1_10024035 3300003323 Bacteria 75545
11 rootH1_10197073 3300003323 Bacteria 2545
12 JGI25160J50197_1000376 3300003354 Bacteria 29172
13 Ga0065714_10069557 3300005288 Bacteria 4163
14 Ga0065704_10164208 3300005289 Bacteria 1301
15 Ga0070658_10058950 3300005327 Bacteria 3126
16 Ga0070658_10089536 3300005327 Bacteria 2534
17 Ga0070658_10237411 3300005327 Bacteria 1545
18 Ga0070683_100034695 3300005329 Bacteria 4610
19 Ga0070690_100260562 3300005330 Bacteria 1230
20 Ga0070670_100032693 3300005331 Bacteria 4481
21 Ga0070670_100275341 3300005331 Bacteria 1469
22 Ga0068869_100007354 3300005334 Bacteria 7029
23 Ga0068869_100094402 3300005334 Unclassified 2255
24 Ga0068869_100272450 3300005334 Bacteria 1358
25 Ga0070666_10000042 3300005335 Bacteria 112296
26 Ga0070680_100000878 3300005336 Bacteria 21341
27 Ga0070680_100027359 3300005336 Bacteria 4566
28 Ga0070682_100001122 3300005337 Bacteria 15300
29 Ga0068868_100004734 3300005338 Bacteria 9556
30 Ga0068868_100271537 3300005338 Bacteria 1433
31 Ga0070660_100079286 3300005339 Bacteria 2576
32 Ga0070660_100168873 3300005339 Bacteria 1766
33 Ga0070691_10055513 3300005341 Bacteria 1897
34 Ga0070661_100028849 3300005344 Bacteria 4004
35 Ga0070692_10119637 3300005345 Unclassified 1467
36 Ga0070669_100378366 3300005353 Bacteria 1154
37 Ga0070675_100029413 3300005354 Bacteria 4431
38 Ga0070675_100154983 3300005354 Bacteria 1966
39 Ga0070671_100073637 3300005355 Bacteria 2853
40 Ga0070671_100236140 3300005355 Bacteria 1552
41 Ga0070671_100290019 3300005355 Bacteria 1392
42 Ga0070688_100160740 3300005365 Bacteria 1543
43 Ga0070659_100023248 3300005366 Bacteria 4741
44 Ga0070667_100044613 3300005367 Bacteria 3724
45 Ga0070667_100087465 3300005367 Bacteria 2675
46 Ga0070667_100729402 3300005367 Bacteria 918
47 Ga0070700_100212342 3300005441 Bacteria 1366
48 Ga0070663_100066019 3300005455 Bacteria 2621
49 Ga0070678_100364358 3300005456 Bacteria 1246
50 Ga0070681_10107427 3300005458 Bacteria 2731
51 Ga0068867_100371125 3300005459 Bacteria 1199
52 Ga0070679_100003316 3300005530 Bacteria 14753
53 Ga0070684_100384859 3300005535 Unclassified 1292
54 Ga0068853_100017299 3300005539 Bacteria 5952
55 Ga0070686_100350105 3300005544 Bacteria 1110
56 Ga0070693_100000650 3300005547 Bacteria 15328
57 Ga0070665_100000006 3300005548 Bacteria 718034
58 Ga0068855_100005029 3300005563 Bacteria 16134
59 Ga0068855_100021745 3300005563 Bacteria 7693
60 Ga0068855_100022488 3300005563 Bacteria 7555
61 Ga0068855_100268785 3300005563 Bacteria 1896
62 Ga0070664_100020776 3300005564 Bacteria 5409
63 Ga0070664_100459822 3300005564 Bacteria 1169
64 Ga0068857_100001316 3300005577 Bacteria 19543
65 Ga0068857_100430408 3300005577 Bacteria 1231
66 Ga0068854_100228082 3300005578 Bacteria 1477
67 Ga0068856_100050360 3300005614 Bacteria 4106
68 Ga0068856_100070615 3300005614 Bacteria 3455
69 Ga0068856_100097121 3300005614 Bacteria 2935
70 Ga0068856_100115232 3300005614 Bacteria 2687
71 Ga0068852_100000811 3300005616 Bacteria 20584
72 Ga0068852_100001166 3300005616 Bacteria 17391
73 Ga0068852_100009916 3300005616 Bacteria 7093
74 Ga0068852_100089660 3300005616 Bacteria 2749
75 Ga0068852_100568653 3300005616 Bacteria 1135
76 Ga0068852_100637843 3300005616 Bacteria 1072
77 Ga0068852_100670681 3300005616 Bacteria 1045
78 Ga0068859_100013654 3300005617 Bacteria 8143
79 Ga0068859_100067304 3300005617 Bacteria 3616
80 Ga0068859_100178142 3300005617 Bacteria 2208
81 Ga0068864_100009257 3300005618 Bacteria 8121
82 Ga0068864_100071098 3300005618 Bacteria 3029
83 Ga0068864_100207334 3300005618 Bacteria 1803
84 Ga0068864_100477920 3300005618 Unclassified 1196
85 Ga0068851_10012661 3300005834 Bacteria 3982
86 Ga0068851_10081459 3300005834 Bacteria 1691
87 Ga0068863_100005978 3300005841 Bacteria 11939
88 Ga0068863_100052271 3300005841 Bacteria 3872
89 Ga0068858_100046101 3300005842 Bacteria 4041
90 Ga0068860_100000005 3300005843 Bacteria 472349
91 Ga0068860_100002561 3300005843 Bacteria 19014
92 Ga0068860_100003920 3300005843 Bacteria 15287
93 Ga0068860_100027888 3300005843 Bacteria 5438
94 Ga0068860_100112440 3300005843 Bacteria 2604
95 Ga0068860_100451802 3300005843 Unclassified 1278
96 Ga0070716_100084569 3300006173 Bacteria 1903
97 Ga0075366_10008789 3300006195 Bacteria 5625
98 Ga0075366_10181895 3300006195 Bacteria 1277
99 Ga0097621_100002185 3300006237 Bacteria 13386
100 Ga0068871_100019766 3300006358 Bacteria 5146
