F451852
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 478 | 235 | 476 | 436 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100065650|Ga0070698_1000656503 |
| Length | 490 |
| Sequence | MGMGTSFWEDLRADELQKAESEFSESWSHPRHAGQGCQGTLLMPKSISSTVTSIDATQRKLIIGIVIATVMALAIAIADLASGGRPDPPTLRAAATLLDGAWRFHTGDDPRWADANTQDNGWETIDLTAVPGSHDGDVGLPDYVGGWMAHGHPGYHGYAWYRRAVTVPAGRASWDILGPTLVEDGYELYWNGQRLGGSGRLGPAPRVVGTRPMRFALPTDAAGTTGVLAVRAYMRPSSGVSADGGGMHSAPILAPRPISDKLHRVQWERTVAGYIVDVIEPIAMLALIGLAFGCRSGSSHKGFLIFASIALALTAARRLNNAITAWTDLMDLATYAWLASVMWVPVVAAWTLAWNRWCLRSWRSIDVAAVVLAVAGIIGALIHSASVTSGSRLGSIALFVVVGARIVRSGPMRILALVTLASIVAGLFGGELLDPLGVPGIWFPFGIGVSRTQYVYAIVTPLLAFLIVRTLLFKENASIERRRSVVPIAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 156 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 157 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 158 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 168 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 169 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 170 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 196 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 204 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 205 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 206 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 207 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 208 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 227 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 229 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 230 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 231 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 232 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 233 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 234 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 235 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0 |
| Isolates | 0.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.72 |
| Nodule | 0 |
| Rhizoplane | 7.53 |
| Rhizosphere | 84.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10274347 | 3300003320 | Bacteria | 2080 |
| 2 | rootL2_10049188 | 3300003322 | Bacteria | 3595 |
| 3 | rootH1_10021045 | 3300003323 | Unclassified | 2798 |
| 4 | rootH1_10096388 | 3300003323 | Bacteria | 3780 |
| 5 | Ga0070658_10004926 | 3300005327 | Bacteria | 10881 |
| 6 | Ga0070658_10123678 | 3300005327 | Bacteria | 2151 |
| 7 | Ga0070658_10136905 | 3300005327 | Bacteria | 2044 |
| 8 | Ga0070676_10001897 | 3300005328 | Bacteria | 10624 |
| 9 | Ga0070676_10024325 | 3300005328 | Bacteria | 3411 |
| 10 | Ga0070683_100020633 | 3300005329 | Bacteria | 5865 |
| 11 | Ga0070690_100000834 | 3300005330 | Bacteria | 15640 |
| 12 | Ga0070690_100006272 | 3300005330 | Bacteria | 6744 |
| 13 | Ga0070690_100021025 | 3300005330 | Bacteria | 3981 |
| 14 | Ga0070670_100006502 | 3300005331 | Bacteria | 9894 |
| 15 | Ga0070670_100011270 | 3300005331 | Bacteria | 7644 |
| 16 | Ga0070670_100113049 | 3300005331 | Bacteria | 2340 |
| 17 | Ga0070670_100138726 | 3300005331 | Bacteria | 2102 |
| 18 | Ga0070670_100154417 | 3300005331 | Bacteria | 1987 |
| 19 | Ga0068869_100031824 | 3300005334 | Bacteria | 3713 |
| 20 | Ga0068869_100033501 | 3300005334 | Bacteria | 3627 |
| 21 | Ga0068869_100064706 | 3300005334 | Bacteria | 2690 |
| 22 | Ga0070666_10000010 | 3300005335 | Bacteria | 264789 |
| 23 | Ga0070666_10000193 | 3300005335 | Bacteria | 41355 |
| 24 | Ga0070666_10002750 | 3300005335 | Bacteria | 10624 |
| 25 | Ga0070666_10007561 | 3300005335 | Bacteria | 6701 |
| 26 | Ga0070666_10034515 | 3300005335 | Bacteria | 3352 |
| 27 | Ga0070666_10069027 | 3300005335 | Bacteria | 2402 |
| 28 | Ga0070682_100026495 | 3300005337 | Bacteria | 3471 |
| 29 | Ga0070682_100081156 | 3300005337 | Bacteria | 2099 |
| 30 | Ga0070689_100002142 | 3300005340 | Bacteria | 12806 |
| 31 | Ga0070661_100018371 | 3300005344 | Bacteria | 4971 |
| 32 | Ga0070661_100092243 | 3300005344 | Bacteria | 2244 |
| 33 | Ga0070661_100101649 | 3300005344 | Unclassified | 2139 |
| 34 | Ga0070668_100035529 | 3300005347 | Bacteria | 3800 |
| 35 | Ga0070669_100014669 | 3300005353 | Bacteria | 5578 |
| 36 | Ga0070669_100016036 | 3300005353 | Bacteria | 5346 |
| 37 | Ga0070669_100126912 | 3300005353 | Bacteria | 1953 |
| 38 | Ga0070675_100003000 | 3300005354 | Bacteria | 12737 |
| 39 | Ga0070675_100016640 | 3300005354 | Bacteria | 5838 |
| 40 | Ga0070675_100020143 | 3300005354 | Bacteria | 5322 |
| 41 | Ga0070675_100036178 | 3300005354 | Bacteria | 4015 |
| 42 | Ga0070675_100041139 | 3300005354 | Bacteria | 3775 |
| 43 | Ga0070675_100044842 | 3300005354 | Bacteria | 3616 |
| 44 | Ga0070675_100072155 | 3300005354 | Bacteria | 2866 |
| 45 | Ga0070671_100009164 | 3300005355 | Bacteria | 7946 |
| 46 | Ga0070671_100171432 | 3300005355 | Bacteria | 1835 |
| 47 | Ga0070674_100008191 | 3300005356 | Bacteria | 6207 |
| 48 | Ga0070674_100038800 | 3300005356 | Bacteria | 3212 |
| 49 | Ga0070674_100233771 | 3300005356 | Bacteria | 1436 |
| 50 | Ga0070673_100041396 | 3300005364 | Bacteria | 3543 |
| 51 | Ga0070673_100154612 | 3300005364 | Bacteria | 1946 |
| 52 | Ga0070667_100016832 | 3300005367 | Bacteria | 6050 |
| 53 | Ga0070667_100047243 | 3300005367 | Bacteria | 3622 |
| 54 | Ga0070700_100003761 | 3300005441 | Bacteria | 7857 |
| 55 | Ga0070700_100185547 | 3300005441 | Bacteria | 1451 |
| 56 | Ga0070694_100003463 | 3300005444 | Bacteria | 9452 |
| 57 | Ga0070708_100000910 | 3300005445 | Bacteria | 22396 |
| 58 | Ga0070663_100089442 | 3300005455 | Bacteria | 2279 |
| 59 | Ga0070678_100070231 | 3300005456 | Bacteria | 2617 |
| 60 | Ga0070678_100130234 | 3300005456 | Bacteria | 1997 |
| 61 | Ga0070662_100002210 | 3300005457 | Bacteria | 11942 |
| 62 | Ga0070681_10192239 | 3300005458 | Bacteria | 1960 |
| 63 | Ga0068867_100002149 | 3300005459 | Bacteria | 13830 |
| 64 | Ga0068867_100039522 | 3300005459 | Bacteria | 3440 |
| 65 | Ga0068867_100085062 | 3300005459 | Bacteria | 2391 |
| 66 | Ga0070706_100004218 | 3300005467 | Bacteria | 13949 |
| 67 | Ga0070706_100008230 | 3300005467 | Bacteria | 9726 |
| 68 | Ga0070698_100065650 | 3300005471 | Bacteria | 3653 |
| 69 | Ga0070698_100094163 | 3300005471 | Bacteria | 2974 |
| 70 | Ga0070698_100098816 | 3300005471 | Bacteria | 2892 |
| 71 | Ga0070699_100159859 | 3300005518 | Bacteria | 1994 |
| 72 | Ga0070679_100098463 | 3300005530 | Unclassified | 2912 |
