F451741

General Info

Members Datasets Scaffolds Average Seq Length
477 269 477 290

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0244439|Ga0373935_0244439_108_1139
Length 343
Sequence VIRTSRPSSDNNSLASGFATGIGYHPTENPIQASPEMLTIGSGAEHLKIYLIDGTYELFRHYYALPSARDAQGREVAAVRGVLASVLGMIKEGATHVAVATDHVIESFRNDLWADYKTSEGVEPDLLAQFPLLEEALSTAGIVVWPMVEFEADDALAAAAIAAAQNATVEQVVICTPDKDLAQCVRGNRIVQLNRRTRVIIDEPGVIAKFGVMPASIPDYLALVGDSADGYPGLSGWGAKSSAAVLAKFGHLESIPKDSREWGVKVTSASTLAETLHRDYDNAILFRQLATLRTEIKLFDDLDKLRWNGPTPAYDAIASQLDAAVTQPAADPRKGRSKRTAGV

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
103 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
104 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
155 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 2.94
Rhizosphere 94.34
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000897 3300000546 Bacteria 4853
2 rootH1_10113718 3300003316 Bacteria 2068
3 JGI25407J50210_10007866 3300003373 Bacteria 2680
4 Ga0065715_10108071 3300005293 Bacteria 2738
5 Ga0070676_10002640 3300005328 Bacteria 9232
6 Ga0070683_100049005 3300005329 Unclassified 3906
7 Ga0070690_100015700 3300005330 Bacteria 4524
8 Ga0070690_100026385 3300005330 Bacteria 3584
9 Ga0070670_100007650 3300005331 Bacteria 9181
10 Ga0068869_100001584 3300005334 Bacteria 13521
11 Ga0070682_100174042 3300005337 Bacteria 1498
12 Ga0068868_100545715 3300005338 Bacteria 1021
13 Ga0070689_100039331 3300005340 Bacteria 3621
14 Ga0070691_10057038 3300005341 Unclassified 1873
15 Ga0070687_100042245 3300005343 Bacteria 2309
16 Ga0070687_100136043 3300005343 Bacteria 1425
17 Ga0070661_100219860 3300005344 Bacteria 1457
18 Ga0070661_100351179 3300005344 Bacteria 1157
19 Ga0070668_100385426 3300005347 Bacteria 1194
20 Ga0070669_100000264 3300005353 Bacteria 42905
21 Ga0070675_100001452 3300005354 Bacteria 17447
22 Ga0070671_100083463 3300005355 Bacteria 2672
23 Ga0070688_100066390 3300005365 Bacteria 2295
24 Ga0070659_100093406 3300005366 Unclassified 2414
25 Ga0070709_10024772 3300005434 Bacteria 3536
26 Ga0070709_10217363 3300005434 Bacteria 1361
27 Ga0070714_100000417 3300005435 Bacteria 31156
28 Ga0070714_100165190 3300005435 Bacteria 2006
29 Ga0070713_100087683 3300005436 Bacteria 2670
30 Ga0070713_100212880 3300005436 Bacteria 1750
31 Ga0070713_100341784 3300005436 Bacteria 1387
32 Ga0070710_10025175 3300005437 Bacteria 3149
33 Ga0070710_10176154 3300005437 Bacteria 1336
34 Ga0070710_10204581 3300005437 Unclassified 1248
35 Ga0070701_10035763 3300005438 Bacteria 2498
36 Ga0070701_10045571 3300005438 Bacteria 2251
37 Ga0070711_100115526 3300005439 Bacteria 1976
38 Ga0070711_100334871 3300005439 Bacteria 1212
39 Ga0070705_100009513 3300005440 Bacteria 4834
40 Ga0070705_100152604 3300005440 Bacteria 1534
41 Ga0070700_100002527 3300005441 Bacteria 9332
42 Ga0070700_100150955 3300005441 Bacteria 1589
43 Ga0070700_100279783 3300005441 Bacteria 1209
44 Ga0070694_100015482 3300005444 Bacteria 4792
45 Ga0070694_100098237 3300005444 Bacteria 2067
46 Ga0070694_100133187 3300005444 Bacteria 1798
47 Ga0070708_100136844 3300005445 Unclassified 2270
48 Ga0070681_10002705 3300005458 Bacteria 16308
49 Ga0070681_10465367 3300005458 Bacteria 1177
50 Ga0068867_100000379 3300005459 Bacteria 29589
51 Ga0068867_100002337 3300005459 Bacteria 13348
52 Ga0070698_100019858 3300005471 Bacteria 7048
53 Ga0070699_100002167 3300005518 Bacteria 17771
54 Ga0070699_100124881 3300005518 Bacteria 2265
55 Ga0070679_100085306 3300005530 Unclassified 3145
56 Ga0070679_100094886 3300005530 Bacteria 2971
57 Ga0070684_100029274 3300005535 Bacteria 4665
58 Ga0070684_100089472 3300005535 Unclassified 2736
59 Ga0068853_100177452 3300005539 Bacteria 1931
60 Ga0070672_100005182 3300005543 Bacteria 8618
61 Ga0070686_100422460 3300005544 Bacteria 1019
62 Ga0070695_100000153 3300005545 Bacteria 32488
63 Ga0070695_100058698 3300005545 Bacteria 2488
64 Ga0070696_100000606 3300005546 Bacteria 23003
65 Ga0070696_100001125 3300005546 Bacteria 17305
66 Ga0070693_100131159 3300005547 Bacteria 1567
67 Ga0070693_100346651 3300005547 Unclassified 1015
68 Ga0070704_100007048 3300005549 Bacteria 6671
69 Ga0070704_100041130 3300005549 Bacteria 3188
70 Ga0070704_100115638 3300005549 Bacteria 2050
71 Ga0068855_100000534 3300005563 Bacteria 46563
72 Ga0068855_100006321 3300005563 Bacteria 14435
73 Ga0070664_100034423 3300005564 Bacteria 4250
74 Ga0068857_100041570 3300005577 Bacteria 4077
75 Ga0068854_100089624 3300005578 Bacteria 2286
76 Ga0068856_100005137 3300005614 Bacteria 12922
77 Ga0068856_100010267 3300005614 Bacteria 9101
78 Ga0068856_100115278 3300005614 Unclassified 2686
79 Ga0070702_100009710 3300005615 Bacteria 4720
80 Ga0068852_100003632 3300005616 Bacteria 10805
81 Ga0068859_100007517 3300005617 Bacteria 11060
82 Ga0068859_100022095 3300005617 Bacteria 6378
83 Ga0068859_100370897 3300005617 Bacteria 1527
84 Ga0068864_100006858 3300005618 Bacteria 9331
85 Ga0068866_10004428 3300005718 Bacteria 5769
86 Ga0068861_100001392 3300005719 Bacteria 15179
87 Ga0068861_100023826 3300005719 Bacteria 4420
88 Ga0068870_10087090 3300005840 Bacteria 1738
89 Ga0068863_100165372 3300005841 Bacteria 2121
90 Ga0068863_100356509 3300005841 Bacteria 1425
91 Ga0068858_100042992 3300005842 Bacteria 4190
92 Ga0068858_100045476 3300005842 Bacteria 4069
93 Ga0068860_100188378 3300005843 Bacteria 1996
94 Ga0068862_100000749 3300005844 Bacteria 32563
95 Ga0081455_10006418 3300005937 Bacteria 12609
96 Ga0081455_10086322 3300005937 Bacteria 2556
97 Ga0081538_10000261 3300005981 Bacteria 59962
98 Ga0081538_10001412 3300005981 Bacteria 24701
99 Ga0081538_10035107 3300005981 Bacteria 3300
100 Ga0070717_10006682 3300006028 Bacteria 8506
101 Ga0070717_10087625 3300006028 Bacteria 2622
102 Ga0075432_10015596 3300006058 Bacteria 2592
103 Ga0070716_100057085 3300006173 Unclassified 2242
104 Ga0070716_100089823 3300006173 Bacteria 1857
105 Ga0070712_100008286 3300006175 Bacteria 6531
106 Ga0075367_10074639 3300006178 Bacteria 2045
107 Ga0097621_100000147 3300006237 Bacteria 42959
108 Ga0097621_100002868 3300006237 Bacteria 11830
109 Ga0097621_100047510 3300006237 Unclassified 3479
110 Ga0068871_100001743 3300006358 Bacteria 14658
111 Ga0068871_100002411 3300006358 Bacteria 12759
112 Ga0068871_100058287 3300006358 Bacteria 3144
113 Ga0068871_100072117 3300006358 Bacteria 2843
114 Ga0075428_100006791 3300006844 Bacteria 12735
115 Ga0075428_100016866 3300006844 Bacteria 8065
116 Ga0075428_100031062 3300006844 Bacteria 5905
117 Ga0075428_100076478 3300006844 Bacteria 3655
118 Ga0075430_100001082 3300006846 Bacteria 21605
119 Ga0075430_100004271 3300006846 Bacteria 12065
120 Ga0075430_100005488 3300006846 Bacteria 10714
121 Ga0075430_100021843 3300006846 Bacteria 5438
122 Ga0075430_100035519 3300006846 Bacteria 4228
123 Ga0075430_100098840 3300006846 Bacteria 2438
124 Ga0075431_100000382 3300006847 Bacteria 35471
125 Ga0075431_100029961 3300006847 Bacteria 5604