101 Ga0075428_100080181 3300006844 Bacteria 3562
102 Ga0075430_100007454 3300006846 Bacteria 9235
103 Ga0075431_100055364 3300006847 Bacteria 4091
104 Ga0075429_100086160 3300006880 Bacteria 2738
105 Ga0097620_100013654 3300006931 Bacteria 8143
106 Ga0097620_100039542 3300006931 Bacteria 4732
107 Ga0097620_100067307 3300006931 Bacteria 3616
108 Ga0097620_100178146 3300006931 Bacteria 2208
109 Ga0105240_10001981 3300009093 Bacteria 33825
110 Ga0105240_10002364 3300009093 Bacteria 30415
111 Ga0105240_10008491 3300009093 Bacteria 14689
112 Ga0105240_10083819 3300009093 Bacteria 3910
113 Ga0105240_10186537 3300009093 Bacteria 2442
114 Ga0105240_10212651 3300009093 Bacteria 2258
115 Ga0105247_10022031 3300009101 Bacteria 3835
116 Ga0114129_10067557 3300009147 Bacteria 4985
117 Ga0105243_10105721 3300009148 Bacteria 2345
118 Ga0105241_10006161 3300009174 Bacteria 8845
119 Ga0105241_10009180 3300009174 Bacteria 7279
120 Ga0105241_10122505 3300009174 Bacteria 2096
121 Ga0105237_10002312 3300009545 Bacteria 23678
122 Ga0105237_10006705 3300009545 Bacteria 12727
123 Ga0105237_10011376 3300009545 Bacteria 9413
124 Ga0105237_10021911 3300009545 Bacteria 6562
125 Ga0105237_10103921 3300009545 Bacteria 2833
126 Ga0105237_10191041 3300009545 Bacteria 2048
127 Ga0105237_10387381 3300009545 Bacteria 1403
128 Ga0105237_10772888 3300009545 Bacteria 967
129 Ga0105249_10600628 3300009553 Bacteria 1155
130 Ga0105249_10850480 3300009553 Unclassified 978
131 Ga0105239_10006736 3300010375 Bacteria 13273
132 Ga0105239_10031088 3300010375 Bacteria 5874
133 Ga0105239_10243849 3300010375 Bacteria 2017
134 Ga0105239_10410474 3300010375 Bacteria 1533
135 Ga0105246_10062235 3300011119 Bacteria 2599
136 Ga0157373_10006957 3300013100 Bacteria 8423
137 Ga0157373_10137943 3300013100 Bacteria 1715
138 Ga0157371_10000242 3300013102 Bacteria 78183
139 Ga0157371_10007760 3300013102 Bacteria 8628
140 Ga0157371_10008547 3300013102 Bacteria 8147
141 Ga0157371_10033320 3300013102 Bacteria 3702
142 Ga0157371_10114507 3300013102 Bacteria 1915
143 Ga0157370_10007415 3300013104 Bacteria 11943
144 Ga0157370_10014024 3300013104 Bacteria 8228
145 Ga0157370_10062438 3300013104 Bacteria 3533
146 Ga0157370_10074087 3300013104 Bacteria 3212
147 Ga0157370_10156011 3300013104 Bacteria 2124
148 Ga0157369_10012301 3300013105 Bacteria 9720
149 Ga0157369_10036173 3300013105 Bacteria 5411
150 Ga0157369_10139752 3300013105 Bacteria 2563
151 Ga0157369_10224911 3300013105 Bacteria 1963
152 Ga0157369_10283965 3300013105 Unclassified 1724
153 Ga0157369_10556784 3300013105 Bacteria 1185
154 Ga0157374_10182361 3300013296 Bacteria 2051
155 Ga0157374_10300760 3300013296 Bacteria 1587
156 Ga0157378_10004167 3300013297 Bacteria 12765
157 Ga0157378_10044235 3300013297 Bacteria 3954
158 Ga0157378_10045074 3300013297 Bacteria 3918
159 Ga0157378_10072153 3300013297 Bacteria 3102
160 Ga0157378_10279820 3300013297 Bacteria 1608
161 Ga0157378_10436987 3300013297 Bacteria 1296
162 Ga0163162_10005547 3300013306 Bacteria 12200
163 Ga0163162_10031627 3300013306 Bacteria 5250
164 Ga0163162_10046772 3300013306 Bacteria 4338
165 Ga0163162_10229752 3300013306 Bacteria 1985
166 Ga0157372_10000052 3300013307 Bacteria 135497
167 Ga0157372_10000115 3300013307 Bacteria 84815
168 Ga0157372_10008424 3300013307 Bacteria 10946
169 Ga0157372_10011878 3300013307 Bacteria 9279
170 Ga0157372_10028489 3300013307 Bacteria 6095
171 Ga0157372_10045882 3300013307 Bacteria 4849
172 Ga0157372_10074816 3300013307 Bacteria 3820
173 Ga0157372_10081022 3300013307 Bacteria 3674
174 Ga0157372_10109475 3300013307 Bacteria 3164
175 Ga0157372_10115082 3300013307 Bacteria 3083
176 Ga0157372_10155631 3300013307 Bacteria 2640
177 Ga0157372_10494999 3300013307 Bacteria 1425
178 Ga0157372_10581076 3300013307 Bacteria 1306
179 Ga0157372_10709006 3300013307 Bacteria 1171
180 Ga0157375_10192383 3300013308 Bacteria 2195
181 Ga0163163_10340249 3300014325 Bacteria 1555
182 Ga0163163_10394846 3300014325 Bacteria 1441
183 Ga0157380_10809862 3300014326 Bacteria 954
184 Ga0157379_10295979 3300014968 Bacteria 1474
185 Ga0157379_10475910 3300014968 Unclassified 1155
186 Ga0157376_10002899 3300014969 Bacteria 11760
187 Ga0182006_1000876 3300015261 Bacteria 20226
188 Ga0163161_10000905 3300017792 Bacteria 22916
189 Ga0213872_10011465 3300021361 Bacteria 4191
190 Ga0213876_10005187 3300021384 Bacteria 7187