| 73 | Ga0070684_100030426 | 3300005535 | Bacteria | 4586 |
| 74 | Ga0070697_100005218 | 3300005536 | Bacteria | 9980 |
| 75 | Ga0068853_100002236 | 3300005539 | Bacteria | 14458 |
| 76 | Ga0070672_100014577 | 3300005543 | Bacteria | 5574 |
| 77 | Ga0070672_100017382 | 3300005543 | Bacteria | 5175 |
| 78 | Ga0070672_100171376 | 3300005543 | Bacteria | 1805 |
| 79 | Ga0070686_100002579 | 3300005544 | Bacteria | 9997 |
| 80 | Ga0070686_100032134 | 3300005544 | Bacteria | 3215 |
| 81 | Ga0070686_100036001 | 3300005544 | Bacteria | 3061 |
| 82 | Ga0070665_100010580 | 3300005548 | Bacteria | 9339 |
| 83 | Ga0070665_100013372 | 3300005548 | Bacteria | 8260 |
| 84 | Ga0070665_100014505 | 3300005548 | Bacteria | 7904 |
| 85 | Ga0070665_100097221 | 3300005548 | Bacteria | 2949 |
| 86 | Ga0070665_100107039 | 3300005548 | Bacteria | 2798 |
| 87 | Ga0070665_100139346 | 3300005548 | Bacteria | 2429 |
| 88 | Ga0070665_100165248 | 3300005548 | Bacteria | 2215 |
| 89 | Ga0068855_100013012 | 3300005563 | Bacteria | 10040 |
| 90 | Ga0070664_100006087 | 3300005564 | Bacteria | 9753 |
| 91 | Ga0070664_100024555 | 3300005564 | Bacteria | 4986 |
| 92 | Ga0070664_100063115 | 3300005564 | Bacteria | 3159 |
| 93 | Ga0070664_100110717 | 3300005564 | Unclassified | 2396 |
| 94 | Ga0068854_100021063 | 3300005578 | Bacteria | 4420 |
| 95 | Ga0068856_100000086 | 3300005614 | Bacteria | 87570 |
| 96 | Ga0068856_100007548 | 3300005614 | Bacteria | 10610 |
| 97 | Ga0068856_100091780 | 3300005614 | Bacteria | 3021 |
| 98 | Ga0068859_100001867 | 3300005617 | Bacteria | 21439 |
| 99 | Ga0068859_100033836 | 3300005617 | Bacteria | 5131 |
| 100 | Ga0068859_100047764 | 3300005617 | Bacteria | 4301 |
| 101 | Ga0068859_100066772 | 3300005617 | Bacteria | 3632 |
| 102 | Ga0068859_100103335 | 3300005617 | Bacteria | 2907 |
| 103 | Ga0068859_100103526 | 3300005617 | Bacteria | 2905 |
| 104 | Ga0068859_100109960 | 3300005617 | Bacteria | 2818 |
| 105 | Ga0068859_100166462 | 3300005617 | Bacteria | 2284 |
| 106 | Ga0068859_100209161 | 3300005617 | Bacteria | 2037 |
| 107 | Ga0068859_100217533 | 3300005617 | Bacteria | 1998 |
| 108 | Ga0068864_100060587 | 3300005618 | Bacteria | 3277 |
| 109 | Ga0068864_100074707 | 3300005618 | Bacteria | 2958 |
| 110 | Ga0068864_100136445 | 3300005618 | Bacteria | 2209 |
| 111 | Ga0068864_100147625 | 3300005618 | Bacteria | 2127 |
| 112 | Ga0068864_100226954 | 3300005618 | Bacteria | 1725 |
| 113 | Ga0068864_100245596 | 3300005618 | Bacteria | 1660 |
| 114 | Ga0068866_10037680 | 3300005718 | Bacteria | 2376 |
| 115 | Ga0068861_100001931 | 3300005719 | Bacteria | 13351 |
| 116 | Ga0068861_100012556 | 3300005719 | Bacteria | 5909 |
| 117 | Ga0068861_100172315 | 3300005719 | Bacteria | 1794 |
| 118 | Ga0068851_10031160 | 3300005834 | Bacteria | 2647 |
| 119 | Ga0068870_10001259 | 3300005840 | Bacteria | 10159 |
| 120 | Ga0068863_100009364 | 3300005841 | Bacteria | 9557 |
| 121 | Ga0068863_100014316 | 3300005841 | Bacteria | 7641 |
| 122 | Ga0068863_100016748 | 3300005841 | Bacteria | 7032 |
| 123 | Ga0068863_100027907 | 3300005841 | Bacteria | 5388 |
| 124 | Ga0068858_100001137 | 3300005842 | Bacteria | 27530 |
| 125 | Ga0068858_100284182 | 3300005842 | Bacteria | 1576 |
| 126 | Ga0068860_100009086 | 3300005843 | Bacteria | 9889 |
| 127 | Ga0068860_100071889 | 3300005843 | Bacteria | 3287 |
| 128 | Ga0068860_100089427 | 3300005843 | Bacteria | 2932 |
| 129 | Ga0068860_100139827 | 3300005843 | Bacteria | 2326 |
| 130 | Ga0068860_100176554 | 3300005843 | Bacteria | 2064 |
| 131 | Ga0068862_100002215 | 3300005844 | Bacteria | 17418 |
| 132 | Ga0068862_100010286 | 3300005844 | Bacteria | 7719 |
| 133 | Ga0081455_10176824 | 3300005937 | Bacteria | 1620 |
| 134 | Ga0081539_10002981 | 3300005985 | Bacteria | 22205 |
| 135 | Ga0075364_10022681 | 3300006051 | Bacteria | 3968 |
| 136 | Ga0097621_100000341 | 3300006237 | Bacteria | 31966 |
| 137 | Ga0068871_100000340 | 3300006358 | Bacteria | 32379 |
| 138 | Ga0068871_100029051 | 3300006358 | Unclassified | 4341 |
| 139 | Ga0075428_100009361 | 3300006844 | Bacteria | 10868 |
| 140 | Ga0075428_100157466 | 3300006844 | Bacteria | 2466 |
| 141 | Ga0075431_100000953 | 3300006847 | Bacteria | 25591 |
| 142 | Ga0075433_10010865 | 3300006852 | Bacteria | 7320 |
| 143 | Ga0075433_10050310 | 3300006852 | Bacteria | 3627 |
| 144 | Ga0075434_100064378 | 3300006871 | Bacteria | 3650 |
| 145 | Ga0075434_100082835 | 3300006871 | Bacteria | 3205 |
| 146 | Ga0075434_100132465 | 3300006871 | Bacteria | 2512 |
| 147 | Ga0075429_100049672 | 3300006880 | Bacteria | 3648 |
| 148 | Ga0075429_100212978 | 3300006880 | Bacteria | 1692 |
| 149 | Ga0068865_100005131 | 3300006881 | Bacteria | 7928 |
| 150 | Ga0068865_100115834 | 3300006881 | Bacteria | 1984 |
| 151 | Ga0097620_100001867 | 3300006931 | Bacteria | 21439 |
| 152 | Ga0097620_100033837 | 3300006931 | Bacteria | 5131 |
| 153 | Ga0097620_100047762 | 3300006931 | Bacteria | 4301 |
| 154 | Ga0097620_100066769 | 3300006931 | Bacteria | 3632 |
| 155 | Ga0097620_100103322 | 3300006931 | Bacteria | 2907 |
| 156 | Ga0097620_100103527 | 3300006931 | Bacteria | 2905 |
| 157 | Ga0097620_100109957 | 3300006931 | Bacteria | 2818 |
| 158 | Ga0097620_100166480 | 3300006931 | Bacteria | 2284 |
| 159 | Ga0097620_100209161 | 3300006931 | Bacteria | 2037 |
| 160 | Ga0097620_100217534 | 3300006931 | Bacteria | 1998 |
| 161 | Ga0075435_100012970 | 3300007076 | Bacteria | 6182 |
| 162 | Ga0075435_100225529 | 3300007076 | Bacteria | 1591 |
| 163 | Ga0105240_10001400 | 3300009093 | Bacteria | 41411 |
| 164 | Ga0105240_10002378 | 3300009093 | Bacteria | 30334 |
| 165 | Ga0111539_10011257 | 3300009094 | Bacteria | 11241 |
| 166 | Ga0111539_10012494 | 3300009094 | Bacteria | 10643 |
| 167 | Ga0111539_10030476 | 3300009094 | Bacteria | 6556 |
| 168 | Ga0111539_10035427 | 3300009094 | Bacteria | 6043 |
| 169 | Ga0111539_10047896 | 3300009094 | Bacteria | 5107 |
| 170 | Ga0111539_10050704 | 3300009094 | Bacteria | 4944 |
| 171 | Ga0111539_10124653 | 3300009094 | Bacteria | 3019 |
| 172 | Ga0111539_10193743 | 3300009094 | Bacteria | 2371 |
| 173 | Ga0105247_10000536 | 3300009101 | Bacteria | 30808 |
| 174 | Ga0114129_10047631 | 3300009147 | Bacteria | 6023 |
| 175 | Ga0105243_10000027 | 3300009148 | Bacteria | 191224 |
| 176 | Ga0105243_10004854 | 3300009148 | Bacteria | 10561 |
| 177 | Ga0105243_10026660 | 3300009148 | Bacteria | 4424 |