126 Ga0075431_100048979 3300006847 Bacteria 4358
127 Ga0075431_100097183 3300006847 Bacteria 3041
128 Ga0075433_10290993 3300006852 Bacteria 1447
129 Ga0075434_100188937 3300006871 Unclassified 2080
130 Ga0075434_100603185 3300006871 Unclassified 1117
131 Ga0075429_100001061 3300006880 Bacteria 21985
132 Ga0075429_100003659 3300006880 Bacteria 13092
133 Ga0075429_100466852 3300006880 Bacteria 1106
134 Ga0068865_100013509 3300006881 Bacteria 5162
135 Ga0068865_100028100 3300006881 Bacteria 3722
136 Ga0075436_100022008 3300006914 Bacteria 4377
137 Ga0097620_100007517 3300006931 Bacteria 11060
138 Ga0097620_100022095 3300006931 Bacteria 6378
139 Ga0097620_100370912 3300006931 Bacteria 1527
140 Ga0075435_100019856 3300007076 Bacteria 5140
141 Ga0075435_100025458 3300007076 Bacteria 4606
142 Ga0075435_100390979 3300007076 Bacteria 1195
143 Ga0105240_10013092 3300009093 Bacteria 11417
144 Ga0105240_10033322 3300009093 Bacteria 6657
145 Ga0111539_10016868 3300009094 Bacteria 9045
146 Ga0111539_10061163 3300009094 Bacteria 4462
147 Ga0111539_10422655 3300009094 Bacteria 1552
148 Ga0105245_10329563 3300009098 Bacteria 1506
149 Ga0114129_10000014 3300009147 Bacteria 130267
150 Ga0114129_10005125 3300009147 Bacteria 18443
151 Ga0114129_10112249 3300009147 Bacteria 3759
152 Ga0114129_10177017 3300009147 Bacteria 2905
153 Ga0114129_10311126 3300009147 Bacteria 2097
154 Ga0114129_10322610 3300009147 Bacteria 2053
155 Ga0105243_10009357 3300009148 Bacteria 7467
156 Ga0105243_10017363 3300009148 Bacteria 5439
157 Ga0105243_10039759 3300009148 Bacteria 3669
158 Ga0105241_10034460 3300009174 Unclassified 3803
159 Ga0105242_10046283 3300009176 Bacteria 3529
160 Ga0105248_10010106 3300009177 Bacteria 10394
161 Ga0105248_10016274 3300009177 Bacteria 8187
162 Ga0105238_10231384 3300009551 Bacteria 1825
163 Ga0105239_10679426 3300010375 Bacteria 1177
164 Ga0105246_10123263 3300011119 Bacteria 1924
165 Ga0157369_10004844 3300013105 Bacteria 15794
166 Ga0157369_10232719 3300013105 Unclassified 1926
167 Ga0157374_10022846 3300013296 Bacteria 5586
168 Ga0157374_10079663 3300013296 Unclassified 3104
169 Ga0157378_10004464 3300013297 Bacteria 12293
170 Ga0157378_10027422 3300013297 Bacteria 5027
171 Ga0157378_10117123 3300013297 Bacteria 2451
172 Ga0157378_10227811 3300013297 Bacteria 1774
173 Ga0157378_10583457 3300013297 Bacteria 1127
174 Ga0163162_10007685 3300013306 Bacteria 10499
175 Ga0157372_10014401 3300013307 Bacteria 8457
176 Ga0157375_10012437 3300013308 Bacteria 7553
177 Ga0157375_10059600 3300013308 Bacteria 3783
178 Ga0163163_10035752 3300014325 Bacteria 4821
179 Ga0163163_10223385 3300014325 Bacteria 1932
180 Ga0157380_10006175 3300014326 Bacteria 8405
181 Ga0157380_10132135 3300014326 Bacteria 2131
182 Ga0157377_10103151 3300014745 Bacteria 1703
183 Ga0157377_10258966 3300014745 Bacteria 1131
184 Ga0157376_10010725 3300014969 Bacteria 6719
185 Ga0157376_10526992 3300014969 Unclassified 1165
186 Ga0182006_1051402 3300015261 Bacteria 1585
187 Ga0224570_100859 3300022730 Unclassified 2428
188 Ga0224572_1013414 3300024225 Bacteria 1562
189 Ga0228598_1001698 3300024227 Bacteria 4819
190 Ga0207426_1030926 3300025302 Bacteria 1751
191 Ga0207653_10017713 3300025885 Bacteria 2242
192 Ga0207682_10020517 3300025893 Bacteria 2594
193 Ga0207642_10003863 3300025899 Bacteria 4776
194 Ga0207647_10095375 3300025904 Bacteria 1771
195 Ga0207685_10008558 3300025905 Bacteria 2922
196 Ga0207699_10131741 3300025906 Bacteria 1632
197 Ga0207699_10172749 3300025906 Bacteria 1447
198 Ga0207645_10003772 3300025907 Bacteria 11384
199 Ga0207643_10098421 3300025908 Bacteria 1712
200 Ga0207654_10106018 3300025911 Bacteria 1740
201 Ga0207707_10010632 3300025912 Bacteria 7993
202 Ga0207707_10167091 3300025912 Unclassified 1923
203 Ga0207695_10020880 3300025913 Bacteria 7484
204 Ga0207695_10124109 3300025913 Bacteria 2547
205 Ga0207693_10012200 3300025915 Bacteria 6942
206 Ga0207693_10016248 3300025915 Bacteria 5952
207 Ga0207693_10122091 3300025915 Bacteria 2046
208 Ga0207663_10098206 3300025916 Bacteria 1960
209 Ga0207663_10261071 3300025916 Unclassified 1279
210 Ga0207660_10012563 3300025917 Bacteria 5545
211 Ga0207660_10167011 3300025917 Bacteria 1701
212 Ga0207662_10014431 3300025918 Bacteria 4434
213 Ga0207649_10147540 3300025920 Unclassified 1616
214 Ga0207652_10460608 3300025921 Unclassified 1146
215 Ga0207681_10003916 3300025923 Bacteria 9233
216 Ga0207694_10007897 3300025924 Bacteria 8055
217 Ga0207659_10018755 3300025926 Bacteria 4540
218 Ga0207659_10092736 3300025926 Bacteria 2259
219 Ga0207687_10165975 3300025927 Bacteria 1698
220 Ga0207700_10015870 3300025928 Bacteria 4984
221 Ga0207700_10025046 3300025928 Bacteria 4137
222 Ga0207700_10358327 3300025928 Bacteria 1271
223 Ga0207664_10021327 3300025929 Bacteria 4814
224 Ga0207664_10057415 3300025929 Bacteria 3093
225 Ga0207664_10359871 3300025929 Unclassified 1289
226 Ga0207690_10247270 3300025932 Unclassified 1376
227 Ga0207686_10122377 3300025934 Bacteria 1773
228 Ga0207709_10004016 3300025935 Bacteria 8575
229 Ga0207709_10085249 3300025935 Bacteria 2048
230 Ga0207670_10040514 3300025936 Bacteria 3058
231 Ga0207670_10100500 3300025936 Bacteria 2065
232 Ga0207704_10005650 3300025938 Bacteria 5777
233 Ga0207665_10000188 3300025939 Bacteria 41567
234 Ga0207665_10008458 3300025939 Bacteria 6782
235 Ga0207665_10094133 3300025939 Bacteria 2080
236 Ga0207691_10023368 3300025940 Bacteria 5819
237 Ga0207691_10213007 3300025940 Bacteria 1678
238 Ga0207691_10481250 3300025940 Bacteria 1055
239 Ga0207689_10003455 3300025942 Bacteria 14431
240 Ga0207661_10042410 3300025944 Unclassified 3587
241 Ga0207679_10186829 3300025945 Bacteria 1719
242 Ga0207667_10004865 3300025949 Bacteria 16403
243 Ga0207667_10041801 3300025949 Bacteria 4874
244 Ga0207651_10090672 3300025960 Bacteria 2235
245 Ga0207668_10054593 3300025972 Bacteria 2774
246 Ga0207640_10072884 3300025981 Bacteria 2318
247 Ga0207640_10263769 3300025981 Bacteria 1344
248 Ga0207640_10304690 3300025981 Bacteria 1262
249 Ga0207708_10019030 3300026075 Bacteria 5171
250 Ga0207708_10331426 3300026075 Bacteria 1244
251 Ga0207702_10002899 3300026078 Bacteria 16048
252 Ga0207641_10037419 3300026088 Bacteria 4052
253 Ga0207641_10113299 3300026088 Bacteria 2408
254 Ga0207641_10142384 3300026088 Bacteria 2165
255 Ga0207641_10371369 3300026088 Bacteria 1368
256 Ga0207648_10000344 3300026089 Bacteria 51064
257 Ga0207648_10001511 3300026089 Bacteria 25628
258 Ga0207676_10048006 3300026095 Unclassified 3312
259 Ga0207674_10007099 3300026116 Bacteria 13088
260 Ga0207674_10047945 3300026116 Bacteria 4377
261 Ga0207675_100004132 3300026118 Bacteria 14051
262 Ga0207675_100009513 3300026118 Bacteria 9093
263 Ga0207428_10001905 3300027907 Bacteria 21121
264 Ga0207428_10010696 3300027907 Bacteria 8184
265 Ga0265356_1000506 3300028017 Bacteria 7036
266 Ga0268265_10001361 3300028380 Bacteria 20828
267 Ga0268265_10461567 3300028380 Unclassified 1189