191 Ga0209026_1000862 3300025250 Bacteria 15839
192 Ga0209233_1004147 3300025261 Bacteria 4986
193 Ga0207426_1000026 3300025302 Bacteria 515228
194 Ga0207697_10161336 3300025315 Bacteria 978
195 Ga0207656_10056065 3300025321 Bacteria 1717
196 Ga0207682_10117240 3300025893 Bacteria 1178
197 Ga0207710_10008199 3300025900 Bacteria 4410
198 Ga0207680_10000228 3300025903 Bacteria 27141
199 Ga0207647_10000480 3300025904 Bacteria 32267
200 Ga0207647_10007430 3300025904 Bacteria 7917
201 Ga0207647_10122070 3300025904 Bacteria 1536
202 Ga0207645_10022378 3300025907 Bacteria 4113
203 Ga0207645_10195536 3300025907 Bacteria 1329
204 Ga0207643_10134355 3300025908 Bacteria 1474
205 Ga0207705_10000015 3300025909 Bacteria 382901
206 Ga0207705_10004284 3300025909 Bacteria 10799
207 Ga0207654_10004675 3300025911 Bacteria 6924
208 Ga0207654_10017743 3300025911 Bacteria 3726
209 Ga0207654_10304322 3300025911 Bacteria 1085
210 Ga0207707_10000722 3300025912 Bacteria 32676
211 Ga0207707_10012266 3300025912 Bacteria 7450
212 Ga0207707_10087874 3300025912 Bacteria 2715
213 Ga0207695_10002702 3300025913 Bacteria 25862
214 Ga0207695_10023732 3300025913 Bacteria 6921
215 Ga0207695_10101098 3300025913 Bacteria 2878
216 Ga0207695_10186053 3300025913 Bacteria 1996
217 Ga0207671_10001247 3300025914 Bacteria 29996
218 Ga0207671_10001635 3300025914 Bacteria 25501
219 Ga0207671_10004787 3300025914 Bacteria 12757
220 Ga0207671_10006785 3300025914 Bacteria 10117
221 Ga0207671_10065245 3300025914 Bacteria 2707
222 Ga0207660_10004797 3300025917 Bacteria 8795
223 Ga0207660_10019465 3300025917 Bacteria 4538
224 Ga0207662_10135392 3300025918 Bacteria 1557
225 Ga0207657_10198998 3300025919 Bacteria 1613
226 Ga0207657_10210605 3300025919 Bacteria 1560
227 Ga0207657_10280592 3300025919 Bacteria 1323
228 Ga0207657_10371862 3300025919 Bacteria 1126
229 Ga0207652_10001022 3300025921 Bacteria 25679
230 Ga0207652_10006617 3300025921 Bacteria 9340
231 Ga0207694_10050498 3300025924 Bacteria 3221
232 Ga0207650_10110269 3300025925 Unclassified 2129
233 Ga0207650_10157283 3300025925 Bacteria 1798
234 Ga0207650_10266897 3300025925 Bacteria 1390
235 Ga0207644_10087314 3300025931 Bacteria 2318
236 Ga0207644_10217730 3300025931 Bacteria 1512
237 Ga0207690_10008826 3300025932 Bacteria 5981
238 Ga0207690_10030335 3300025932 Bacteria 3448
239 Ga0207709_10141262 3300025935 Unclassified 1655
240 Ga0207670_10340712 3300025936 Bacteria 1185
241 Ga0207669_10003972 3300025937 Bacteria 6459
242 Ga0207691_10021466 3300025940 Bacteria 6096
243 Ga0207691_10037667 3300025940 Bacteria 4477
244 Ga0207691_10160726 3300025940 Bacteria 1971
245 Ga0207691_10221128 3300025940 Bacteria 1642
246 Ga0207711_10000028 3300025941 Bacteria 214107
247 Ga0207689_10009695 3300025942 Bacteria 8295
248 Ga0207689_10078572 3300025942 Bacteria 2712
249 Ga0207661_10156025 3300025944 Bacteria 1977
250 Ga0207661_10220451 3300025944 Bacteria 1676
251 Ga0207679_10021840 3300025945 Bacteria 4347
252 Ga0207679_10121644 3300025945 Bacteria 2079
253 Ga0207679_10162180 3300025945 Bacteria 1831
254 Ga0207679_10373854 3300025945 Bacteria 1248
255 Ga0207667_10000009 3300025949 Bacteria 603135
256 Ga0207667_10001800 3300025949 Bacteria 27004
257 Ga0207667_10002024 3300025949 Bacteria 25418
258 Ga0207667_10011416 3300025949 Bacteria 10326
259 Ga0207667_10040996 3300025949 Bacteria 4927
260 Ga0207667_10160636 3300025949 Bacteria 2311
261 Ga0207651_10324120 3300025960 Bacteria 1289
262 Ga0207712_10009009 3300025961 Bacteria 6313
263 Ga0207712_10016687 3300025961 Bacteria 4759
264 Ga0207640_10084794 3300025981 Bacteria 2176
265 Ga0207640_10317146 3300025981 Bacteria 1239
266 Ga0207658_10064798 3300025986 Unclassified 2742
267 Ga0207658_10102615 3300025986 Bacteria 2244
268 Ga0207677_10494537 3300026023 Bacteria 1056
269 Ga0207703_10004767 3300026035 Bacteria 11059
270 Ga0207639_10029149 3300026041 Bacteria 4038
271 Ga0207639_10032202 3300026041 Bacteria 3858
272 Ga0207639_10464122 3300026041 Bacteria 1152
273 Ga0207678_10029748 3300026067 Bacteria 4769
274 Ga0207678_10341038 3300026067 Bacteria 1291
275 Ga0207708_10311876 3300026075 Bacteria 1282
276 Ga0207702_10058064 3300026078 Bacteria 3292
277 Ga0207702_10075338 3300026078 Bacteria 2915
278 Ga0207702_10356659 3300026078 Bacteria 1401
279 Ga0207641_10000158 3300026088 Bacteria 96378
280 Ga0207641_10006686 3300026088 Bacteria 9667