| 178 | Ga0105241_10000436 | 3300009174 | Bacteria | 31406 |
| 179 | Ga0105242_10000056 | 3300009176 | Bacteria | 76052 |
| 180 | Ga0105242_10001559 | 3300009176 | Bacteria | 18042 |
| 181 | Ga0105242_10008632 | 3300009176 | Bacteria | 7823 |
| 182 | Ga0105242_10019209 | 3300009176 | Bacteria | 5354 |
| 183 | Ga0105248_10001767 | 3300009177 | Bacteria | 24053 |
| 184 | Ga0105248_10007658 | 3300009177 | Bacteria | 11865 |
| 185 | Ga0105248_10051695 | 3300009177 | Bacteria | 4610 |
| 186 | Ga0105237_10000070 | 3300009545 | Bacteria | 136694 |
| 187 | Ga0105237_10031809 | 3300009545 | Bacteria | 5345 |
| 188 | Ga0105238_10000044 | 3300009551 | Bacteria | 151485 |
| 189 | Ga0105238_10000736 | 3300009551 | Bacteria | 34203 |
| 190 | Ga0105238_10104209 | 3300009551 | Bacteria | 2818 |
| 191 | Ga0105249_10017449 | 3300009553 | Bacteria | 6372 |
| 192 | Ga0105239_10092011 | 3300010375 | Bacteria | 3347 |
| 193 | Ga0105239_10247816 | 3300010375 | Bacteria | 2000 |
| 194 | Ga0105246_10062594 | 3300011119 | Bacteria | 2593 |
| 195 | Ga0157373_10081491 | 3300013100 | Bacteria | 2281 |
| 196 | Ga0157369_10022988 | 3300013105 | Bacteria | 6950 |
| 197 | Ga0157374_10222142 | 3300013296 | Bacteria | 1854 |
| 198 | Ga0157378_10026566 | 3300013297 | Bacteria | 5103 |
| 199 | Ga0163162_10102623 | 3300013306 | Bacteria | 2953 |
| 200 | Ga0157375_10003297 | 3300013308 | Bacteria | 13977 |
| 201 | Ga0157375_10034015 | 3300013308 | Bacteria | 4850 |
| 202 | Ga0157375_10081078 | 3300013308 | Bacteria | 3284 |
| 203 | Ga0157375_10160800 | 3300013308 | Unclassified | 2387 |
| 204 | Ga0163163_10118360 | 3300014325 | Unclassified | 2681 |
| 205 | Ga0157380_10014094 | 3300014326 | Bacteria | 5843 |
| 206 | Ga0157380_10022220 | 3300014326 | Bacteria | 4771 |
| 207 | Ga0157380_10076921 | 3300014326 | Bacteria | 2718 |
| 208 | Ga0157377_10027960 | 3300014745 | Bacteria | 3032 |
| 209 | Ga0157379_10103279 | 3300014968 | Bacteria | 2558 |
| 210 | Ga0157376_10002143 | 3300014969 | Bacteria | 13292 |
| 211 | Ga0157376_10007517 | 3300014969 | Bacteria | 7787 |
| 212 | Ga0157376_10166866 | 3300014969 | Bacteria | 2001 |
| 213 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 214 | Ga0163161_10006219 | 3300017792 | Bacteria | 8273 |
| 215 | Ga0163161_10037241 | 3300017792 | Bacteria | 3486 |
| 216 | Ga0213876_10017563 | 3300021384 | Bacteria | 3777 |
| 217 | Ga0207427_100251 | 3300025231 | Bacteria | 42496 |
| 218 | Ga0209026_1000378 | 3300025250 | Bacteria | 40841 |
| 219 | Ga0209759_1021271 | 3300025256 | Bacteria | 1481 |
| 220 | Ga0209759_1021272 | 3300025256 | Bacteria | 1481 |
| 221 | Ga0209455_1000151 | 3300025272 | Bacteria | 129842 |
| 222 | Ga0209051_1004999 | 3300025303 | Bacteria | 7904 |
| 223 | Ga0207682_10004090 | 3300025893 | Bacteria | 6193 |
| 224 | Ga0207642_10011050 | 3300025899 | Bacteria | 3207 |
| 225 | Ga0207710_10000212 | 3300025900 | Bacteria | 51768 |
| 226 | Ga0207688_10047236 | 3300025901 | Bacteria | 2404 |
| 227 | Ga0207680_10042657 | 3300025903 | Bacteria | 2655 |
| 228 | Ga0207647_10041567 | 3300025904 | Bacteria | 2890 |
| 229 | Ga0207645_10005982 | 3300025907 | Bacteria | 8756 |
| 230 | Ga0207645_10013082 | 3300025907 | Bacteria | 5605 |
| 231 | Ga0207645_10034632 | 3300025907 | Bacteria | 3244 |
| 232 | Ga0207643_10000629 | 3300025908 | Bacteria | 22222 |
| 233 | Ga0207643_10033243 | 3300025908 | Bacteria | 2885 |
| 234 | Ga0207643_10034714 | 3300025908 | Bacteria | 2826 |
| 235 | Ga0207705_10001527 | 3300025909 | Bacteria | 18362 |
| 236 | Ga0207684_10009547 | 3300025910 | Bacteria | 8557 |
| 237 | Ga0207684_10054714 | 3300025910 | Bacteria | 3386 |
| 238 | Ga0207654_10000604 | 3300025911 | Bacteria | 20264 |
| 239 | Ga0207707_10079691 | 3300025912 | Bacteria | 2859 |
| 240 | Ga0207707_10160504 | 3300025912 | Bacteria | 1966 |
| 241 | Ga0207695_10000943 | 3300025913 | Bacteria | 51800 |
| 242 | Ga0207695_10001814 | 3300025913 | Bacteria | 33622 |
| 243 | Ga0207695_10006277 | 3300025913 | Bacteria | 15474 |
| 244 | Ga0207671_10000429 | 3300025914 | Bacteria | 57986 |
| 245 | Ga0207671_10186636 | 3300025914 | Bacteria | 1615 |
| 246 | Ga0207693_10135545 | 3300025915 | Bacteria | 1936 |
| 247 | Ga0207693_10227210 | 3300025915 | Bacteria | 1466 |
| 248 | Ga0207662_10008551 | 3300025918 | Bacteria | 5610 |
| 249 | Ga0207657_10202794 | 3300025919 | Bacteria | 1595 |
| 250 | Ga0207649_10013683 | 3300025920 | Bacteria | 4534 |
| 251 | Ga0207681_10003774 | 3300025923 | Bacteria | 9413 |
| 252 | Ga0207694_10000109 | 3300025924 | Bacteria | 86216 |
| 253 | Ga0207694_10006182 | 3300025924 | Bacteria | 9145 |
| 254 | Ga0207650_10023348 | 3300025925 | Bacteria | 4384 |
| 255 | Ga0207650_10062156 | 3300025925 | Bacteria | 2790 |
| 256 | Ga0207659_10001820 | 3300025926 | Bacteria | 12625 |
| 257 | Ga0207659_10007853 | 3300025926 | Bacteria | 6594 |
| 258 | Ga0207659_10034596 | 3300025926 | Bacteria | 3485 |
| 259 | Ga0207659_10049922 | 3300025926 | Bacteria | 2970 |
| 260 | Ga0207644_10163691 | 3300025931 | Bacteria | 1731 |
| 261 | Ga0207690_10000285 | 3300025932 | Bacteria | 35963 |
| 262 | Ga0207690_10006534 | 3300025932 | Bacteria | 6914 |
| 263 | Ga0207706_10019662 | 3300025933 | Bacteria | 6075 |
| 264 | Ga0207706_10021575 | 3300025933 | Bacteria | 5782 |
| 265 | Ga0207706_10085194 | 3300025933 | Bacteria | 2778 |
| 266 | Ga0207686_10000008 | 3300025934 | Bacteria | 245575 |
| 267 | Ga0207709_10000025 | 3300025935 | Bacteria | 364795 |
| 268 | Ga0207709_10008990 | 3300025935 | Bacteria | 5506 |
| 269 | Ga0207709_10060507 | 3300025935 | Bacteria | 2362 |
| 270 | Ga0207670_10049975 | 3300025936 | Bacteria | 2799 |
| 271 | Ga0207670_10122396 | 3300025936 | Bacteria | 1893 |
| 272 | Ga0207670_10158529 | 3300025936 | Bacteria | 1687 |
| 273 | Ga0207704_10016391 | 3300025938 | Bacteria | 3807 |
| 274 | Ga0207691_10008078 | 3300025940 | Bacteria | 10109 |
| 275 | Ga0207691_10009281 | 3300025940 | Bacteria | 9437 |
| 276 | Ga0207691_10009607 | 3300025940 | Bacteria | 9281 |
| 277 | Ga0207691_10033968 | 3300025940 | Bacteria | 4747 |
| 278 | Ga0207691_10048351 | 3300025940 | Bacteria | 3901 |
| 279 | Ga0207691_10064511 | 3300025940 | Bacteria | 3318 |
| 280 | Ga0207711_10040534 | 3300025941 | Bacteria | 3962 |
| 281 | Ga0207711_10050459 | 3300025941 | Bacteria | 3562 |
| 282 | Ga0207711_10156128 | 3300025941 | Bacteria | 2062 |