268 Ga0268264_10463375 3300028381 Bacteria 1230
269 Ga0265319_1068389 3300028563 Unclassified 1141
270 Ga0265762_1000577 3300030760 Bacteria 6466
271 Ga0265762_1009155 3300030760 Bacteria 1766
272 Ga0265760_10000154 3300031090 Bacteria 17770
273 Ga0265760_10004368 3300031090 Bacteria 4061
274 Ga0265340_10031781 3300031247 Bacteria 2638
275 Ga0265339_10016905 3300031249 Bacteria 4334
276 Ga0265339_10022883 3300031249 Unclassified 3615
277 Ga0307408_100119577 3300031548 Bacteria 2039
278 Ga0307408_100157994 3300031548 Bacteria 1798
279 Ga0265314_10160116 3300031711 Bacteria 1371
280 Ga0265314_10220215 3300031711 Bacteria 1108
281 Ga0307410_10015047 3300031852 Bacteria 4576
282 Ga0307410_10020259 3300031852 Bacteria 4064
283 Ga0307410_10255928 3300031852 Bacteria 1363
284 Ga0307416_100015243 3300032002 Bacteria 5302
285 Ga0307416_100260816 3300032002 Bacteria 1694
286 Ga0307414_10110351 3300032004 Bacteria 2092
287 Ga0307411_10016206 3300032005 Bacteria 4215
288 Ga0307411_10107226 3300032005 Bacteria 1990
289 Ga0307411_10598910 3300032005 Bacteria 947
290 Ga0307415_100080248 3300032126 Bacteria 2327
291 Ga0316214_1001674 3300033545 Unclassified 2631
292 Ga0373936_0080890 3300035113 Bacteria 1352
293 Ga0373943_0031450 3300035170 Bacteria 2518
294 Ga0373931_0114723 3300035691 Bacteria 1533
295 Ga0373935_0008519 3300035692 Bacteria 6138
296 Ga0373935_0244439 3300035692 Bacteria 1254
297 Ga0373927_0142235 3300035695 Bacteria 1569
298 Ga0373947_0021993 3300035725 Bacteria 3696
299 Ga0373937_0181245 3300036401 Bacteria 1978
300 Ga0373925_0004573 3300037068 Bacteria 10455
301 Ga0373925_0013356 3300037068 Bacteria 5943
302 Ga0373925_0016278 3300037068 Bacteria 5383
303 Ga0373925_0028059 3300037068 Unclassified 4123
304 Ga0395898_0253062 3300037466 Bacteria 1680
305 Ga0400483_223030 3300039062 Bacteria 7944
306 Ga0436360_0072150 3300039438 Bacteria 2296
307 Ga0439443_016911 3300042003 Bacteria 1118
308 Ga0439450_032797 3300042008 Bacteria 1174
309 Ga0439463_001828 3300042016 Bacteria 5523
310 Ga0439444_0018080 3300042437 Bacteria 1217
311 Ga0453683_0029870 3300044673 Bacteria 3445
312 Ga0466963_0257456 3300044694 Unclassified 1225
313 Ga0466963_0389568 3300044694 Bacteria 982
314 Ga0466957_0520606 3300044842 Bacteria 826
315 Ga0466959_0181148 3300045049 Bacteria 1473
316 Ga0451576_0527141 3300045051 Bacteria 1241
317 Ga0466967_0001080 3300045976 Bacteria 15092
318 Ga0466967_0116763 3300045976 Bacteria 2459
319 Ga0495603_0009651 3300046455 Bacteria 5837
320 Ga0495651_0021369 3300046462 Bacteria 5030
321 Ga0495580_0002722 3300046472 Bacteria 15271
322 Ga0495580_0003043 3300046472 Bacteria 14356
323 Ga0495580_0057556 3300046472 Unclassified 2736
324 Ga0495580_0165814 3300046472 Bacteria 1528
325 Ga0495582_0000811 3300046473 Bacteria 17357
326 Ga0495585_0019975 3300046492 Bacteria 3854
327 Ga0495594_0000127 3300046499 Bacteria 35752
328 Ga0495596_0023659 3300046500 Bacteria 2491
329 Ga0495618_0023614 3300046514 Bacteria 3804
330 Ga0495630_0027027 3300046517 Bacteria 4253
331 Ga0495630_0050370 3300046517 Bacteria 3117
332 Ga0495644_0000059 3300046523 Bacteria 53320
333 Ga0495665_0014245 3300046531 Bacteria 4290
334 Ga0495665_0129809 3300046531 Bacteria 1319
335 Ga0495640_0030735 3300046533 Bacteria 3842
336 Ga0495586_0032984 3300046535 Bacteria 2778
337 Ga0495621_0007907 3300046539 Bacteria 3165
338 Ga0495667_0020477 3300046559 Bacteria 4463
339 Ga0495668_0019669 3300046616 Bacteria 3890
340 Ga0495634_0005181 3300046642 Bacteria 10073
341 Ga0495625_0057308 3300046660 Bacteria 2771
342 Ga0495669_0040463 3300046684 Bacteria 2067
343 Ga0495613_0002438 3300046689 Bacteria 14034
344 Ga0495589_0123443 3300046794 Bacteria 1246
345 Ga0495600_0166041 3300046809 Bacteria 1426
346 Ga0495581_0068483 3300047315 Bacteria 2052
347 Ga0495604_0067057 3300047317 Bacteria 2728
348 Ga0495636_0070587 3300047318 Bacteria 1490
349 Ga0495636_0113024 3300047318 Unclassified 1196
350 Ga0495677_0023392 3300047445 Bacteria 2243
351 Ga0496102_0076064 3300048905 Unclassified 3087
352 Ga0496104_0240971 3300048907 Bacteria 1721
353 Ga0496104_0563702 3300048907 Bacteria 1050
354 Ga0496106_0137094 3300048909 Bacteria 1923
355 Ga0496108_0000098 3300048911 Bacteria 90200
356 Ga0496108_0396441 3300048911 Bacteria 1205
357 Ga0496109_0359197 3300048912 Bacteria 1376
358 Ga0496110_0171555 3300048913 Bacteria 1968
359 Ga0496110_0357175 3300048913 Bacteria 1331
360 Ga0496112_0004189 3300048915 Bacteria 12150
361 Ga0496112_0106368 3300048915 Unclassified 2776
362 Ga0496113_0173793 3300048916 Bacteria 1706
363 Ga0496114_0462457 3300048917 Bacteria 1123
364 Ga0496115_0315219 3300048918 Bacteria 1280
365 Ga0496126_0000575 3300048929 Bacteria 70082
366 Ga0496126_0002908 3300048929 Bacteria 22313
367 Ga0501031_0094023 3300049568 Bacteria 1956
368 Ga0501031_0306771 3300049568 Bacteria 1028
369 Ga0501033_0009810 3300049570 Bacteria 7350
370 Ga0501036_0001434 3300049572 Bacteria 18324
371 Ga0501036_0005326 3300049572 Bacteria 10409
372 Ga0501037_0142340 3300049573 Bacteria 1716
373 Ga0501038_0110224 3300049574 Bacteria 2281
374 Ga0501039_0016652 3300049575 Bacteria 5631
375 Ga0501039_0042084 3300049575 Bacteria 3530
376 Ga0501039_0043979 3300049575 Bacteria 3450
377 Ga0501039_0137964 3300049575 Bacteria 1915
378 Ga0501040_0009525 3300049576 Bacteria 6336
379 Ga0501040_0009897 3300049576 Bacteria 6224
380 Ga0501040_0039541 3300049576 Bacteria 3208
381 Ga0501040_0183432 3300049576 Bacteria 1484
382 Ga0501041_0045290 3300049577 Bacteria 2674
383 Ga0501041_0046903 3300049577 Bacteria 2629
384 Ga0501042_0004919 3300049578 Bacteria 8555
385 Ga0501042_0027851 3300049578 Bacteria 3975
386 Ga0501043_0198473 3300049579 Bacteria 1558
387 Ga0501046_0033470 3300049580 Bacteria 4152
388 Ga0501046_0068235 3300049580 Bacteria 2768
389 Ga0501046_0085489 3300049580 Bacteria 2432
390 Ga0501048_0009000 3300049582 Bacteria 7516
391 Ga0501048_0088273 3300049582 Bacteria 2187
392 Ga0501048_0107775 3300049582 Bacteria 1967
393 Ga0501070_0262743 3300049586 Bacteria 1411
394 Ga0501070_0316413 3300049586 Bacteria 1270
395 Ga0501071_0098649 3300049587 Bacteria 2152
396 Ga0501072_0018729 3300049588 Bacteria 5337
397 Ga0501072_0019359 3300049588 Bacteria 5261
398 Ga0501072_0189195 3300049588 Bacteria 1642
399 Ga0501072_0210475 3300049588 Bacteria 1549
400 Ga0501072_0329183 3300049588 Bacteria 1214
401 Ga0501075_0034462 3300049591 Bacteria 3770
402 Ga0501075_0037802 3300049591 Bacteria 3608
403 Ga0501075_0052686 3300049591 Bacteria 3059
404 Ga0501075_0098002 3300049591 Bacteria 2225
405 Ga0501075_0286805 3300049591 Bacteria 1254
406 Ga0501076_0015150 3300049592 Bacteria 5822
407 Ga0501076_0025031 3300049592 Unclassified 4617
408 Ga0501076_0051913 3300049592 Bacteria 3246
409 Ga0501076_0143988 3300049592 Bacteria 1937
410 Ga0501077_0040821 3300049593 Bacteria 2954
411 Ga0501077_0041383 3300049593 Bacteria 2933
412 Ga0501079_0002044 3300049741 Bacteria 14455