281 Ga0207641_10336642 3300026088 Bacteria 1435
282 Ga0207648_10001073 3300026089 Bacteria 30612
283 Ga0207676_10004127 3300026095 Bacteria 10254
284 Ga0207676_10054313 3300026095 Bacteria 3139
285 Ga0207676_10150795 3300026095 Bacteria 2002
286 Ga0207676_10207452 3300026095 Unclassified 1736
287 Ga0207674_10070485 3300026116 Bacteria 3515
288 Ga0207674_10162918 3300026116 Bacteria 2184
289 Ga0207675_100054038 3300026118 Bacteria 3747
290 Ga0207683_10042793 3300026121 Bacteria 3956
291 Ga0207698_10001170 3300026142 Bacteria 15290
292 Ga0207698_10001210 3300026142 Bacteria 15065
293 Ga0207698_10008221 3300026142 Bacteria 6582
294 Ga0207698_10049231 3300026142 Bacteria 3206
295 Ga0207698_10056355 3300026142 Bacteria 3034
296 Ga0207698_10166184 3300026142 Bacteria 1937
297 Ga0207698_10369743 3300026142 Bacteria 1360
298 Ga0207698_10805741 3300026142 Bacteria 942
299 Ga0209281_1008337 3300027111 Bacteria 2524
300 Ga0268266_10000010 3300028379 Bacteria 1030233
301 Ga0268265_10819947 3300028380 Unclassified 908
302 Ga0268264_10000012 3300028381 Bacteria 521740
303 Ga0268264_10005689 3300028381 Bacteria 10570
304 Ga0268264_10009194 3300028381 Bacteria 8187
305 Ga0268264_10031602 3300028381 Bacteria 4340
306 Ga0268264_10136542 3300028381 Bacteria 2181
307 Ga0307515_10000859 3300028794 Bacteria 69963
308 Ga0307515_10001136 3300028794 Bacteria 61007
309 Ga0265338_10029068 3300028800 Bacteria 5493
310 Ga0307511_10000850 3300030521 Bacteria 32503
311 Ga0265327_10000488 3300031251 Bacteria 69809
312 Ga0265327_10016774 3300031251 Bacteria 4629
313 Ga0265327_10169658 3300031251 Bacteria 1003
314 Ga0307513_10248806 3300031456 Unclassified 1576
315 Ga0307509_10037320 3300031507 Bacteria 5313
316 Ga0307408_100001972 3300031548 Bacteria 14821
317 Ga0307508_10001227 3300031616 Bacteria 29288
318 Ga0307412_10088207 3300031911 Bacteria 2163
319 Ga0307409_100120140 3300031995 Bacteria 2224
320 Ga0307416_100178995 3300032002 Bacteria 1985
321 Ga0307414_10158090 3300032004 Bacteria 1797
322 Ga0307415_100041291 3300032126 Bacteria 3062
323 Ga0316585_10028486 3300032137 Bacteria 1747
324 Ga0316580_10009432 3300032139 Bacteria 2934
325 Ga0307507_10020463 3300033179 Bacteria 7406
326 Ga0307510_10007660 3300033180 Bacteria 12874
327 Ga0373935_0136215 3300035692 Bacteria 1654
328 Ga0395899_0033581 3300037312 Bacteria 3852
329 Ga0395899_0093740 3300037312 Bacteria 2173
330 Ga0395899_0171142 3300037312 Bacteria 1529
331 Ga0395899_0265766 3300037312 Bacteria 1172
332 Ga0395900_0029481 3300037418 Bacteria 5628
333 Ga0395900_0077503 3300037418 Bacteria 3414
334 Ga0395900_0113365 3300037418 Bacteria 2783
335 Ga0395900_0275726 3300037418 Bacteria 1675
336 Ga0395900_0350884 3300037418 Unclassified 1449
337 Ga0395900_0400524 3300037418 Bacteria 1337
338 Ga0395898_0010470 3300037466 Bacteria 9694
339 Ga0395898_0068906 3300037466 Bacteria 3423
340 Ga0395898_0122628 3300037466 Unclassified 2490
341 Ga0395898_0154876 3300037466 Bacteria 2192
342 Ga0395905_0044479 3300037471 Bacteria 4168
343 Ga0395905_0082438 3300037471 Bacteria 3013
344 Ga0395905_0265783 3300037471 Bacteria 1601
345 Ga0395901_0071323 3300038443 Bacteria 3620
346 Ga0395901_0081828 3300038443 Bacteria 3373
347 Ga0395901_0741369 3300038443 Bacteria 976
348 Ga0436365_1251897 3300039437 Bacteria 24739
349 Ga0436365_1501550 3300039437 Unclassified 2102
350 Ga0436361_0544688 3300039447 Bacteria 4916
351 Ga0439436_0007176 3300041404 Bacteria 3429
352 Ga0439439_0000685 3300041406 Bacteria 5987
353 Ga0439466_0040771 3300041411 Bacteria 1552
354 Ga0451855_0034114 3300041511 Bacteria 3113
355 Ga0439433_0003295 3300041999 Bacteria 3460
356 Ga0439445_0053759 3300042004 Bacteria 1091
357 Ga0439449_0004582 3300042007 Bacteria 5343
358 Ga0439449_0004763 3300042007 Bacteria 5237
359 Ga0439449_0038234 3300042007 Bacteria 1785
360 Ga0439457_015664 3300042014 Bacteria 1692
361 Ga0439457_028009 3300042014 Bacteria 1247
362 Ga0439462_0001585 3300042015 Bacteria 5106
363 Ga0439462_0035363 3300042015 Bacteria 1328
364 Ga0439434_0023737 3300042435 Bacteria 1847
365 Ga0439434_0056571 3300042435 Bacteria 1222
366 Ga0451577_0010712 3300042876 Bacteria 8730
367 Ga0451577_0056136 3300042876 Bacteria 3512
368 Ga0451577_0140651 3300042876 Bacteria 2169
369 Ga0451577_0592703 3300042876 Bacteria 1006
370 Ga0453683_0007933 3300044673 Bacteria 7155
371 Ga0453683_0079499 3300044673 Bacteria 2053