| 283 | Ga0207689_10001673 | 3300025942 | Bacteria | 21051 |
| 284 | Ga0207689_10070618 | 3300025942 | Bacteria | 2869 |
| 285 | Ga0207689_10093223 | 3300025942 | Bacteria | 2474 |
| 286 | Ga0207661_10038991 | 3300025944 | Bacteria | 3727 |
| 287 | Ga0207679_10002837 | 3300025945 | Bacteria | 10746 |
| 288 | Ga0207679_10055191 | 3300025945 | Bacteria | 2927 |
| 289 | Ga0207679_10121734 | 3300025945 | Bacteria | 2078 |
| 290 | Ga0207667_10014977 | 3300025949 | Bacteria | 8820 |
| 291 | Ga0207667_10054538 | 3300025949 | Bacteria | 4204 |
| 292 | Ga0207651_10003017 | 3300025960 | Bacteria | 8156 |
| 293 | Ga0207651_10010900 | 3300025960 | Bacteria | 5060 |
| 294 | Ga0207651_10029048 | 3300025960 | Bacteria | 3498 |
| 295 | Ga0207651_10082766 | 3300025960 | Bacteria | 2318 |
| 296 | Ga0207712_10041534 | 3300025961 | Bacteria | 3161 |
| 297 | Ga0207668_10146301 | 3300025972 | Bacteria | 1824 |
| 298 | Ga0207640_10001631 | 3300025981 | Bacteria | 12021 |
| 299 | Ga0207640_10065325 | 3300025981 | Bacteria | 2427 |
| 300 | Ga0207658_10001950 | 3300025986 | Bacteria | 15409 |
| 301 | Ga0207658_10042978 | 3300025986 | Bacteria | 3282 |
| 302 | Ga0207658_10073339 | 3300025986 | Bacteria | 2598 |
| 303 | Ga0207658_10110339 | 3300025986 | Unclassified | 2173 |
| 304 | Ga0207703_10103256 | 3300026035 | Bacteria | 2420 |
| 305 | Ga0207678_10038003 | 3300026067 | Bacteria | 4186 |
| 306 | Ga0207678_10088781 | 3300026067 | Bacteria | 2642 |
| 307 | Ga0207708_10008383 | 3300026075 | Bacteria | 7651 |
| 308 | Ga0207702_10000160 | 3300026078 | Bacteria | 79708 |
| 309 | Ga0207641_10015006 | 3300026088 | Bacteria | 6351 |
| 310 | Ga0207641_10029705 | 3300026088 | Bacteria | 4521 |
| 311 | Ga0207648_10000973 | 3300026089 | Bacteria | 32318 |
| 312 | Ga0207648_10025223 | 3300026089 | Bacteria | 5298 |
| 313 | Ga0207648_10095090 | 3300026089 | Bacteria | 2606 |
| 314 | Ga0207648_10161616 | 3300026089 | Bacteria | 1978 |
| 315 | Ga0207676_10024024 | 3300026095 | Bacteria | 4506 |
| 316 | Ga0207676_10062583 | 3300026095 | Bacteria | 2952 |
| 317 | Ga0207676_10080407 | 3300026095 | Bacteria | 2645 |
| 318 | Ga0207676_10188342 | 3300026095 | Bacteria | 1813 |
| 319 | Ga0207674_10039459 | 3300026116 | Bacteria | 4894 |
| 320 | Ga0207674_10128453 | 3300026116 | Bacteria | 2499 |
| 321 | Ga0207674_10139849 | 3300026116 | Bacteria | 2381 |
| 322 | Ga0207675_100001134 | 3300026118 | Bacteria | 26415 |
| 323 | Ga0207675_100003190 | 3300026118 | Bacteria | 16090 |
| 324 | Ga0207675_100004461 | 3300026118 | Bacteria | 13527 |
| 325 | Ga0207675_100052985 | 3300026118 | Bacteria | 3786 |
| 326 | Ga0207675_100070198 | 3300026118 | Bacteria | 3274 |
| 327 | Ga0207683_10054559 | 3300026121 | Bacteria | 3504 |
| 328 | Ga0207683_10056723 | 3300026121 | Bacteria | 3437 |
| 329 | Ga0207683_10062019 | 3300026121 | Bacteria | 3292 |
| 330 | Ga0207428_10006505 | 3300027907 | Bacteria | 10785 |
| 331 | Ga0207428_10032544 | 3300027907 | Bacteria | 4287 |
| 332 | Ga0207428_10039155 | 3300027907 | Bacteria | 3848 |
| 333 | Ga0207428_10076265 | 3300027907 | Bacteria | 2625 |
| 334 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 335 | Ga0268266_10065155 | 3300028379 | Bacteria | 3149 |
| 336 | Ga0268266_10070181 | 3300028379 | Bacteria | 3036 |
| 337 | Ga0268265_10001596 | 3300028380 | Bacteria | 18723 |
| 338 | Ga0268265_10112366 | 3300028380 | Bacteria | 2227 |
| 339 | Ga0268264_10071056 | 3300028381 | Bacteria | 2948 |
| 340 | Ga0268264_10119343 | 3300028381 | Bacteria | 2322 |
| 341 | Ga0268264_10195996 | 3300028381 | Bacteria | 1844 |
| 342 | Ga0307515_10159193 | 3300028794 | Bacteria | 2313 |
| 343 | Ga0307513_10008910 | 3300031456 | Bacteria | 12759 |
| 344 | Ga0307513_10070070 | 3300031456 | Bacteria | 3667 |
| 345 | Ga0307513_10124642 | 3300031456 | Bacteria | 2535 |
| 346 | Ga0307509_10001087 | 3300031507 | Bacteria | 46534 |
| 347 | Ga0307509_10038884 | 3300031507 | Bacteria | 5186 |
| 348 | Ga0307508_10006470 | 3300031616 | Bacteria | 11020 |
| 349 | Ga0307508_10026468 | 3300031616 | Bacteria | 5257 |
| 350 | Ga0307516_10012872 | 3300031730 | Bacteria | 8976 |
| 351 | Ga0307406_10095122 | 3300031901 | Bacteria | 2015 |
| 352 | Ga0373961_0000787 | 3300035241 | Bacteria | 10887 |
| 353 | Ga0373937_0035783 | 3300036401 | Bacteria | 4521 |
| 354 | Ga0373925_0025126 | 3300037068 | Bacteria | 4350 |
| 355 | Ga0395899_0005425 | 3300037312 | Bacteria | 9899 |
| 356 | Ga0395900_0002085 | 3300037418 | Bacteria | 22422 |
| 357 | Ga0395901_0000604 | 3300038443 | Bacteria | 41808 |
| 358 | Ga0395901_0100935 | 3300038443 | Bacteria | 3027 |
| 359 | Ga0436365_1749406 | 3300039437 | Bacteria | 18798 |
| 360 | Ga0451577_0022660 | 3300042876 | Bacteria | 5734 |
| 361 | Ga0453684_0080848 | 3300044712 | Bacteria | 4056 |
| 362 | Ga0451576_0026362 | 3300045051 | Bacteria | 6253 |
| 363 | Ga0451576_0348054 | 3300045051 | Bacteria | 1552 |
| 364 | Ga0495638_0000783 | 3300046460 | Bacteria | 33554 |
| 365 | Ga0495638_0004874 | 3300046460 | Bacteria | 10097 |
| 366 | Ga0495638_0009044 | 3300046460 | Bacteria | 7022 |
| 367 | Ga0495580_0002707 | 3300046472 | Bacteria | 15322 |
| 368 | Ga0495580_0008311 | 3300046472 | Bacteria | 8260 |
| 369 | Ga0495582_0015610 | 3300046473 | Bacteria | 4170 |
| 370 | Ga0495582_0027993 | 3300046473 | Bacteria | 3092 |
| 371 | Ga0495639_0053417 | 3300046475 | Bacteria | 1841 |
| 372 | Ga0495664_0036664 | 3300046477 | Bacteria | 2891 |
| 373 | Ga0495584_0061669 | 3300046491 | Bacteria | 1885 |
| 374 | Ga0495583_0000149 | 3300046506 | Bacteria | 117980 |
| 375 | Ga0495606_0007250 | 3300046507 | Bacteria | 9992 |
| 376 | Ga0495665_0081006 | 3300046531 | Bacteria | 1707 |
| 377 | Ga0495622_0032975 | 3300046557 | Bacteria | 2418 |
| 378 | Ga0495656_0075157 | 3300046615 | Bacteria | 1511 |
| 379 | Ga0495668_0085586 | 3300046616 | Bacteria | 1729 |
| 380 | Ga0495625_0016273 | 3300046660 | Bacteria | 5857 |
| 381 | Ga0495657_0146773 | 3300046675 | Bacteria | 1467 |
| 382 | Ga0495599_0046645 | 3300046678 | Bacteria | 2717 |
| 383 | Ga0495658_0078192 | 3300046683 | Bacteria | 1936 |
| 384 | Ga0495613_0028910 | 3300046689 | Bacteria | 4123 |
| 385 | Ga0495649_0001149 | 3300046694 | Bacteria | 20618 |
| 386 | Ga0495600_0096360 | 3300046809 | Bacteria | 1929 |
| 387 | Ga0495604_0021923 | 3300047317 | Bacteria | 5099 |
| 388 | Ga0495636_0024179 | 3300047318 | Bacteria | 2462 |
| 389 | Ga0495674_0039335 | 3300047319 | Bacteria | 4240 |