413 Ga0501079_0012891 3300049741 Bacteria 6380
414 Ga0501079_0036381 3300049741 Bacteria 3793
415 Ga0501079_0064513 3300049741 Unclassified 2825
416 Ga0501080_0236660 3300049742 Bacteria 1668
417 Ga0501080_0260849 3300049742 Bacteria 1579
418 Ga0501081_0004219 3300049743 Bacteria 9213
419 Ga0501083_0350499 3300049744 Bacteria 960
420 Ga0501044_0061610 3300049823 Bacteria 3838
421 Ga0501045_0004936 3300049824 Bacteria 9240
422 Ga0501045_0011568 3300049824 Bacteria 6197
423 Ga0501045_0098220 3300049824 Bacteria 2166
424 nmdc:mga06z11_115837_c1 3300050494 Bacteria 1489
425 nmdc:mga06z11_24489_c1 3300050494 Bacteria 2848
426 nmdc:mga05p37_159946_c1 3300050507 Bacteria 2751
427 nmdc:mga05p37_257_c1 3300050507 Bacteria 54851
428 nmdc:mga05p37_280725_c1 3300050507 Bacteria 1986
429 nmdc:mga05p37_409287_c1 3300050507 Bacteria 1581
430 nmdc:mga09592_122513_c1 3300050508 Bacteria 2234
431 nmdc:mga09592_231674_c1 3300050508 Bacteria 1600
432 nmdc:mga09592_291228_c1 3300050508 Bacteria 1415
433 nmdc:mga09592_537033_c1 3300050508 Bacteria 1005
434 nmdc:mga09592_8206_c1 3300050508 Bacteria 8490
435 nmdc:mga09592_961_c1 3300050508 Bacteria 22726
436 nmdc:mga0qj67_21855_c1 3300050509 Bacteria 4909
437 nmdc:mga0qj67_249888_c1 3300050509 Bacteria 1439
438 nmdc:mga0qj67_289_c1 3300050509 Bacteria 35087
439 nmdc:mga0qj67_4031_c1 3300050509 Bacteria 10633
440 nmdc:mga0qj67_49534_c1 3300050509 Bacteria 3320
441 nmdc:mga06r32_107915_c1 3300050510 Bacteria 2737
442 nmdc:mga06r32_2804_c1 3300050510 Bacteria 15615
443 nmdc:mga06r32_556648_c1 3300050510 Bacteria 1120
444 nmdc:mga06r32_58495_c1 3300050510 Bacteria 3704
445 nmdc:mga06r32_681457_c1 3300050510 Bacteria 995
446 nmdc:mga06r32_735_c1 3300050510 Bacteria 28720
447 nmdc:mga08y16_12291_c1 3300050511 Bacteria 9001
448 nmdc:mga08y16_298035_c1 3300050511 Bacteria 1662
449 nmdc:mga08y16_3479_c1 3300050511 Bacteria 16338
450 nmdc:mga08y16_63262_c1 3300050511 Bacteria 3864
451 nmdc:mga0n895_279690_c1 3300050512 Unclassified 1692
452 nmdc:mga0n895_689926_c1 3300050512 Unclassified 1018
453 nmdc:mga0rr50_23342_c1 3300050513 Bacteria 4264
454 nmdc:mga0rr50_57131_c1 3300050513 Bacteria 2918
455 nmdc:mga08x19_54952_c1 3300050514 Bacteria 2565
456 nmdc:mga0a205_384305_c1 3300050515 Bacteria 1269
457 nmdc:mga0a205_396940_c1 3300050515 Bacteria 1243
458 nmdc:mga0a205_7085_c1 3300050515 Bacteria 6593
459 Ga0495612_0121443 3300053078 Bacteria 1124
460 Ga0495595_0015041 3300053084 Bacteria 3294
461 Ga0495619_0019539 3300053085 Bacteria 4309
462 Ga0495619_0169519 3300053085 Bacteria 1509
463 Ga0500555_000212 3300053103 Bacteria 27048
464 Ga0500616_0003378 3300053153 Bacteria 12258
465 Ga0500616_0007181 3300053153 Bacteria 7122
466 Ga0500645_000201 3300053730 Bacteria 46162
467 Ga0501084_0009142 3300054114 Bacteria 8197
468 Ga0501084_0019855 3300054114 Bacteria 5600
469 Ga0590075_020221 3300059424 Bacteria 1657
470 Ga0590077_007909 3300059426 Bacteria 2174
471 Ga0501082_0008031 3300060353 Bacteria 9109
472 Ga0501082_0041152 3300060353 Bacteria 3984
473 Ga0530510_0002383 3300061734 Bacteria 12930
474 Ga0530510_0013520 3300061734 Bacteria 5740
475 Ga0530510_0072784 3300061734 Bacteria 2494
476 Ga0530510_0084531 3300061734 Bacteria 2311
477 Ga0530510_0352656 3300061734 Bacteria 1105

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0520606 Ga0466957_0520606_59_799 227
2 3300044694 Ga0466963_0257456 Ga0466963_0257456_288_1103 231
3 3300045049 Ga0466959_0181148 Ga0466959_0181148_10_780 237
4 3300050510 nmdc:mga06r32_681457_c1 nmdc:mga06r32_681457_c1_249_980 239
5 3300050508 nmdc:mga09592_537033_c1 nmdc:mga09592_537033_c1_260_994 241
6 3300050515 nmdc:mga0a205_396940_c1 nmdc:mga0a205_396940_c1_21_794 245
7 3300049588 Ga0501072_0329183 Ga0501072_0329183_414_1193 251
8 3300049574 Ga0501038_0110224 Ga0501038_0110224_1496_2266 252
9 3300047318 Ga0495636_0113024 Ga0495636_0113024_121_1032 265
10 3300005435 Ga0070714_100000417 Ga0070714_10000041725 268
11 3300025929 Ga0207664_10057415 Ga0207664_100574153 268
12 3300053103 Ga0500555_000212 Ga0500555_000212_824_1723 268
13 3300053730 Ga0500645_000201 Ga0500645_000201_44454_45350 268
14 3300007076 Ga0075435_100390979 Ga0075435_1003909791 274
15 3300059424 Ga0590075_020221 Ga0590075_020221_544_1467 274
16 3300059426 Ga0590077_007909 Ga0590077_007909_207_1130 274
17 3300005444 Ga0070694_100015482 Ga0070694_1000154823 275
18 3300005545 Ga0070695_100000153 Ga0070695_10000015314 275
19 3300005546 Ga0070696_100001125 Ga0070696_10000112511 275
20 3300005547 Ga0070693_100131159 Ga0070693_1001311592 275
21 3300005615 Ga0070702_100009710 Ga0070702_1000097103 275
22 3300006852 Ga0075433_10290993 Ga0075433_102909932 275
23 3300009147 Ga0114129_10311126 Ga0114129_103111261 275
24 3300009148 Ga0105243_10017363 Ga0105243_100173633 275
25 3300025934 Ga0207686_10122377 Ga0207686_101223772 275
26 3300025935 Ga0207709_10085249 Ga0207709_100852492 275
27 3300050512 nmdc:mga0n895_689926_c1 nmdc:mga0n895_689926_c1_126_953 275
28 3300050515 nmdc:mga0a205_384305_c1 nmdc:mga0a205_384305_c1_312_1139 275
29 3300005293 Ga0065715_10108071 Ga0065715_101080714 276
30 3300005330 Ga0070690_100026385 Ga0070690_1000263853 276
31 3300005331 Ga0070670_100007650 Ga0070670_1000076506 276
32 3300005338 Ga0068868_100545715 Ga0068868_1005457151 276
33 3300005340 Ga0070689_100039331 Ga0070689_1000393314 276
34 3300005343 Ga0070687_100042245 Ga0070687_1000422453 276
35 3300005344 Ga0070661_100351179 Ga0070661_1003511791 276
36 3300005347 Ga0070668_100385426 Ga0070668_1003854261 276
37 3300005353 Ga0070669_100000264 Ga0070669_10000026424 276
38 3300005365 Ga0070688_100066390 Ga0070688_1000663902 276
39 3300005440 Ga0070705_100152604 Ga0070705_1001526042 276
40 3300005441 Ga0070700_100150955 Ga0070700_1001509551 276
41 3300005459 Ga0068867_100002337 Ga0068867_10000233710 276
42 3300005518 Ga0070699_100124881 Ga0070699_1001248812 276
43 3300005549 Ga0070704_100041130 Ga0070704_1000411304 276
44 3300005577 Ga0068857_100041570 Ga0068857_1000415704 276
45 3300005617 Ga0068859_100007517 Ga0068859_1000075176 276
46 3300005719 Ga0068861_100001392 Ga0068861_1000013928 276
47 3300005840 Ga0068870_10087090 Ga0068870_100870902 276
48 3300005844 Ga0068862_100000749 Ga0068862_10000074915 276
49 3300006931 Ga0097620_100007517 Ga0097620_1000075178 276
50 3300009094 Ga0111539_10061163 Ga0111539_100611634 276
51 3300009094 Ga0111539_10422655 Ga0111539_104226552 276
52 3300009098 Ga0105245_10329563 Ga0105245_103295631 276
53 3300009147 Ga0114129_10177017 Ga0114129_101770172 276
54 3300009148 Ga0105243_10039759 Ga0105243_100397594 276
55 3300010375 Ga0105239_10679426 Ga0105239_106794262 276
56 3300013308 Ga0157375_10012437 Ga0157375_100124376 276
57 3300014326 Ga0157380_10132135 Ga0157380_101321353 276
58 3300014745 Ga0157377_10103151 Ga0157377_101031513 276
59 3300014745 Ga0157377_10258966 Ga0157377_102589662 276
60 3300025908 Ga0207643_10098421 Ga0207643_100984212 276