372 Ga0453684_0000191 3300044712 Bacteria 267816
373 Ga0453684_0001431 3300044712 Bacteria 68233
374 Ga0453684_0125115 3300044712 Bacteria 3096
375 Ga0451576_0003347 3300045051 Bacteria 22204
376 Ga0451576_0004911 3300045051 Bacteria 17059
377 Ga0495638_0059936 3300046460 Bacteria 2355
378 Ga0495638_0161133 3300046460 Bacteria 1294
379 Ga0495651_0318377 3300046462 Bacteria 1038
380 Ga0495650_0000025 3300046471 Bacteria 486001
381 Ga0495585_0000290 3300046492 Bacteria 50496
382 Ga0495585_0000980 3300046492 Bacteria 23938
383 Ga0495585_0273334 3300046492 Bacteria 837
384 Ga0495606_0000035 3300046507 Bacteria 243820
385 Ga0495606_0010337 3300046507 Bacteria 7761
386 Ga0495606_0057220 3300046507 Bacteria 2512
387 Ga0495610_0001310 3300046512 Bacteria 22164
388 Ga0495610_0014425 3300046512 Bacteria 4641
389 Ga0495616_0012017 3300046513 Bacteria 4930
390 Ga0495637_0022925 3300046520 Bacteria 2842
391 Ga0495652_0139161 3300046529 Bacteria 1911
392 Ga0495652_0231095 3300046529 Bacteria 1383
393 Ga0495652_0562010 3300046529 Bacteria 783
394 Ga0495654_0031871 3300046530 Bacteria 2675
395 Ga0495654_0078093 3300046530 Bacteria 1557
396 Ga0495609_0010365 3300046538 Bacteria 4473
397 Ga0495609_0090612 3300046538 Bacteria 1330
398 Ga0495633_0000172 3300046558 Bacteria 84811
399 Ga0495633_0031931 3300046558 Bacteria 2547
400 Ga0495668_0000069 3300046616 Bacteria 174287
401 Ga0495668_0128064 3300046616 Bacteria 1390
402 Ga0495625_0000063 3300046660 Bacteria 176435
403 Ga0495625_0000385 3300046660 Bacteria 67419
404 Ga0495625_0000419 3300046660 Bacteria 63844
405 Ga0495661_0004990 3300046665 Bacteria 9477
406 Ga0495661_0040839 3300046665 Bacteria 2874
407 Ga0495658_0060081 3300046683 Bacteria 2179
408 Ga0495649_0000006 3300046694 Bacteria 542188
409 Ga0495672_0005283 3300047320 Bacteria 10282
410 Ga0495687_000243 3300047443 Bacteria 75026
411 Ga0495687_001958 3300047443 Bacteria 17588
412 Ga0495614_0067849 3300048089 Bacteria 1535
413 Ga0496114_0265998 3300048917 Unclassified 1511
414 Ga0496115_0164960 3300048918 Bacteria 1832
415 Ga0496123_0022358 3300048926 Bacteria 4875
416 Ga0496124_0003190 3300048927 Bacteria 20256
417 Ga0496124_0014329 3300048927 Bacteria 7669
418 Ga0496125_0004037 3300048928 Bacteria 17207
419 Ga0496126_0000153 3300048929 Bacteria 160642
420 Ga0501291_010833 3300049514 Unclassified 1304
421 Ga0501033_0042980 3300049570 Bacteria 3367
422 Ga0501033_0389698 3300049570 Unclassified 973
423 Ga0501034_0005663 3300049571 Bacteria 13592
424 Ga0501034_0016302 3300049571 Bacteria 7628
425 Ga0501034_0063913 3300049571 Unclassified 3694
426 Ga0501034_0300693 3300049571 Bacteria 1541
427 Ga0501036_0141203 3300049572 Bacteria 2032
428 Ga0501038_0055888 3300049574 Bacteria 3390
429 Ga0501039_0032992 3300049575 Bacteria 3994
430 Ga0501043_0003830 3300049579 Bacteria 12375
431 Ga0501046_0006720 3300049580 Bacteria 10156
432 Ga0501047_0010701 3300049581 Bacteria 8669
433 Ga0501070_0041260 3300049586 Bacteria 3845
434 Ga0501070_0427560 3300049586 Unclassified 1069
435 Ga0501073_0002013 3300049589 Bacteria 15173
436 Ga0501074_0002600 3300049590 Bacteria 12616
437 Ga0501202_029400 3300049652 Bacteria 1139
438 Ga0501223_002156 3300049663 Bacteria 4411
439 Ga0501233_006755 3300049668 Bacteria 2165
440 Ga0501235_028660 3300049669 Bacteria 1251
441 Ga0501240_009402 3300049673 Bacteria 1275
442 Ga0501243_004172 3300049675 Bacteria 2162
443 Ga0501243_008698 3300049675 Bacteria 1569
444 Ga0501225_0042448 3300049705 Bacteria 1256
445 Ga0501080_0018745 3300049742 Bacteria 6404
446 Ga0501080_0181426 3300049742 Bacteria 1937
447 Ga0501083_0012750 3300049744 Bacteria 5878
448 Ga0501035_0049062 3300049822 Bacteria 3784
449 Ga0501035_0079018 3300049822 Bacteria 2906
450 Ga0501044_0045316 3300049823 Bacteria 4557
451 Ga0501044_0251411 3300049823 Bacteria 1708
452 nmdc:mga0k408_190_c1 3300050493 Bacteria 31887
453 nmdc:mga0qj67_44943_c1 3300050509 Bacteria 3484
454 nmdc:mga06r32_117938_c1 3300050510 Bacteria 2616
455 Ga0500647_0124805 3300053091 Bacteria 1217
456 Ga0500583_0015747 3300053092 Unclassified 3001
457 Ga0500562_000047 3300053108 Bacteria 62430
458 Ga0500618_000001 3300053125 Bacteria 538477
459 Ga0500618_020344 3300053125 Bacteria 1626
460 Ga0500642_0010291 3300053130 Unclassified 3292
461 Ga0500616_0009931 3300053153 Bacteria 5729
462 Ga0500619_144813 3300053154 Bacteria 809
463 Ga0500622_0012858 3300053156 Bacteria 4523