| 390 | Ga0495674_0113661 | 3300047319 | Bacteria | 2293 |
| 391 | Ga0495686_0000946 | 3300047472 | Bacteria | 36027 |
| 392 | Ga0495686_0001902 | 3300047472 | Bacteria | 20837 |
| 393 | Ga0496101_0167343 | 3300048904 | Bacteria | 1688 |
| 394 | Ga0496102_0123891 | 3300048905 | Bacteria | 2415 |
| 395 | Ga0496104_0010105 | 3300048907 | Bacteria | 8426 |
| 396 | Ga0496104_0053242 | 3300048907 | Bacteria | 3823 |
| 397 | Ga0496104_0055003 | 3300048907 | Bacteria | 3762 |
| 398 | Ga0496104_0144011 | 3300048907 | Bacteria | 2289 |
| 399 | Ga0496104_0244461 | 3300048907 | Bacteria | 1707 |
| 400 | Ga0496106_0002225 | 3300048909 | Bacteria | 14464 |
| 401 | Ga0496107_0008832 | 3300048910 | Bacteria | 6982 |
| 402 | Ga0496107_0174424 | 3300048910 | Bacteria | 1596 |
| 403 | Ga0496108_0017834 | 3300048911 | Bacteria | 5806 |
| 404 | Ga0496108_0029664 | 3300048911 | Bacteria | 4532 |
| 405 | Ga0496108_0043312 | 3300048911 | Bacteria | 3760 |
| 406 | Ga0496109_0000397 | 3300048912 | Bacteria | 39356 |
| 407 | Ga0496109_0021919 | 3300048912 | Bacteria | 5656 |
| 408 | Ga0496109_0034542 | 3300048912 | Bacteria | 4555 |
| 409 | Ga0496109_0146235 | 3300048912 | Bacteria | 2211 |
| 410 | Ga0496110_0015795 | 3300048913 | Bacteria | 6294 |
| 411 | Ga0496110_0120299 | 3300048913 | Bacteria | 2365 |
| 412 | Ga0496110_0166949 | 3300048913 | Bacteria | 1996 |
| 413 | Ga0496110_0241307 | 3300048913 | Bacteria | 1644 |
| 414 | Ga0496111_0009989 | 3300048914 | Bacteria | 6350 |
| 415 | Ga0496111_0013749 | 3300048914 | Bacteria | 5514 |
| 416 | Ga0496111_0150980 | 3300048914 | Bacteria | 1723 |
| 417 | Ga0496112_0007198 | 3300048915 | Bacteria | 9858 |
| 418 | Ga0496112_0029356 | 3300048915 | Bacteria | 5318 |
| 419 | Ga0496112_0038969 | 3300048915 | Bacteria | 4642 |
| 420 | Ga0496113_0000284 | 3300048916 | Bacteria | 23973 |
| 421 | Ga0496113_0038362 | 3300048916 | Bacteria | 3522 |
| 422 | Ga0496113_0056408 | 3300048916 | Bacteria | 2949 |
| 423 | Ga0496114_0000064 | 3300048917 | Bacteria | 83513 |
| 424 | Ga0496114_0000550 | 3300048917 | Bacteria | 27773 |
| 425 | Ga0496114_0204193 | 3300048917 | Unclassified | 1732 |
| 426 | Ga0496114_0305663 | 3300048917 | Bacteria | 1404 |
| 427 | Ga0496115_0000354 | 3300048918 | Bacteria | 38566 |
| 428 | Ga0496115_0100608 | 3300048918 | Unclassified | 2370 |
| 429 | Ga0496118_0082421 | 3300048921 | Bacteria | 2254 |
| 430 | Ga0496121_0001659 | 3300048924 | Bacteria | 36737 |
| 431 | Ga0496125_0031533 | 3300048928 | Bacteria | 4723 |
| 432 | Ga0501047_0000443 | 3300049581 | Bacteria | 45792 |
| 433 | Ga0501069_0018688 | 3300049585 | Bacteria | 3743 |
| 434 | Ga0501070_0007236 | 3300049586 | Bacteria | 9426 |
| 435 | Ga0501070_0021035 | 3300049586 | Bacteria | 5473 |
| 436 | Ga0501070_0104110 | 3300049586 | Unclassified | 2347 |
| 437 | Ga0501071_0055916 | 3300049587 | Bacteria | 2849 |
| 438 | Ga0501074_0001565 | 3300049590 | Bacteria | 15472 |
| 439 | Ga0501077_0004900 | 3300049593 | Bacteria | 8127 |
| 440 | Ga0501080_0008896 | 3300049742 | Bacteria | 9130 |
| 441 | Ga0501080_0216173 | 3300049742 | Bacteria | 1755 |
| 442 | Ga0501035_0160437 | 3300049822 | Bacteria | 1946 |
| 443 | Ga0501044_0021521 | 3300049823 | Bacteria | 6878 |
| 444 | Ga0501044_0188823 | 3300049823 | Bacteria | 2024 |
| 445 | nmdc:mga05p37_10270_c1 | 3300050507 | Bacteria | 11117 |
| 446 | nmdc:mga05p37_65248_c2 | 3300050507 | Bacteria | 3852 |
| 447 | nmdc:mga09592_46066_c1 | 3300050508 | Bacteria | 3674 |
| 448 | nmdc:mga09592_50643_c1 | 3300050508 | Bacteria | 3502 |
| 449 | nmdc:mga06r32_2052_c1 | 3300050510 | Bacteria | 18014 |
| 450 | nmdc:mga06r32_27220_c1 | 3300050510 | Bacteria | 5339 |
| 451 | nmdc:mga08y16_17057_c1 | 3300050511 | Bacteria | 7647 |
| 452 | nmdc:mga08y16_19632_c1 | 3300050511 | Bacteria | 7127 |
| 453 | nmdc:mga08y16_22652_c1 | 3300050511 | Bacteria | 6632 |
| 454 | nmdc:mga08y16_45345_c1 | 3300050511 | Bacteria | 4607 |
| 455 | nmdc:mga08y16_51591_c1 | 3300050511 | Bacteria | 4304 |
| 456 | nmdc:mga08y16_54337_c1 | 3300050511 | Bacteria | 4185 |
| 457 | nmdc:mga0n895_10328_c1 | 3300050512 | Bacteria | 8237 |
| 458 | nmdc:mga0n895_105123_c1 | 3300050512 | Bacteria | 2836 |
| 459 | nmdc:mga0n895_109161_c1 | 3300050512 | Bacteria | 2782 |
| 460 | nmdc:mga0n895_249853_c1 | 3300050512 | Bacteria | 1800 |
| 461 | nmdc:mga0rr50_277887_c1 | 3300050513 | Bacteria | 1397 |
| 462 | nmdc:mga0a205_167531_c1 | 3300050515 | Bacteria | 2093 |
| 463 | Ga0495601_0023428 | 3300053077 | Bacteria | 3793 |
| 464 | Ga0495601_0029769 | 3300053077 | Bacteria | 3389 |
| 465 | Ga0495601_0075424 | 3300053077 | Bacteria | 2159 |
| 466 | Ga0500635_0000011 | 3300053080 | Bacteria | 144219 |
| 467 | Ga0500635_0012182 | 3300053080 | Bacteria | 2462 |
| 468 | Ga0495619_0007794 | 3300053085 | Bacteria | 6778 |
| 469 | Ga0500583_0000447 | 3300053092 | Bacteria | 12938 |
| 470 | Ga0500568_0005076 | 3300053139 | Bacteria | 6887 |
| 471 | Ga0500588_0007263 | 3300053146 | Bacteria | 2547 |
| 472 | Ga0500616_0065689 | 3300053153 | Bacteria | 1865 |
| 473 | Ga0500622_0020874 | 3300053156 | Bacteria | 3475 |
| 474 | Ga0500636_0001344 | 3300053177 | Bacteria | 13342 |
| 475 | Ga0500637_0017899 | 3300053178 | Bacteria | 3800 |
| 476 | Ga0501082_0206453 | 3300060353 | Bacteria | 1709 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005441 | Ga0070700_100185547 | Ga0070700_1001855471 | 336 |
| 2 | 3300038443 | Ga0395901_0100935 | Ga0395901_0100935_405_1727 | 365 |
| 3 | 3300049585 | Ga0501069_0018688 | Ga0501069_0018688_157_1467 | 366 |
| 4 | 3300049586 | Ga0501070_0007236 | Ga0501070_0007236_4455_5765 | 366 |
| 5 | 3300013308 | Ga0157375_10160800 | Ga0157375_101608002 | 367 |
| 6 | 3300025986 | Ga0207658_10110339 | Ga0207658_101103393 | 367 |
| 7 | 3300049581 | Ga0501047_0000443 | Ga0501047_0000443_11850_13157 | 368 |
| 8 | 3300009551 | Ga0105238_10000044 | Ga0105238_10000044128 | 370 |
| 9 | 3300005841 | Ga0068863_100027907 | Ga0068863_1000279075 | 371 |
| 10 | 3300005617 | Ga0068859_100103526 | Ga0068859_1001035263 | 372 |
| 11 | 3300006931 | Ga0097620_100103527 | Ga0097620_1001035273 | 372 |
| 12 | 3300005719 | Ga0068861_100012556 | Ga0068861_1000125562 | 373 |
| 13 | 3300025936 | Ga0207670_10122396 | Ga0207670_101223962 | 373 |
| 14 | 3300026118 | Ga0207675_100004461 | Ga0207675_1000044613 | 373 |
| 15 | 3300009176 | Ga0105242_10008632 | Ga0105242_100086323 | 374 |