61 3300025918 Ga0207662_10014431 Ga0207662_100144312 276
62 3300025923 Ga0207681_10003916 Ga0207681_100039169 276
63 3300025926 Ga0207659_10092736 Ga0207659_100927362 276
64 3300025927 Ga0207687_10165975 Ga0207687_101659753 276
65 3300025935 Ga0207709_10004016 Ga0207709_100040164 276
66 3300025936 Ga0207670_10040514 Ga0207670_100405144 276
67 3300025940 Ga0207691_10213007 Ga0207691_102130072 276
68 3300025972 Ga0207668_10054593 Ga0207668_100545932 276
69 3300025981 Ga0207640_10304690 Ga0207640_103046902 276
70 3300026089 Ga0207648_10001511 Ga0207648_1000151115 276
71 3300026116 Ga0207674_10007099 Ga0207674_100070992 276
72 3300026116 Ga0207674_10047945 Ga0207674_100479453 276
73 3300026118 Ga0207675_100004132 Ga0207675_1000041328 276
74 3300027907 Ga0207428_10001905 Ga0207428_1000190519 276
75 3300028380 Ga0268265_10001361 Ga0268265_1000136111 276
76 3300028381 Ga0268264_10463375 Ga0268264_104633752 276
77 3300050507 nmdc:mga05p37_159946_c1 nmdc:mga05p37_159946_c1_363_1211 276
78 3300050511 nmdc:mga08y16_3479_c1 nmdc:mga08y16_3479_c1_8410_9276 276
79 3300030760 Ga0265762_1009155 Ga0265762_10091551 277
80 3300005438 Ga0070701_10035763 Ga0070701_100357632 279
81 3300005441 Ga0070700_100279783 Ga0070700_1002797831 279
82 3300005549 Ga0070704_100115638 Ga0070704_1001156382 279
83 3300006846 Ga0075430_100004271 Ga0075430_1000042717 279
84 3300009147 Ga0114129_10322610 Ga0114129_103226102 279
85 3300026075 Ga0207708_10331426 Ga0207708_103314262 279
86 3300044694 Ga0466963_0389568 Ga0466963_0389568_14_910 279
87 3300049575 Ga0501039_0043979 Ga0501039_0043979_2545_3384 279
88 3300049576 Ga0501040_0039541 Ga0501040_0039541_854_1693 279
89 3300049577 Ga0501041_0045290 Ga0501041_0045290_1713_2552 279
90 3300049578 Ga0501042_0004919 Ga0501042_0004919_453_1292 279
91 3300049579 Ga0501043_0198473 Ga0501043_0198473_258_1097 279
92 3300049580 Ga0501046_0085489 Ga0501046_0085489_453_1292 279
93 3300049582 Ga0501048_0107775 Ga0501048_0107775_750_1589 279
94 3300049586 Ga0501070_0316413 Ga0501070_0316413_183_1031 279
95 3300049588 Ga0501072_0210475 Ga0501072_0210475_59_898 279
96 3300049591 Ga0501075_0034462 Ga0501075_0034462_1047_1886 279
97 3300049592 Ga0501076_0025031 Ga0501076_0025031_2758_3597 279
98 3300049741 Ga0501079_0064513 Ga0501079_0064513_1479_2318 279
99 3300049742 Ga0501080_0260849 Ga0501080_0260849_475_1314 279
100 3300049744 Ga0501083_0350499 Ga0501083_0350499_88_927 279
101 3300049824 Ga0501045_0011568 Ga0501045_0011568_5223_6062 279
102 3300050508 nmdc:mga09592_122513_c1 nmdc:mga09592_122513_c1_1365_2204 279
103 3300050509 nmdc:mga0qj67_21855_c1 nmdc:mga0qj67_21855_c1_1976_2815 279
104 3300061734 Ga0530510_0002383 Ga0530510_0002383_10896_11735 279
105 3300025913 Ga0207695_10124109 Ga0207695_101241093 280
106 3300026088 Ga0207641_10371369 Ga0207641_103713691 280
107 3300031247 Ga0265340_10031781 Ga0265340_100317812 280
108 3300031249 Ga0265339_10016905 Ga0265339_100169053 280
109 3300031711 Ga0265314_10220215 Ga0265314_102202151 280
110 3300006058 Ga0075432_10015596 Ga0075432_100155961 281
111 3300006175 Ga0070712_100008286 Ga0070712_1000082864 281
112 3300007076 Ga0075435_100019856 Ga0075435_1000198562 281
113 3300009147 Ga0114129_10005125 Ga0114129_1000512512 281
114 3300025915 Ga0207693_10016248 Ga0207693_100162484 281
115 3300050508 nmdc:mga09592_231674_c1 nmdc:mga09592_231674_c1_149_997 281
116 3300050513 nmdc:mga0rr50_57131_c1 nmdc:mga0rr50_57131_c1_1869_2714 281
117 3300025945 Ga0207679_10186829 Ga0207679_101868292 282
118 3300031090 Ga0265760_10004368 Ga0265760_100043684 282
119 3300035695 Ga0373927_0142235 Ga0373927_0142235_516_1421 283
120 3300037068 Ga0373925_0028059 Ga0373925_0028059_2612_3517 283
121 3300037466 Ga0395898_0253062 Ga0395898_0253062_362_1228 283
122 3300046472 Ga0495580_0057556 Ga0495580_0057556_762_1667 283
123 3300046531 Ga0495665_0129809 Ga0495665_0129809_284_1189 283
124 3300005445 Ga0070708_100136844 Ga0070708_1001368441 284
125 3300013297 Ga0157378_10117123 Ga0157378_101171232 284
126 3300044673 Ga0453683_0029870 Ga0453683_0029870_533_1438 284
127 3300006871 Ga0075434_100188937 Ga0075434_1001889372 285
128 3300006881 Ga0068865_100028100 Ga0068865_1000281003 285
129 3300009177 Ga0105248_10016274 Ga0105248_100162744 285
130 3300050512 nmdc:mga0n895_279690_c1 nmdc:mga0n895_279690_c1_473_1363 285
131 3300005343 Ga0070687_100136043 Ga0070687_1001360432 286
132 3300005437 Ga0070710_10025175 Ga0070710_100251753 286
133 3300005439 Ga0070711_100115526 Ga0070711_1001155262 286
134 3300005841 Ga0068863_100356509 Ga0068863_1003565091 286
135 3300006844 Ga0075428_100076478 Ga0075428_1000764783 286
136 3300006846 Ga0075430_100005488 Ga0075430_1000054885 286
137 3300006847 Ga0075431_100000382 Ga0075431_10000038211 286
138 3300006880 Ga0075429_100003659 Ga0075429_1000036594 286
139 3300013306 Ga0163162_10007685 Ga0163162_100076855 286
140 3300013308 Ga0157375_10059600 Ga0157375_100596003 286
141 3300025302 Ga0207426_1030926 Ga0207426_10309261 286
142 3300025905 Ga0207685_10008558 Ga0207685_100085583 286
143 3300025915 Ga0207693_10012200 Ga0207693_100122002 286
144 3300025916 Ga0207663_10098206 Ga0207663_100982061 286
145 3300025939 Ga0207665_10000188 Ga0207665_1000018816 286
146 3300031852 Ga0307410_10255928 Ga0307410_102559282 286
147 3300032002 Ga0307416_100015243 Ga0307416_1000152432 286
148 3300032004 Ga0307414_10110351 Ga0307414_101103513 286
149 3300032005 Ga0307411_10107226 Ga0307411_101072262 286
150 3300045051 Ga0451576_0527141 Ga0451576_0527141_113_1000 286
151 3300049572 Ga0501036_0001434 Ga0501036_0001434_1777_2643 286
152 3300049575 Ga0501039_0016652 Ga0501039_0016652_1228_2094 286
153 3300049576 Ga0501040_0009525 Ga0501040_0009525_1050_1916 286
154 3300049577 Ga0501041_0046903 Ga0501041_0046903_324_1190 286
155 3300049580 Ga0501046_0068235 Ga0501046_0068235_1549_2415 286
156 3300049586 Ga0501070_0262743 Ga0501070_0262743_263_1129 286
157 3300049588 Ga0501072_0018729 Ga0501072_0018729_2736_3602 286
158 3300049591 Ga0501075_0098002 Ga0501075_0098002_1164_2030 286
159 3300049592 Ga0501076_0015150 Ga0501076_0015150_3510_4376 286
160 3300049593 Ga0501077_0041383 Ga0501077_0041383_1135_2001 286
161 3300049741 Ga0501079_0012891 Ga0501079_0012891_2077_2943 286
162 3300049742 Ga0501080_0236660 Ga0501080_0236660_496_1362 286
163 3300049823 Ga0501044_0061610 Ga0501044_0061610_1712_2578 286
164 3300049824 Ga0501045_0004936 Ga0501045_0004936_7374_8240 286
165 3300050508 nmdc:mga09592_8206_c1 nmdc:mga09592_8206_c1_2012_2878 286
166 3300050509 nmdc:mga0qj67_4031_c1 nmdc:mga0qj67_4031_c1_5921_6787 286
167 3300050510 nmdc:mga06r32_2804_c1 nmdc:mga06r32_2804_c1_6543_7409 286
168 3300054114 Ga0501084_0009142 Ga0501084_0009142_4044_4910 286
169 3300060353 Ga0501082_0041152 Ga0501082_0041152_1670_2536 286
170 3300061734 Ga0530510_0084531 Ga0530510_0084531_1091_1957 286
171 3300003373 JGI25407J50210_10007866 JGI25407J50210_100078661 287
172 3300005937 Ga0081455_10006418 Ga0081455_100064184 287