464 Ga0500622_0049166 3300053156 Bacteria 2175
465 Ga0500645_017016 3300053730 Bacteria 2284
466 Ga0501082_0077751 3300060353 Bacteria 2861
467 2599480322 2599185184 Bacteria 6430550
468 2738700822 2738541273 Bacteria 4048577
469 2739254571 2738543014 Bacteria 4048139
470 2793182853 2791355222 Bacteria 5898266
471 2819586664 2818991444 Bacteria 6968812
472 2842687151 2842682962 Bacteria 5589973
473 2904119639 2904113452 Bacteria 7796941
474 2910246141 2910245624 Bacteria 6935613
475 2914760424 2914759650 Bacteria 4701441
476 2928083427 2928078545 Bacteria 6534839
477 2928151309 2928147474 Bacteria 6512076
478 2932084610 2932082852 Bacteria 6563563
479 Ga0157372_10422384
480 JGI24736J21556_1017597
481 JGI24739J22299_10013373
482 JGI24737J22298_10005749
483 JGI24735J21928_10000013
484 rootH1_10001050
485 rootL2_10032000
486 rootL2_10146929
487 rootH1_10024035
488 rootH1_10197073
489 JGI25160J50197_1000376
490 Ga0065714_10069557
491 Ga0065704_10164208
492 Ga0070658_10058950
493 Ga0070658_10089536
494 Ga0070658_10237411
495 Ga0070683_100034695
496 Ga0070690_100260562
497 Ga0070670_100032693
498 Ga0070670_100275341
499 Ga0068869_100007354
500 Ga0068869_100094402
501 Ga0068869_100272450
502 Ga0070666_10000042
503 Ga0070680_100000878
504 Ga0070680_100027359
505 Ga0070682_100001122
506 Ga0068868_100004734
507 Ga0068868_100271537
508 Ga0070660_100079286
509 Ga0070660_100168873
510 Ga0070691_10055513
511 Ga0070661_100028849
512 Ga0070692_10119637
513 Ga0070669_100378366
514 Ga0070675_100029413
515 Ga0070675_100154983
516 Ga0070671_100073637
517 Ga0070671_100236140
518 Ga0070671_100290019
519 Ga0070688_100160740
520 Ga0070659_100023248
521 Ga0070667_100044613
522 Ga0070667_100087465
523 Ga0070667_100729402
524 Ga0070700_100212342
525 Ga0070663_100066019
526 Ga0070678_100364358
527 Ga0070681_10107427
528 Ga0068867_100371125
529 Ga0070679_100003316
530 Ga0070684_100384859
531 Ga0068853_100017299
532 Ga0070686_100350105
533 Ga0070693_100000650
534 Ga0070665_100000006
535 Ga0068855_100005029
536 Ga0068855_100021745
537 Ga0068855_100022488
538 Ga0068855_100268785
539 Ga0070664_100020776
540 Ga0070664_100459822
541 Ga0068857_100001316
542 Ga0068857_100430408
543 Ga0068854_100228082
544 Ga0068856_100050360
545 Ga0068856_100070615
546 Ga0068856_100097121
547 Ga0068856_100115232
548 Ga0068852_100000811
549 Ga0068852_100001166
550 Ga0068852_100009916
551 Ga0068852_100089660
552 Ga0068852_100568653
553 Ga0068852_100637843
554 Ga0068852_100670681
555 Ga0068859_100013654
556 Ga0068859_100067304
557 Ga0068859_100178142
558 Ga0068864_100009257
559 Ga0068864_100071098
560 Ga0068864_100207334
561 Ga0068864_100477920
562 Ga0068851_10012661
563 Ga0068851_10081459
564 Ga0068863_100005978
565 Ga0068863_100052271
566 Ga0068858_100046101
567 Ga0068860_100000005
568 Ga0068860_100002561
569 Ga0068860_100003920
570 Ga0068860_100027888
571 Ga0068860_100112440
572 Ga0068860_100451802
573 Ga0070716_100084569
574 Ga0075366_10008789
575 Ga0075366_10181895
576 Ga0097621_100002185
577 Ga0068871_100019766
578 Ga0075428_100080181
579 Ga0075430_100007454
580 Ga0075431_100055364
581 Ga0075429_100086160
582 Ga0097620_100013654
583 Ga0097620_100039542
584 Ga0097620_100067307
585 Ga0097620_100178146
586 Ga0105240_10001981
587 Ga0105240_10002364
588 Ga0105240_10008491
589 Ga0105240_10083819
590 Ga0105240_10186537
591 Ga0105240_10212651
592 Ga0105247_10022031
593 Ga0114129_10067557
594 Ga0105243_10105721
595 Ga0105241_10006161
596 Ga0105241_10009180
597 Ga0105241_10122505
598 Ga0105237_10002312
599 Ga0105237_10006705
600 Ga0105237_10011376
601 Ga0105237_10021911
602 Ga0105237_10103921
603 Ga0105237_10191041
604 Ga0105237_10387381
605 Ga0105237_10772888
606 Ga0105249_10600628
607 Ga0105249_10850480
608 Ga0105239_10006736
609 Ga0105239_10031088
610 Ga0105239_10243849
611 Ga0105239_10410474
612 Ga0105246_10062235
613 Ga0157373_10006957
614 Ga0157373_10137943
615 Ga0157371_10000242
616 Ga0157371_10007760
617 Ga0157371_10008547
618 Ga0157371_10033320
619 Ga0157371_10114507
620 Ga0157370_10007415
621 Ga0157370_10014024
622 Ga0157370_10062438
623 Ga0157370_10074087
624 Ga0157370_10156011
625 Ga0157369_10012301
626 Ga0157369_10036173
627 Ga0157369_10139752
628 Ga0157369_10224911
629 Ga0157369_10283965
630 Ga0157369_10556784
631 Ga0157374_10182361
632 Ga0157374_10300760
633 Ga0157378_10004167
634 Ga0157378_10044235
635 Ga0157378_10045074