| 16 | 3300046460 | Ga0495638_0000783 | Ga0495638_0000783_20859_22166 | 374 |
| 17 | 3300049590 | Ga0501074_0001565 | Ga0501074_0001565_794_2146 | 374 |
| 18 | 3300049742 | Ga0501080_0008896 | Ga0501080_0008896_673_2025 | 374 |
| 19 | 3300049822 | Ga0501035_0160437 | Ga0501035_0160437_371_1723 | 374 |
| 20 | 3300049823 | Ga0501044_0021521 | Ga0501044_0021521_5425_6777 | 374 |
| 21 | 3300005937 | Ga0081455_10176824 | Ga0081455_101768242 | 375 |
| 22 | 3300013306 | Ga0163162_10102623 | Ga0163162_101026231 | 375 |
| 23 | 3300005327 | Ga0070658_10136905 | Ga0070658_101369052 | 378 |
| 24 | 3300005344 | Ga0070661_100092243 | Ga0070661_1000922432 | 378 |
| 25 | 3300005564 | Ga0070664_100063115 | Ga0070664_1000631153 | 378 |
| 26 | 3300005834 | Ga0068851_10031160 | Ga0068851_100311602 | 378 |
| 27 | 3300013296 | Ga0157374_10222142 | Ga0157374_102221421 | 378 |
| 28 | 3300025944 | Ga0207661_10038991 | Ga0207661_100389912 | 378 |
| 29 | 3300025945 | Ga0207679_10055191 | Ga0207679_100551913 | 378 |
| 30 | 3300003323 | rootH1_10021045 | rootH1_100210453 | 379 |
| 31 | 3300009545 | Ga0105237_10031809 | Ga0105237_100318096 | 379 |
| 32 | 3300031507 | Ga0307509_10001087 | Ga0307509_1000108723 | 379 |
| 33 | 3300046660 | Ga0495625_0016273 | Ga0495625_0016273_1732_3039 | 380 |
| 34 | 3300009174 | Ga0105241_10000436 | Ga0105241_1000043616 | 381 |
| 35 | 3300013105 | Ga0157369_10022988 | Ga0157369_100229884 | 381 |
| 36 | 3300025911 | Ga0207654_10000604 | Ga0207654_100006043 | 381 |
| 37 | 3300046507 | Ga0495606_0007250 | Ga0495606_0007250_1329_2636 | 381 |
| 38 | 3300053080 | Ga0500635_0000011 | Ga0500635_0000011_29772_31079 | 381 |
| 39 | 3300003322 | rootL2_10049188 | rootL2_100491882 | 382 |
| 40 | 3300025303 | Ga0209051_1004999 | Ga0209051_10049996 | 382 |
| 41 | 3300048918 | Ga0496115_0100608 | Ga0496115_0100608_84_1457 | 382 |
| 42 | 3300031616 | Ga0307508_10006470 | Ga0307508_100064705 | 383 |
| 43 | 3300037312 | Ga0395899_0005425 | Ga0395899_0005425_5825_7162 | 384 |
| 44 | 3300037418 | Ga0395900_0002085 | Ga0395900_0002085_17655_18992 | 384 |
| 45 | 3300046472 | Ga0495580_0002707 | Ga0495580_0002707_9982_11304 | 384 |
| 46 | 3300046531 | Ga0495665_0081006 | Ga0495665_0081006_64_1386 | 384 |
| 47 | 3300037068 | Ga0373925_0025126 | Ga0373925_0025126_3041_4303 | 385 |
| 48 | 3300046472 | Ga0495580_0008311 | Ga0495580_0008311_4416_5678 | 385 |
| 49 | 3300046675 | Ga0495657_0146773 | Ga0495657_0146773_39_1301 | 385 |
| 50 | 3300047319 | Ga0495674_0113661 | Ga0495674_0113661_285_1547 | 385 |
| 51 | 3300005843 | Ga0068860_100071889 | Ga0068860_1000718894 | 386 |
| 52 | 3300028381 | Ga0268264_10071056 | Ga0268264_100710563 | 386 |
| 53 | 3300025231 | Ga0207427_100251 | Ga0207427_10025147 | 387 |
| 54 | 3300046506 | Ga0495583_0000149 | Ga0495583_0000149_33221_34528 | 387 |
| 55 | 3300046694 | Ga0495649_0001149 | Ga0495649_0001149_9458_10765 | 387 |
| 56 | 3300048912 | Ga0496109_0146235 | Ga0496109_0146235_980_2200 | 387 |
| 57 | 3300005354 | Ga0070675_100016640 | Ga0070675_1000166404 | 388 |
| 58 | 3300005356 | Ga0070674_100008191 | Ga0070674_1000081913 | 388 |
| 59 | 3300005364 | Ga0070673_100041396 | Ga0070673_1000413963 | 388 |
| 60 | 3300009094 | Ga0111539_10030476 | Ga0111539_100304767 | 388 |
| 61 | 3300009094 | Ga0111539_10035427 | Ga0111539_100354275 | 388 |
| 62 | 3300014326 | Ga0157380_10076921 | Ga0157380_100769212 | 388 |
| 63 | 3300025940 | Ga0207691_10008078 | Ga0207691_100080786 | 388 |
| 64 | 3300025960 | Ga0207651_10029048 | Ga0207651_100290482 | 388 |
| 65 | 3300026121 | Ga0207683_10054559 | Ga0207683_100545594 | 388 |
| 66 | 3300027907 | Ga0207428_10006505 | Ga0207428_100065055 | 388 |
| 67 | 3300031730 | Ga0307516_10012872 | Ga0307516_100128722 | 388 |
| 68 | 3300050511 | nmdc:mga08y16_17057_c1 | nmdc:mga08y16_17057_c1_2324_3580 | 388 |
| 69 | 3300050511 | nmdc:mga08y16_45345_c1 | nmdc:mga08y16_45345_c1_1728_3074 | 388 |
| 70 | 3300005353 | Ga0070669_100014669 | Ga0070669_1000146694 | 389 |
| 71 | 3300005563 | Ga0068855_100013012 | Ga0068855_1000130126 | 389 |
| 72 | 3300005844 | Ga0068862_100010286 | Ga0068862_1000102866 | 389 |
| 73 | 3300006852 | Ga0075433_10050310 | Ga0075433_100503103 | 389 |
| 74 | 3300006871 | Ga0075434_100064378 | Ga0075434_1000643783 | 389 |
| 75 | 3300007076 | Ga0075435_100012970 | Ga0075435_1000129701 | 389 |
| 76 | 3300009093 | Ga0105240_10002378 | Ga0105240_100023789 | 389 |
| 77 | 3300009094 | Ga0111539_10124653 | Ga0111539_101246533 | 389 |
| 78 | 3300025913 | Ga0207695_10001814 | Ga0207695_1000181418 | 389 |
| 79 | 3300025945 | Ga0207679_10121734 | Ga0207679_101217343 | 389 |
| 80 | 3300025949 | Ga0207667_10014977 | Ga0207667_100149774 | 389 |
| 81 | 3300025981 | Ga0207640_10001631 | Ga0207640_100016317 | 389 |
| 82 | 3300026116 | Ga0207674_10039459 | Ga0207674_100394593 | 389 |
| 83 | 3300046616 | Ga0495668_0085586 | Ga0495668_0085586_458_1717 | 389 |
| 84 | 3300050511 | nmdc:mga08y16_51591_c1 | nmdc:mga08y16_51591_c1_2689_4056 | 389 |
| 85 | 3300050512 | nmdc:mga0n895_10328_c1 | nmdc:mga0n895_10328_c1_4951_6324 | 389 |
| 86 | 3300015685 | Ga0183369_1003 | Ga0183369_100329 | 390 |
| 87 | 3300025913 | Ga0207695_10006277 | Ga0207695_100062779 | 390 |
| 88 | 3300025914 | Ga0207671_10186636 | Ga0207671_101866362 | 390 |
| 89 | 3300025961 | Ga0207712_10041534 | Ga0207712_100415342 | 390 |
| 90 | 3300005328 | Ga0070676_10001897 | Ga0070676_100018973 | 391 |
| 91 | 3300005330 | Ga0070690_100006272 | Ga0070690_1000062722 | 391 |
| 92 | 3300005354 | Ga0070675_100003000 | Ga0070675_1000030005 | 391 |
| 93 | 3300005441 | Ga0070700_100003761 | Ga0070700_1000037613 | 391 |
| 94 | 3300005459 | Ga0068867_100002149 | Ga0068867_1000021496 | 391 |
| 95 | 3300005543 | Ga0070672_100014577 | Ga0070672_1000145772 | 391 |
| 96 | 3300005617 | Ga0068859_100047764 | Ga0068859_1000477645 | 391 |
| 97 | 3300005719 | Ga0068861_100001931 | Ga0068861_1000019314 | 391 |
| 98 | 3300006881 | Ga0068865_100005131 | Ga0068865_1000051313 | 391 |
| 99 | 3300006931 | Ga0097620_100047762 | Ga0097620_1000477621 | 391 |
| 100 | 3300009148 | Ga0105243_10004854 | Ga0105243_100048543 | 391 |
| 101 | 3300009176 | Ga0105242_10001559 | Ga0105242_1000155913 | 391 |
| 102 | 3300014326 | Ga0157380_10014094 | Ga0157380_100140942 | 391 |
| 103 | 3300014745 | Ga0157377_10027960 | Ga0157377_100279602 | 391 |
| 104 | 3300025926 | Ga0207659_10049922 | Ga0207659_100499223 | 391 |