173 3300005937 Ga0081455_10086322 Ga0081455_100863222 287
174 3300005981 Ga0081538_10000261 Ga0081538_1000026131 287
175 3300005981 Ga0081538_10001412 Ga0081538_100014125 287
176 3300005981 Ga0081538_10035107 Ga0081538_100351074 287
177 3300006844 Ga0075428_100006791 Ga0075428_1000067911 287
178 3300006844 Ga0075428_100016866 Ga0075428_1000168664 287
179 3300006844 Ga0075428_100031062 Ga0075428_1000310624 287
180 3300006846 Ga0075430_100001082 Ga0075430_10000108212 287
181 3300006846 Ga0075430_100021843 Ga0075430_1000218436 287
182 3300006846 Ga0075430_100035519 Ga0075430_1000355193 287
183 3300006846 Ga0075430_100098840 Ga0075430_1000988402 287
184 3300006847 Ga0075431_100029961 Ga0075431_1000299616 287
185 3300006847 Ga0075431_100048979 Ga0075431_1000489792 287
186 3300006847 Ga0075431_100097183 Ga0075431_1000971832 287
187 3300006880 Ga0075429_100001061 Ga0075429_10000106112 287
188 3300009094 Ga0111539_10016868 Ga0111539_100168682 287
189 3300009147 Ga0114129_10000014 Ga0114129_10000014122 287
190 3300009147 Ga0114129_10112249 Ga0114129_101122493 287
191 3300027907 Ga0207428_10010696 Ga0207428_100106964 287
192 3300031249 Ga0265339_10022883 Ga0265339_100228832 287
193 3300039438 Ga0436360_0072150 Ga0436360_0072150_156_1070 287
194 3300042003 Ga0439443_016911 Ga0439443_016911_41_919 287
195 3300042008 Ga0439450_032797 Ga0439450_032797_38_916 287
196 3300042016 Ga0439463_001828 Ga0439463_001828_4449_5327 287
197 3300042437 Ga0439444_0018080 Ga0439444_0018080_171_1049 287
198 3300046514 Ga0495618_0023614 Ga0495618_0023614_1367_2233 287
199 3300046517 Ga0495630_0027027 Ga0495630_0027027_2315_3181 287
200 3300046533 Ga0495640_0030735 Ga0495640_0030735_2680_3546 287
201 3300046535 Ga0495586_0032984 Ga0495586_0032984_297_1163 287
202 3300046539 Ga0495621_0007907 Ga0495621_0007907_978_1841 287
203 3300046559 Ga0495667_0020477 Ga0495667_0020477_3065_3934 287
204 3300046642 Ga0495634_0005181 Ga0495634_0005181_1231_2097 287
205 3300046689 Ga0495613_0002438 Ga0495613_0002438_6099_6965 287
206 3300046809 Ga0495600_0166041 Ga0495600_0166041_418_1287 287
207 3300049568 Ga0501031_0094023 Ga0501031_0094023_960_1838 287
208 3300049570 Ga0501033_0009810 Ga0501033_0009810_5633_6511 287
209 3300049572 Ga0501036_0005326 Ga0501036_0005326_7252_8130 287
210 3300049575 Ga0501039_0137964 Ga0501039_0137964_807_1685 287
211 3300049576 Ga0501040_0009897 Ga0501040_0009897_1719_2597 287
212 3300049576 Ga0501040_0183432 Ga0501040_0183432_349_1227 287
213 3300049578 Ga0501042_0027851 Ga0501042_0027851_1372_2250 287
214 3300049580 Ga0501046_0033470 Ga0501046_0033470_2149_3027 287
215 3300049582 Ga0501048_0009000 Ga0501048_0009000_5321_6199 287
216 3300049588 Ga0501072_0019359 Ga0501072_0019359_1794_2672 287
217 3300049588 Ga0501072_0189195 Ga0501072_0189195_72_950 287
218 3300049591 Ga0501075_0037802 Ga0501075_0037802_499_1377 287
219 3300049591 Ga0501075_0052686 Ga0501075_0052686_1445_2323 287
220 3300049592 Ga0501076_0051913 Ga0501076_0051913_1552_2430 287
221 3300049592 Ga0501076_0143988 Ga0501076_0143988_881_1759 287
222 3300049593 Ga0501077_0040821 Ga0501077_0040821_1836_2714 287
223 3300049741 Ga0501079_0002044 Ga0501079_0002044_6014_6892 287
224 3300049741 Ga0501079_0036381 Ga0501079_0036381_1697_2575 287
225 3300049743 Ga0501081_0004219 Ga0501081_0004219_6931_7809 287
226 3300049824 Ga0501045_0098220 Ga0501045_0098220_362_1240 287
227 3300050507 nmdc:mga05p37_257_c1 nmdc:mga05p37_257_c1_44167_45039 287
228 3300050507 nmdc:mga05p37_280725_c1 nmdc:mga05p37_280725_c1_649_1527 287
229 3300050507 nmdc:mga05p37_409287_c1 nmdc:mga05p37_409287_c1_220_1089 287
230 3300050508 nmdc:mga09592_961_c1 nmdc:mga09592_961_c1_11189_12061 287
231 3300050509 nmdc:mga0qj67_249888_c1 nmdc:mga0qj67_249888_c1_191_1060 287
232 3300050509 nmdc:mga0qj67_289_c1 nmdc:mga0qj67_289_c1_23151_24023 287
233 3300050509 nmdc:mga0qj67_49534_c1 nmdc:mga0qj67_49534_c1_1435_2313 287
234 3300050510 nmdc:mga06r32_107915_c1 nmdc:mga06r32_107915_c1_132_1007 287
235 3300050510 nmdc:mga06r32_556648_c1 nmdc:mga06r32_556648_c1_10_882 287
236 3300050510 nmdc:mga06r32_58495_c1 nmdc:mga06r32_58495_c1_1094_1963 287
237 3300050510 nmdc:mga06r32_735_c1 nmdc:mga06r32_735_c1_22446_23318 287
238 3300050511 nmdc:mga08y16_12291_c1 nmdc:mga08y16_12291_c1_7683_8558 287
239 3300050511 nmdc:mga08y16_63262_c1 nmdc:mga08y16_63262_c1_173_1045 287
240 3300053084 Ga0495595_0015041 Ga0495595_0015041_1398_2267 287
241 3300053085 Ga0495619_0169519 Ga0495619_0169519_443_1312 287
242 3300054114 Ga0501084_0019855 Ga0501084_0019855_44_922 287
243 3300060353 Ga0501082_0008031 Ga0501082_0008031_2032_2910 287
244 3300061734 Ga0530510_0013520 Ga0530510_0013520_3758_4636 287
245 3300061734 Ga0530510_0072784 Ga0530510_0072784_1029_1907 287
246 3300003316 rootH1_10113718 rootH1_101137181 288
247 3300005328 Ga0070676_10002640 Ga0070676_100026405 288
248 3300005330 Ga0070690_100015700 Ga0070690_1000157001 288
249 3300005334 Ga0068869_100001584 Ga0068869_1000015845 288
250 3300005354 Ga0070675_100001452 Ga0070675_1000014525 288
251 3300005438 Ga0070701_10045571 Ga0070701_100455712 288
252 3300005441 Ga0070700_100002527 Ga0070700_1000025274 288
253 3300005459 Ga0068867_100000379 Ga0068867_10000037926 288
254 3300005543 Ga0070672_100005182 Ga0070672_1000051824 288
255 3300005544 Ga0070686_100422460 Ga0070686_1004224601 288
256 3300005578 Ga0068854_100089624 Ga0068854_1000896243 288
257 3300005617 Ga0068859_100370897 Ga0068859_1003708972 288
258 3300005719 Ga0068861_100023826 Ga0068861_1000238262 288
259 3300005843 Ga0068860_100188378 Ga0068860_1001883783 288
260 3300006881 Ga0068865_100013509 Ga0068865_1000135094 288
261 3300006931 Ga0097620_100370912 Ga0097620_1003709121 288
262 3300011119 Ga0105246_10123263 Ga0105246_101232632 288
263 3300022730 Ga0224570_100859 Ga0224570_1008592 288
264 3300024225 Ga0224572_1013414 Ga0224572_10134142 288
265 3300024227 Ga0228598_1001698 Ga0228598_10016982 288
266 3300025893 Ga0207682_10020517 Ga0207682_100205172 288
267 3300025904 Ga0207647_10095375 Ga0207647_100953751 288
268 3300025907 Ga0207645_10003772 Ga0207645_100037725 288
269 3300025926 Ga0207659_10018755 Ga0207659_100187552 288
270 3300025936 Ga0207670_10100500 Ga0207670_101005002 288
271 3300025938 Ga0207704_10005650 Ga0207704_100056503 288
272 3300025940 Ga0207691_10023368 Ga0207691_100233682 288
273 3300025942 Ga0207689_10003455 Ga0207689_100034559 288
274 3300025960 Ga0207651_10090672 Ga0207651_100906722 288
275 3300025981 Ga0207640_10263769 Ga0207640_102637692 288
276 3300026075 Ga0207708_10019030 Ga0207708_100190302 288
277 3300026089 Ga0207648_10000344 Ga0207648_1000034411 288
278 3300026118 Ga0207675_100009513 Ga0207675_1000095135 288
279 3300028017 Ga0265356_1000506 Ga0265356_10005066 288
280 3300030760 Ga0265762_1000577 Ga0265762_10005774 288
281 3300031090 Ga0265760_10000154 Ga0265760_1000015419 288
282 3300033545 Ga0316214_1001674 Ga0316214_10016742 288