636 Ga0157378_10072153
637 Ga0157378_10279820
638 Ga0157378_10436987
639 Ga0163162_10005547
640 Ga0163162_10031627
641 Ga0163162_10046772
642 Ga0163162_10229752
643 Ga0157372_10000052
644 Ga0157372_10000115
645 Ga0157372_10008424
646 Ga0157372_10011878
647 Ga0157372_10028489
648 Ga0157372_10045882
649 Ga0157372_10074816
650 Ga0157372_10081022
651 Ga0157372_10109475
652 Ga0157372_10115082
653 Ga0157372_10155631
654 Ga0157372_10494999
655 Ga0157372_10581076
656 Ga0157372_10709006
657 Ga0157375_10192383
658 Ga0163163_10340249
659 Ga0163163_10394846
660 Ga0157380_10809862
661 Ga0157379_10295979
662 Ga0157379_10475910
663 Ga0157376_10002899
664 Ga0182006_1000876
665 Ga0163161_10000905
666 Ga0213872_10011465
667 Ga0213876_10005187
668 Ga0209026_1000862
669 Ga0209233_1004147
670 Ga0207426_1000026
671 Ga0207697_10161336
672 Ga0207656_10056065
673 Ga0207682_10117240
674 Ga0207710_10008199
675 Ga0207680_10000228
676 Ga0207647_10000480
677 Ga0207647_10007430
678 Ga0207647_10122070
679 Ga0207645_10022378
680 Ga0207645_10195536
681 Ga0207643_10134355
682 Ga0207705_10000015
683 Ga0207705_10004284
684 Ga0207654_10004675
685 Ga0207654_10017743
686 Ga0207654_10304322
687 Ga0207707_10000722
688 Ga0207707_10012266
689 Ga0207707_10087874
690 Ga0207695_10002702
691 Ga0207695_10023732
692 Ga0207695_10101098
693 Ga0207695_10186053
694 Ga0207671_10001247
695 Ga0207671_10001635
696 Ga0207671_10004787
697 Ga0207671_10006785
698 Ga0207671_10065245
699 Ga0207660_10004797
700 Ga0207660_10019465
701 Ga0207662_10135392
702 Ga0207657_10198998
703 Ga0207657_10210605
704 Ga0207657_10280592
705 Ga0207657_10371862
706 Ga0207652_10001022
707 Ga0207652_10006617
708 Ga0207694_10050498
709 Ga0207650_10110269
710 Ga0207650_10157283
711 Ga0207650_10266897
712 Ga0207644_10087314
713 Ga0207644_10217730
714 Ga0207690_10008826
715 Ga0207690_10030335
716 Ga0207709_10141262
717 Ga0207670_10340712
718 Ga0207669_10003972
719 Ga0207691_10021466
720 Ga0207691_10037667
721 Ga0207691_10160726
722 Ga0207691_10221128
723 Ga0207711_10000028
724 Ga0207689_10009695
725 Ga0207689_10078572
726 Ga0207661_10156025
727 Ga0207661_10220451
728 Ga0207679_10021840
729 Ga0207679_10121644
730 Ga0207679_10162180
731 Ga0207679_10373854
732 Ga0207667_10000009
733 Ga0207667_10001800
734 Ga0207667_10002024
735 Ga0207667_10011416
736 Ga0207667_10040996
737 Ga0207667_10160636
738 Ga0207651_10324120
739 Ga0207712_10009009
740 Ga0207712_10016687
741 Ga0207640_10084794
742 Ga0207640_10317146
743 Ga0207658_10064798
744 Ga0207658_10102615
745 Ga0207677_10494537
746 Ga0207703_10004767
747 Ga0207639_10029149
748 Ga0207639_10032202
749 Ga0207639_10464122
750 Ga0207678_10029748
751 Ga0207678_10341038
752 Ga0207708_10311876
753 Ga0207702_10058064
754 Ga0207702_10075338
755 Ga0207702_10356659
756 Ga0207641_10000158
757 Ga0207641_10006686
758 Ga0207641_10336642
759 Ga0207648_10001073
760 Ga0207676_10004127
761 Ga0207676_10054313
762 Ga0207676_10150795
763 Ga0207676_10207452
764 Ga0207674_10070485
765 Ga0207674_10162918
766 Ga0207675_100054038
767 Ga0207683_10042793
768 Ga0207698_10001170
769 Ga0207698_10001210
770 Ga0207698_10008221
771 Ga0207698_10049231
772 Ga0207698_10056355
773 Ga0207698_10166184
774 Ga0207698_10369743
775 Ga0207698_10805741
776 Ga0209281_1008337
777 Ga0268266_10000010
778 Ga0268265_10819947
779 Ga0268264_10000012
780 Ga0268264_10005689
781 Ga0268264_10009194
782 Ga0268264_10031602
783 Ga0268264_10136542
784 Ga0307515_10000859
785 Ga0307515_10001136
786 Ga0265338_10029068
787 Ga0307511_10000850
788 Ga0265327_10000488
789 Ga0265327_10016774
790 Ga0265327_10169658
791 Ga0307513_10248806
792 Ga0307509_10037320
793 Ga0307408_100001972
794 Ga0307508_10001227
795 Ga0307412_10088207
796 Ga0307409_100120140
797 Ga0307416_100178995
798 Ga0307414_10158090
799 Ga0307415_100041291
800 Ga0316585_10028486
801 Ga0316580_10009432
802 Ga0307507_10020463
803 Ga0307510_10007660
804 Ga0373935_0136215
805 Ga0395899_0033581
806 Ga0395899_0093740
807 Ga0395899_0171142
808 Ga0395899_0265766
809 Ga0395900_0029481
810 Ga0395900_0077503
811 Ga0395900_0113365
812 Ga0395900_0275726
813 Ga0395900_0350884
814 Ga0395900_0400524
815 Ga0395898_0010470
816 Ga0395898_0068906
817 Ga0395898_0122628
818 Ga0395898_0154876
819 Ga0395905_0044479
820 Ga0395905_0082438
821 Ga0395905_0265783
822 Ga0395901_0071323
823 Ga0395901_0081828
824 Ga0395901_0741369
825 Ga0436365_1251897