| 105 | 3300025935 | Ga0207709_10008990 | Ga0207709_100089902 | 391 |
| 106 | 3300025940 | Ga0207691_10009607 | Ga0207691_100096072 | 391 |
| 107 | 3300025942 | Ga0207689_10001673 | Ga0207689_100016736 | 391 |
| 108 | 3300025960 | Ga0207651_10003017 | Ga0207651_100030174 | 391 |
| 109 | 3300026075 | Ga0207708_10008383 | Ga0207708_100083833 | 391 |
| 110 | 3300026089 | Ga0207648_10000973 | Ga0207648_1000097316 | 391 |
| 111 | 3300026118 | Ga0207675_100003190 | Ga0207675_1000031906 | 391 |
| 112 | 3300046475 | Ga0495639_0053417 | Ga0495639_0053417_417_1763 | 391 |
| 113 | 3300005329 | Ga0070683_100020633 | Ga0070683_1000206333 | 392 |
| 114 | 3300005331 | Ga0070670_100006502 | Ga0070670_1000065023 | 392 |
| 115 | 3300005344 | Ga0070661_100018371 | Ga0070661_1000183711 | 392 |
| 116 | 3300005355 | Ga0070671_100171432 | Ga0070671_1001714322 | 392 |
| 117 | 3300005535 | Ga0070684_100030426 | Ga0070684_1000304264 | 392 |
| 118 | 3300005548 | Ga0070665_100010580 | Ga0070665_1000105807 | 392 |
| 119 | 3300009094 | Ga0111539_10047896 | Ga0111539_100478963 | 392 |
| 120 | 3300009177 | Ga0105248_10051695 | Ga0105248_100516953 | 392 |
| 121 | 3300014969 | Ga0157376_10166866 | Ga0157376_101668661 | 392 |
| 122 | 3300025920 | Ga0207649_10013683 | Ga0207649_100136833 | 392 |
| 123 | 3300025931 | Ga0207644_10163691 | Ga0207644_101636912 | 392 |
| 124 | 3300025941 | Ga0207711_10050459 | Ga0207711_100504593 | 392 |
| 125 | 3300025981 | Ga0207640_10065325 | Ga0207640_100653253 | 392 |
| 126 | 3300028379 | Ga0268266_10070181 | Ga0268266_100701814 | 392 |
| 127 | 3300046477 | Ga0495664_0036664 | Ga0495664_0036664_581_1912 | 392 |
| 128 | 3300046678 | Ga0495599_0046645 | Ga0495599_0046645_14_1339 | 392 |
| 129 | 3300048907 | Ga0496104_0055003 | Ga0496104_0055003_1621_2889 | 392 |
| 130 | 3300048911 | Ga0496108_0043312 | Ga0496108_0043312_1199_2467 | 392 |
| 131 | 3300048912 | Ga0496109_0034542 | Ga0496109_0034542_1710_2978 | 392 |
| 132 | 3300048913 | Ga0496110_0015795 | Ga0496110_0015795_4224_5492 | 392 |
| 133 | 3300048914 | Ga0496111_0013749 | Ga0496111_0013749_2206_3474 | 392 |
| 134 | 3300048915 | Ga0496112_0029356 | Ga0496112_0029356_3112_4380 | 392 |
| 135 | 3300048916 | Ga0496113_0038362 | Ga0496113_0038362_1086_2354 | 392 |
| 136 | 3300006852 | Ga0075433_10010865 | Ga0075433_100108656 | 393 |
| 137 | 3300006871 | Ga0075434_100082835 | Ga0075434_1000828354 | 393 |
| 138 | 3300028794 | Ga0307515_10159193 | Ga0307515_101591932 | 393 |
| 139 | 3300045051 | Ga0451576_0026362 | Ga0451576_0026362_4075_5388 | 393 |
| 140 | 3300048921 | Ga0496118_0082421 | Ga0496118_0082421_522_1835 | 393 |
| 141 | 3300050512 | nmdc:mga0n895_249853_c1 | nmdc:mga0n895_249853_c1_340_1668 | 393 |
| 142 | 3300050515 | nmdc:mga0a205_167531_c1 | nmdc:mga0a205_167531_c1_667_1995 | 393 |
| 143 | 3300053092 | Ga0500583_0000447 | Ga0500583_0000447_9187_10542 | 393 |
| 144 | 3300005617 | Ga0068859_100166462 | Ga0068859_1001664622 | 394 |
| 145 | 3300006931 | Ga0097620_100166480 | Ga0097620_1001664802 | 394 |
| 146 | 3300053146 | Ga0500588_0007263 | Ga0500588_0007263_559_1872 | 394 |
| 147 | 3300048917 | Ga0496114_0000064 | Ga0496114_0000064_75603_76937 | 395 |
| 148 | 3300006880 | Ga0075429_100212978 | Ga0075429_1002129781 | 396 |
| 149 | 3300021384 | Ga0213876_10017563 | Ga0213876_100175632 | 396 |
| 150 | 3300039437 | Ga0436365_1749406 | Ga0436365_1749406_3446_4849 | 396 |
| 151 | 3300005355 | Ga0070671_100009164 | Ga0070671_1000091644 | 397 |
| 152 | 3300005539 | Ga0068853_100002236 | Ga0068853_1000022362 | 397 |
| 153 | 3300025901 | Ga0207688_10047236 | Ga0207688_100472362 | 397 |
| 154 | 3300025938 | Ga0207704_10016391 | Ga0207704_100163912 | 397 |
| 155 | 3300031456 | Ga0307513_10070070 | Ga0307513_100700702 | 397 |
| 156 | 3300046460 | Ga0495638_0004874 | Ga0495638_0004874_5664_6971 | 397 |
| 157 | 3300047472 | Ga0495686_0001902 | Ga0495686_0001902_9465_10781 | 397 |
| 158 | 3300053080 | Ga0500635_0012182 | Ga0500635_0012182_385_1692 | 397 |
| 159 | 3300053177 | Ga0500636_0001344 | Ga0500636_0001344_9942_11249 | 397 |
| 160 | 3300005335 | Ga0070666_10034515 | Ga0070666_100345152 | 398 |
| 161 | 3300005842 | Ga0068858_100284182 | Ga0068858_1002841821 | 398 |
| 162 | 3300009177 | Ga0105248_10007658 | Ga0105248_100076586 | 398 |
| 163 | 3300017792 | Ga0163161_10006219 | Ga0163161_100062193 | 398 |
| 164 | 3300025272 | Ga0209455_1000151 | Ga0209455_100015190 | 398 |
| 165 | 3300028379 | Ga0268266_10065155 | Ga0268266_100651552 | 398 |
| 166 | 3300005471 | Ga0070698_100098816 | Ga0070698_1000988163 | 399 |
| 167 | 3300005518 | Ga0070699_100159859 | Ga0070699_1001598592 | 399 |
| 168 | 3300025910 | Ga0207684_10054714 | Ga0207684_100547143 | 399 |
| 169 | 3300045051 | Ga0451576_0348054 | Ga0451576_0348054_200_1504 | 399 |
| 170 | 3300048905 | Ga0496102_0123891 | Ga0496102_0123891_929_2227 | 399 |
| 171 | 3300005353 | Ga0070669_100016036 | Ga0070669_1000160363 | 400 |
| 172 | 3300005457 | Ga0070662_100002210 | Ga0070662_1000022102 | 400 |
| 173 | 3300005458 | Ga0070681_10192239 | Ga0070681_101922392 | 400 |
| 174 | 3300005618 | Ga0068864_100245596 | Ga0068864_1002455961 | 400 |
| 175 | 3300005841 | Ga0068863_100014316 | Ga0068863_1000143162 | 400 |
| 176 | 3300005844 | Ga0068862_100002215 | Ga0068862_1000022159 | 400 |
| 177 | 3300006844 | Ga0075428_100157466 | Ga0075428_1001574662 | 400 |
| 178 | 3300009553 | Ga0105249_10017449 | Ga0105249_100174492 | 400 |
| 179 | 3300025912 | Ga0207707_10160504 | Ga0207707_101605042 | 400 |
| 180 | 3300025919 | Ga0207657_10202794 | Ga0207657_102027941 | 400 |
| 181 | 3300025923 | Ga0207681_10003774 | Ga0207681_100037744 | 400 |
| 182 | 3300025924 | Ga0207694_10000109 | Ga0207694_1000010926 | 400 |
| 183 | 3300025933 | Ga0207706_10085194 | Ga0207706_100851942 | 400 |
| 184 | 3300026118 | Ga0207675_100001134 | Ga0207675_10000113414 | 400 |
| 185 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004180 | 400 |
| 186 | 3300028380 | Ga0268265_10001596 | Ga0268265_100015969 | 400 |
| 187 | 3300035241 | Ga0373961_0000787 | Ga0373961_0000787_2198_3487 | 400 |
| 188 | 3300048914 | Ga0496111_0009989 | Ga0496111_0009989_4133_5449 | 400 |
| 189 | 3300048916 | Ga0496113_0000284 | Ga0496113_0000284_4749_6062 | 400 |
| 190 | 3300050508 | nmdc:mga09592_50643_c1 | nmdc:mga09592_50643_c1_1947_3278 | 400 |
| 191 | 3300003323 | rootH1_10096388 | rootH1_100963882 | 401 |