283 3300039062 Ga0400483_223030 Ga0400483_223030_987_1862 288
284 3300045976 Ga0466967_0001080 Ga0466967_0001080_9783_10649 288
285 3300045976 Ga0466967_0116763 Ga0466967_0116763_1449_2327 288
286 3300048911 Ga0496108_0000098 Ga0496108_0000098_19560_20432 288
287 3300048929 Ga0496126_0000575 Ga0496126_0000575_35832_36701 288
288 3300049575 Ga0501039_0042084 Ga0501039_0042084_78_959 288
289 3300050515 nmdc:mga0a205_7085_c1 nmdc:mga0a205_7085_c1_4391_5263 288
290 3300005329 Ga0070683_100049005 Ga0070683_1000490053 289
291 3300005341 Ga0070691_10057038 Ga0070691_100570382 289
292 3300005434 Ga0070709_10024772 Ga0070709_100247722 289
293 3300005435 Ga0070714_100165190 Ga0070714_1001651902 289
294 3300005436 Ga0070713_100212880 Ga0070713_1002128802 289
295 3300005458 Ga0070681_10002705 Ga0070681_100027056 289
296 3300005458 Ga0070681_10465367 Ga0070681_104653671 289
297 3300005530 Ga0070679_100085306 Ga0070679_1000853062 289
298 3300005530 Ga0070679_100094886 Ga0070679_1000948864 289
299 3300005535 Ga0070684_100029274 Ga0070684_1000292742 289
300 3300005535 Ga0070684_100089472 Ga0070684_1000894722 289
301 3300005563 Ga0068855_100000534 Ga0068855_10000053425 289
302 3300005563 Ga0068855_100006321 Ga0068855_1000063212 289
303 3300005564 Ga0070664_100034423 Ga0070664_1000344233 289
304 3300005614 Ga0068856_100005137 Ga0068856_1000051374 289
305 3300005614 Ga0068856_100010267 Ga0068856_1000102674 289
306 3300005616 Ga0068852_100003632 Ga0068852_1000036328 289
307 3300005617 Ga0068859_100022095 Ga0068859_1000220955 289
308 3300005618 Ga0068864_100006858 Ga0068864_1000068582 289
309 3300005718 Ga0068866_10004428 Ga0068866_100044283 289
310 3300005842 Ga0068858_100042992 Ga0068858_1000429923 289
311 3300005842 Ga0068858_100045476 Ga0068858_1000454765 289
312 3300006237 Ga0097621_100000147 Ga0097621_10000014732 289
313 3300006237 Ga0097621_100002868 Ga0097621_1000028686 289
314 3300006358 Ga0068871_100001743 Ga0068871_1000017431 289
315 3300006358 Ga0068871_100002411 Ga0068871_1000024116 289
316 3300006358 Ga0068871_100072117 Ga0068871_1000721174 289
317 3300006914 Ga0075436_100022008 Ga0075436_1000220085 289
318 3300006931 Ga0097620_100022095 Ga0097620_1000220955 289
319 3300007076 Ga0075435_100025458 Ga0075435_1000254583 289
320 3300009093 Ga0105240_10013092 Ga0105240_100130926 289
321 3300009177 Ga0105248_10010106 Ga0105248_1001010610 289
322 3300013105 Ga0157369_10004844 Ga0157369_1000484411 289
323 3300013296 Ga0157374_10022846 Ga0157374_100228464 289
324 3300013297 Ga0157378_10004464 Ga0157378_100044647 289
325 3300013297 Ga0157378_10027422 Ga0157378_100274224 289
326 3300013307 Ga0157372_10014401 Ga0157372_100144013 289
327 3300014969 Ga0157376_10010725 Ga0157376_100107251 289
328 3300025899 Ga0207642_10003863 Ga0207642_100038635 289
329 3300025911 Ga0207654_10106018 Ga0207654_101060182 289
330 3300025912 Ga0207707_10010632 Ga0207707_100106327 289
331 3300025915 Ga0207693_10122091 Ga0207693_101220913 289
332 3300025916 Ga0207663_10261071 Ga0207663_102610712 289
333 3300025917 Ga0207660_10012563 Ga0207660_100125633 289
334 3300025924 Ga0207694_10007897 Ga0207694_100078972 289
335 3300025928 Ga0207700_10025046 Ga0207700_100250462 289
336 3300025928 Ga0207700_10358327 Ga0207700_103583271 289
337 3300025932 Ga0207690_10247270 Ga0207690_102472702 289
338 3300025939 Ga0207665_10008458 Ga0207665_100084586 289
339 3300025940 Ga0207691_10481250 Ga0207691_104812501 289
340 3300025944 Ga0207661_10042410 Ga0207661_100424104 289
341 3300025949 Ga0207667_10004865 Ga0207667_100048657 289
342 3300025949 Ga0207667_10041801 Ga0207667_100418014 289
343 3300025981 Ga0207640_10072884 Ga0207640_100728843 289
344 3300026078 Ga0207702_10002899 Ga0207702_100028997 289
345 3300026088 Ga0207641_10037419 Ga0207641_100374194 289
346 3300026088 Ga0207641_10142384 Ga0207641_101423841 289
347 3300026095 Ga0207676_10048006 Ga0207676_100480064 289
348 3300031548 Ga0307408_100119577 Ga0307408_1001195772 289
349 3300032002 Ga0307416_100260816 Ga0307416_1002608161 289
350 3300035170 Ga0373943_0031450 Ga0373943_0031450_1255_2133 289
351 3300035691 Ga0373931_0114723 Ga0373931_0114723_251_1120 289
352 3300035692 Ga0373935_0008519 Ga0373935_0008519_4270_5148 289
353 3300037068 Ga0373925_0004573 Ga0373925_0004573_5100_5978 289
354 3300046462 Ga0495651_0021369 Ga0495651_0021369_2640_3536 289
355 3300046472 Ga0495580_0003043 Ga0495580_0003043_11001_11879 289
356 3300046473 Ga0495582_0000811 Ga0495582_0000811_2602_3480 289
357 3300046517 Ga0495630_0050370 Ga0495630_0050370_765_1643 289
358 3300046531 Ga0495665_0014245 Ga0495665_0014245_1360_2238 289
359 3300047315 Ga0495581_0068483 Ga0495581_0068483_55_933 289
360 3300047317 Ga0495604_0067057 Ga0495604_0067057_304_1200 289
361 3300048907 Ga0496104_0240971 Ga0496104_0240971_391_1260 289
362 3300048915 Ga0496112_0004189 Ga0496112_0004189_9780_10649 289
363 3300048915 Ga0496112_0106368 Ga0496112_0106368_597_1466 289
364 3300048918 Ga0496115_0315219 Ga0496115_0315219_248_1117 289
365 3300050513 nmdc:mga0rr50_23342_c1 nmdc:mga0rr50_23342_c1_401_1279 289
366 3300050514 nmdc:mga08x19_54952_c1 nmdc:mga08x19_54952_c1_1501_2379 289
367 3300005337 Ga0070682_100174042 Ga0070682_1001740422 290
368 3300005344 Ga0070661_100219860 Ga0070661_1002198602 290
369 3300005355 Ga0070671_100083463 Ga0070671_1000834631 290
370 3300005366 Ga0070659_100093406 Ga0070659_1000934062 290
371 3300005434 Ga0070709_10217363 Ga0070709_102173631 290
372 3300005436 Ga0070713_100341784 Ga0070713_1003417841 290
373 3300005437 Ga0070710_10176154 Ga0070710_101761541 290
374 3300005439 Ga0070711_100334871 Ga0070711_1003348711 290
375 3300005444 Ga0070694_100133187 Ga0070694_1001331872 290
376 3300005539 Ga0068853_100177452 Ga0068853_1001774523 290
377 3300005547 Ga0070693_100346651 Ga0070693_1003466511 290
378 3300005614 Ga0068856_100115278 Ga0068856_1001152782 290
379 3300005841 Ga0068863_100165372 Ga0068863_1001653722 290
380 3300006028 Ga0070717_10006682 Ga0070717_100066824 290
381 3300006028 Ga0070717_10087625 Ga0070717_100876253 290
382 3300006173 Ga0070716_100089823 Ga0070716_1000898232 290
383 3300006237 Ga0097621_100047510 Ga0097621_1000475103 290
384 3300006358 Ga0068871_100058287 Ga0068871_1000582873 290
385 3300006880 Ga0075429_100466852 Ga0075429_1004668521 290
386 3300009093 Ga0105240_10033322 Ga0105240_100333224 290
387 3300009148 Ga0105243_10009357 Ga0105243_100093574 290
388 3300009174 Ga0105241_10034460 Ga0105241_100344602 290
389 3300009176 Ga0105242_10046283 Ga0105242_100462834 290
390 3300009551 Ga0105238_10231384 Ga0105238_102313841 290
391 3300013105 Ga0157369_10232719 Ga0157369_102327192 290
392 3300013296 Ga0157374_10079663 Ga0157374_100796632 290
393 3300013297 Ga0157378_10583457 Ga0157378_105834571 290
394 3300014325 Ga0163163_10035752 Ga0163163_100357522 290
395 3300014326 Ga0157380_10006175 Ga0157380_100061755 290
396 3300015261 Ga0182006_1051402 Ga0182006_10514022 290