826 Ga0436365_1501550
827 Ga0436361_0544688
828 Ga0439436_0007176
829 Ga0439439_0000685
830 Ga0439466_0040771
831 Ga0451855_0034114
832 Ga0439433_0003295
833 Ga0439445_0053759
834 Ga0439449_0004582
835 Ga0439449_0004763
836 Ga0439449_0038234
837 Ga0439457_015664
838 Ga0439457_028009
839 Ga0439462_0001585
840 Ga0439462_0035363
841 Ga0439434_0023737
842 Ga0439434_0056571
843 Ga0451577_0010712
844 Ga0451577_0056136
845 Ga0451577_0140651
846 Ga0451577_0592703
847 Ga0453683_0007933
848 Ga0453683_0079499
849 Ga0453684_0000191
850 Ga0453684_0001431
851 Ga0453684_0125115
852 Ga0451576_0003347
853 Ga0451576_0004911
854 Ga0495638_0059936
855 Ga0495638_0161133
856 Ga0495651_0318377
857 Ga0495650_0000025
858 Ga0495585_0000290
859 Ga0495585_0000980
860 Ga0495585_0273334
861 Ga0495606_0000035
862 Ga0495606_0010337
863 Ga0495606_0057220
864 Ga0495610_0001310
865 Ga0495610_0014425
866 Ga0495616_0012017
867 Ga0495637_0022925
868 Ga0495652_0139161
869 Ga0495652_0231095
870 Ga0495652_0562010
871 Ga0495654_0031871
872 Ga0495654_0078093
873 Ga0495609_0010365
874 Ga0495609_0090612
875 Ga0495633_0000172
876 Ga0495633_0031931
877 Ga0495668_0000069
878 Ga0495668_0128064
879 Ga0495625_0000063
880 Ga0495625_0000385
881 Ga0495625_0000419
882 Ga0495661_0004990
883 Ga0495661_0040839
884 Ga0495658_0060081
885 Ga0495649_0000006
886 Ga0495672_0005283
887 Ga0495687_000243
888 Ga0495687_001958
889 Ga0495614_0067849
890 Ga0496114_0265998
891 Ga0496115_0164960
892 Ga0496123_0022358
893 Ga0496124_0003190
894 Ga0496124_0014329
895 Ga0496125_0004037
896 Ga0496126_0000153
897 Ga0501291_010833
898 Ga0501033_0042980
899 Ga0501033_0389698
900 Ga0501034_0005663
901 Ga0501034_0016302
902 Ga0501034_0063913
903 Ga0501034_0300693
904 Ga0501036_0141203
905 Ga0501038_0055888
906 Ga0501039_0032992
907 Ga0501043_0003830
908 Ga0501046_0006720
909 Ga0501047_0010701
910 Ga0501070_0041260
911 Ga0501070_0427560
912 Ga0501073_0002013
913 Ga0501074_0002600
914 Ga0501202_029400
915 Ga0501223_002156
916 Ga0501233_006755
917 Ga0501235_028660
918 Ga0501240_009402
919 Ga0501243_004172
920 Ga0501243_008698
921 Ga0501225_0042448
922 Ga0501080_0018745
923 Ga0501080_0181426
924 Ga0501083_0012750
925 Ga0501035_0049062
926 Ga0501035_0079018
927 Ga0501044_0045316
928 Ga0501044_0251411
929 nmdc:mga0k408_190_c1
930 nmdc:mga0qj67_44943_c1
931 nmdc:mga06r32_117938_c1
932 Ga0500647_0124805
933 Ga0500583_0015747
934 Ga0500562_000047
935 Ga0500618_000001
936 Ga0500618_020344
937 Ga0500642_0010291
938 Ga0500616_0009931
939 Ga0500619_144813
940 Ga0500622_0012858
941 Ga0500622_0049166
942 Ga0500645_017016
943 Ga0501082_0077751
944 2599480322
945 2738700822
946 2739254571
947 2793182853
948 2819586664
949 2842687151
950 2904119639
951 2910246141
952 2914760424
953 2928083427
954 2928151309
955 2932084610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04962

KduI

KduI/IolB family

26

267

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xru-assembly1.cif.gz_A crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli 0.9827 2 274
1ywk-assembly3.cif.gz_C crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis 0.9826 2 259
1ywk-assembly6.cif.gz_F crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis 0.9803 2 260
1x8m-assembly1.cif.gz_A x-ray structure of pectin degrading enzyme 5-keto 4-deoxyuronate isomerase from escherichia coli 0.9772 1 264
7yrs-assembly4.cif.gz_D crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mops 0.9758 2 261
ID Description Score Start End Superfamily
af_Q46938_25_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9838 26 263 2.60.120.10
1ywkB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9802 2 260 2.60.120.10
af_Q46938_25_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9677 26 263 2.60.120.10
1ywkB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9612 2 260 2.60.120.10
1x8mA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9587 140 264 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q3G1I0-F1-model_v4 deleted 0.9972 1 143
AF-A0A4Q3L616-F1-model_v4 deleted 0.9956 1 253
AF-A0A351RGT4-F1-model_v4 deleted 0.9953 1 135
AF-A0A4Q5YMU5-F1-model_v4 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) 0.9941 1 239 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872
AF-A0A484YH81-F1-model_v4 5-keto-4-deoxyuronate isomerase (EC 5.3.1.17) 0.9938 67 140 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872

Map