397 3300025906 Ga0207699_10131741 Ga0207699_101317411 290
398 3300025912 Ga0207707_10167091 Ga0207707_101670911 290
399 3300025913 Ga0207695_10020880 Ga0207695_100208809 290
400 3300025920 Ga0207649_10147540 Ga0207649_101475402 290
401 3300025921 Ga0207652_10460608 Ga0207652_104606081 290
402 3300025929 Ga0207664_10021327 Ga0207664_100213272 290
403 3300025939 Ga0207665_10094133 Ga0207665_100941331 290
404 3300026088 Ga0207641_10113299 Ga0207641_101132992 290
405 3300031548 Ga0307408_100157994 Ga0307408_1001579941 290
406 3300032005 Ga0307411_10598910 Ga0307411_105989101 290
407 3300035113 Ga0373936_0080890 Ga0373936_0080890_403_1278 290
408 3300035725 Ga0373947_0021993 Ga0373947_0021993_2795_3670 290
409 3300037068 Ga0373925_0016278 Ga0373925_0016278_2924_3799 290
410 3300046455 Ga0495603_0009651 Ga0495603_0009651_2447_3346 290
411 3300046472 Ga0495580_0002722 Ga0495580_0002722_2593_3468 290
412 3300046472 Ga0495580_0165814 Ga0495580_0165814_239_1138 290
413 3300046492 Ga0495585_0019975 Ga0495585_0019975_713_1612 290
414 3300046499 Ga0495594_0000127 Ga0495594_0000127_22159_23058 290
415 3300046500 Ga0495596_0023659 Ga0495596_0023659_1161_2060 290
416 3300046523 Ga0495644_0000059 Ga0495644_0000059_3223_4122 290
417 3300046616 Ga0495668_0019669 Ga0495668_0019669_1916_2815 290
418 3300046660 Ga0495625_0057308 Ga0495625_0057308_1354_2253 290
419 3300046684 Ga0495669_0040463 Ga0495669_0040463_846_1730 290
420 3300046794 Ga0495589_0123443 Ga0495589_0123443_241_1140 290
421 3300047318 Ga0495636_0070587 Ga0495636_0070587_578_1477 290
422 3300047445 Ga0495677_0023392 Ga0495677_0023392_388_1287 290
423 3300048905 Ga0496102_0076064 Ga0496102_0076064_71_961 290
424 3300048907 Ga0496104_0563702 Ga0496104_0563702_122_1009 290
425 3300048909 Ga0496106_0137094 Ga0496106_0137094_634_1524 290
426 3300048911 Ga0496108_0396441 Ga0496108_0396441_265_1155 290
427 3300048912 Ga0496109_0359197 Ga0496109_0359197_469_1359 290
428 3300048913 Ga0496110_0171555 Ga0496110_0171555_714_1604 290
429 3300048913 Ga0496110_0357175 Ga0496110_0357175_327_1217 290
430 3300048916 Ga0496113_0173793 Ga0496113_0173793_451_1341 290
431 3300048929 Ga0496126_0002908 Ga0496126_0002908_11909_12781 290
432 3300049568 Ga0501031_0306771 Ga0501031_0306771_46_930 290
433 3300049573 Ga0501037_0142340 Ga0501037_0142340_569_1453 290
434 3300049582 Ga0501048_0088273 Ga0501048_0088273_291_1175 290
435 3300049587 Ga0501071_0098649 Ga0501071_0098649_1078_1962 290
436 3300049591 Ga0501075_0286805 Ga0501075_0286805_157_1041 290
437 3300050508 nmdc:mga09592_291228_c1 nmdc:mga09592_291228_c1_346_1230 290
438 3300050511 nmdc:mga08y16_298035_c1 nmdc:mga08y16_298035_c1_430_1314 290
439 3300053153 Ga0500616_0003378 Ga0500616_0003378_7985_8884 290
440 3300061734 Ga0530510_0352656 Ga0530510_0352656_134_1018 290
441 3300005440 Ga0070705_100009513 Ga0070705_1000095134 291
442 3300005444 Ga0070694_100098237 Ga0070694_1000982372 291
443 3300005471 Ga0070698_100019858 Ga0070698_1000198584 291
444 3300005518 Ga0070699_100002167 Ga0070699_1000021675 291
445 3300005545 Ga0070695_100058698 Ga0070695_1000586983 291
446 3300005546 Ga0070696_100000606 Ga0070696_1000006063 291
447 3300005549 Ga0070704_100007048 Ga0070704_1000070484 291
448 3300025885 Ga0207653_10017713 Ga0207653_100177132 291
449 3300025917 Ga0207660_10167011 Ga0207660_101670112 291
450 3300028563 Ga0265319_1068389 Ga0265319_10683891 291
451 3300031711 Ga0265314_10160116 Ga0265314_101601161 291
452 3300036401 Ga0373937_0181245 Ga0373937_0181245_982_1860 291
453 3300050494 nmdc:mga06z11_24489_c1 nmdc:mga06z11_24489_c1_601_1476 291
454 3300000546 LJNas_1000897 LJNas_10008973 292
455 3300005436 Ga0070713_100087683 Ga0070713_1000876833 292
456 3300005437 Ga0070710_10204581 Ga0070710_102045811 292
457 3300006173 Ga0070716_100057085 Ga0070716_1000570852 292
458 3300006178 Ga0075367_10074639 Ga0075367_100746392 292
459 3300006871 Ga0075434_100603185 Ga0075434_1006031851 292
460 3300013297 Ga0157378_10227811 Ga0157378_102278112 292
461 3300014325 Ga0163163_10223385 Ga0163163_102233852 292
462 3300014969 Ga0157376_10526992 Ga0157376_105269922 292
463 3300025906 Ga0207699_10172749 Ga0207699_101727492 292
464 3300025928 Ga0207700_10015870 Ga0207700_100158702 292
465 3300025929 Ga0207664_10359871 Ga0207664_103598712 292
466 3300028380 Ga0268265_10461567 Ga0268265_104615672 292
467 3300031852 Ga0307410_10015047 Ga0307410_100150472 292
468 3300031852 Ga0307410_10020259 Ga0307410_100202592 292
469 3300032005 Ga0307411_10016206 Ga0307411_100162062 292
470 3300032126 Ga0307415_100080248 Ga0307415_1000802482 292
471 3300035692 Ga0373935_0244439 Ga0373935_0244439_108_1139 292
472 3300037068 Ga0373925_0013356 Ga0373925_0013356_1341_2264 292
473 3300048917 Ga0496114_0462457 Ga0496114_0462457_55_936 292
474 3300050494 nmdc:mga06z11_115837_c1 nmdc:mga06z11_115837_c1_162_1043 292
475 3300053078 Ga0495612_0121443 Ga0495612_0121443_230_1111 292
476 3300053085 Ga0495619_0019539 Ga0495619_0019539_3236_4144 292
477 3300053153 Ga0500616_0007181 Ga0500616_0007181_4595_5476 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

212

313

0.91

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

48

211

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zde-assembly1.cif.gz_A potassium free structure of e. coli exoix 0.862 1 261
3zdc-assembly1.cif.gz_A structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, potassium and calcium 0.8553 1 260
3zdb-assembly1.cif.gz_A-2 structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, di-magnesium and potassium 0.8528 1 261
3zda-assembly1.cif.gz_A structure of e. coli exoix in complex with a fragment of the flap1 dna oligonucleotide, potassium and magnesium 0.8515 1 261
3zd8-assembly2.cif.gz_B potassium bound structure of e. coli exoix in p1 0.8496 1 260
ID Description Score Start End Superfamily
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9066 3 167 3.40.50.1010
af_Q8I7W9_262_459_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8683 2 165 3.40.50.1010
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8666 3 167 3.40.50.1010
af_Q2FYJ1_1_174_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8634 2 166 3.40.50.1010
af_Q2FXN9_173_262_1.10.150.20 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.8437 170 258 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A2V8I4R1-F1-model_v4 Flap endonuclease 0.9916 1 147 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A1Q7XPG7-F1-model_v4 Flap endonuclease 0.9909 35 264 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7V8YLT2-F1-model_v4 Flap endonuclease 0.9906 1 205 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A537H256-F1-model_v4 Flap endonuclease 0.9902 1 172 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A6N8WWV0-F1-model_v4 Flap endonuclease 0.9895 1 277 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Feature Viewer

pLDDT pTM Quality
93.53 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map