| 192 | 3300005331 | Ga0070670_100011270 | Ga0070670_1000112703 | 401 |
| 193 | 3300005353 | Ga0070669_100126912 | Ga0070669_1001269123 | 401 |
| 194 | 3300005354 | Ga0070675_100036178 | Ga0070675_1000361782 | 401 |
| 195 | 3300005564 | Ga0070664_100024555 | Ga0070664_1000245553 | 401 |
| 196 | 3300025925 | Ga0207650_10023348 | Ga0207650_100233482 | 401 |
| 197 | 3300025940 | Ga0207691_10009281 | Ga0207691_100092812 | 401 |
| 198 | 3300046689 | Ga0495613_0028910 | Ga0495613_0028910_2132_3403 | 401 |
| 199 | 3300049742 | Ga0501080_0216173 | Ga0501080_0216173_13_1266 | 401 |
| 200 | 3300005356 | Ga0070674_100233771 | Ga0070674_1002337711 | 402 |
| 201 | 3300017792 | Ga0163161_10037241 | Ga0163161_100372413 | 402 |
| 202 | 3300026118 | Ga0207675_100070198 | Ga0207675_1000701982 | 402 |
| 203 | 3300005327 | Ga0070658_10123678 | Ga0070658_101236782 | 403 |
| 204 | 3300005328 | Ga0070676_10024325 | Ga0070676_100243253 | 403 |
| 205 | 3300005330 | Ga0070690_100000834 | Ga0070690_1000008344 | 403 |
| 206 | 3300005331 | Ga0070670_100113049 | Ga0070670_1001130491 | 403 |
| 207 | 3300005331 | Ga0070670_100138726 | Ga0070670_1001387262 | 403 |
| 208 | 3300005331 | Ga0070670_100154417 | Ga0070670_1001544172 | 403 |
| 209 | 3300005334 | Ga0068869_100031824 | Ga0068869_1000318241 | 403 |
| 210 | 3300005334 | Ga0068869_100033501 | Ga0068869_1000335012 | 403 |
| 211 | 3300005335 | Ga0070666_10000193 | Ga0070666_1000019318 | 403 |
| 212 | 3300005335 | Ga0070666_10002750 | Ga0070666_1000275012 | 403 |
| 213 | 3300005335 | Ga0070666_10007561 | Ga0070666_100075616 | 403 |
| 214 | 3300005335 | Ga0070666_10069027 | Ga0070666_100690271 | 403 |
| 215 | 3300005337 | Ga0070682_100026495 | Ga0070682_1000264953 | 403 |
| 216 | 3300005337 | Ga0070682_100081156 | Ga0070682_1000811562 | 403 |
| 217 | 3300005340 | Ga0070689_100002142 | Ga0070689_1000021423 | 403 |
| 218 | 3300005344 | Ga0070661_100101649 | Ga0070661_1001016492 | 403 |
| 219 | 3300005347 | Ga0070668_100035529 | Ga0070668_1000355291 | 403 |
| 220 | 3300005354 | Ga0070675_100020143 | Ga0070675_1000201433 | 403 |
| 221 | 3300005354 | Ga0070675_100041139 | Ga0070675_1000411392 | 403 |
| 222 | 3300005354 | Ga0070675_100044842 | Ga0070675_1000448422 | 403 |
| 223 | 3300005354 | Ga0070675_100072155 | Ga0070675_1000721552 | 403 |
| 224 | 3300005356 | Ga0070674_100038800 | Ga0070674_1000388003 | 403 |
| 225 | 3300005364 | Ga0070673_100154612 | Ga0070673_1001546122 | 403 |
| 226 | 3300005367 | Ga0070667_100016832 | Ga0070667_1000168326 | 403 |
| 227 | 3300005444 | Ga0070694_100003463 | Ga0070694_1000034633 | 403 |
| 228 | 3300005445 | Ga0070708_100000910 | Ga0070708_10000091011 | 403 |
| 229 | 3300005455 | Ga0070663_100089442 | Ga0070663_1000894422 | 403 |
| 230 | 3300005456 | Ga0070678_100070231 | Ga0070678_1000702312 | 403 |
| 231 | 3300005456 | Ga0070678_100130234 | Ga0070678_1001302341 | 403 |
| 232 | 3300005459 | Ga0068867_100039522 | Ga0068867_1000395224 | 403 |
| 233 | 3300005459 | Ga0068867_100085062 | Ga0068867_1000850622 | 403 |
| 234 | 3300005467 | Ga0070706_100004218 | Ga0070706_10000421810 | 403 |
| 235 | 3300005471 | Ga0070698_100065650 | Ga0070698_1000656503 | 403 |
| 236 | 3300005471 | Ga0070698_100094163 | Ga0070698_1000941632 | 403 |
| 237 | 3300005536 | Ga0070697_100005218 | Ga0070697_1000052189 | 403 |
| 238 | 3300005543 | Ga0070672_100017382 | Ga0070672_1000173823 | 403 |
| 239 | 3300005543 | Ga0070672_100171376 | Ga0070672_1001713762 | 403 |
| 240 | 3300005544 | Ga0070686_100032134 | Ga0070686_1000321343 | 403 |
| 241 | 3300005544 | Ga0070686_100036001 | Ga0070686_1000360012 | 403 |
| 242 | 3300005548 | Ga0070665_100013372 | Ga0070665_1000133725 | 403 |
| 243 | 3300005548 | Ga0070665_100097221 | Ga0070665_1000972213 | 403 |
| 244 | 3300005548 | Ga0070665_100139346 | Ga0070665_1001393463 | 403 |
| 245 | 3300005548 | Ga0070665_100165248 | Ga0070665_1001652482 | 403 |
| 246 | 3300005564 | Ga0070664_100110717 | Ga0070664_1001107171 | 403 |
| 247 | 3300005614 | Ga0068856_100007548 | Ga0068856_1000075482 | 403 |
| 248 | 3300005614 | Ga0068856_100091780 | Ga0068856_1000917802 | 403 |
| 249 | 3300005617 | Ga0068859_100001867 | Ga0068859_1000018673 | 403 |
| 250 | 3300005617 | Ga0068859_100033836 | Ga0068859_1000338364 | 403 |
| 251 | 3300005617 | Ga0068859_100109960 | Ga0068859_1001099602 | 403 |
| 252 | 3300005617 | Ga0068859_100209161 | Ga0068859_1002091612 | 403 |
| 253 | 3300005617 | Ga0068859_100217533 | Ga0068859_1002175332 | 403 |
| 254 | 3300005618 | Ga0068864_100060587 | Ga0068864_1000605872 | 403 |
| 255 | 3300005618 | Ga0068864_100074707 | Ga0068864_1000747073 | 403 |
| 256 | 3300005618 | Ga0068864_100136445 | Ga0068864_1001364452 | 403 |
| 257 | 3300005618 | Ga0068864_100147625 | Ga0068864_1001476252 | 403 |
| 258 | 3300005618 | Ga0068864_100226954 | Ga0068864_1002269542 | 403 |
| 259 | 3300005718 | Ga0068866_10037680 | Ga0068866_100376802 | 403 |
| 260 | 3300005719 | Ga0068861_100172315 | Ga0068861_1001723152 | 403 |
| 261 | 3300005841 | Ga0068863_100009364 | Ga0068863_1000093643 | 403 |
| 262 | 3300005841 | Ga0068863_100016748 | Ga0068863_1000167482 | 403 |
| 263 | 3300005842 | Ga0068858_100001137 | Ga0068858_10000113729 | 403 |
| 264 | 3300005843 | Ga0068860_100009086 | Ga0068860_1000090868 | 403 |
| 265 | 3300005843 | Ga0068860_100089427 | Ga0068860_1000894273 | 403 |
| 266 | 3300005843 | Ga0068860_100139827 | Ga0068860_1001398272 | 403 |
| 267 | 3300005843 | Ga0068860_100176554 | Ga0068860_1001765542 | 403 |
| 268 | 3300005985 | Ga0081539_10002981 | Ga0081539_100029814 | 403 |
| 269 | 3300006051 | Ga0075364_10022681 | Ga0075364_100226813 | 403 |
| 270 | 3300006237 | Ga0097621_100000341 | Ga0097621_10000034111 | 403 |
| 271 | 3300006358 | Ga0068871_100000340 | Ga0068871_10000034021 | 403 |
| 272 | 3300006844 | Ga0075428_100009361 | Ga0075428_1000093614 | 403 |
| 273 | 3300006847 | Ga0075431_100000953 | Ga0075431_10000095325 | 403 |
| 274 | 3300006871 | Ga0075434_100132465 | Ga0075434_1001324651 | 403 |
| 275 | 3300006880 | Ga0075429_100049672 | Ga0075429_1000496722 | 403 |
| 276 | 3300006881 | Ga0068865_100115834 | Ga0068865_1001158342 | 403 |
| 277 | 3300006931 | Ga0097620_100001867 | Ga0097620_10000186719 | 403 |
| 278 | 3300006931 | Ga0097620_100033837 | Ga0097620_1000338372 | 403 |
| 279 | 3300006931 | Ga0097620_100109957 | Ga0097620_1001099572 | 403 |
| 280 | 3300006931 | Ga0097620_100209161 | Ga0097620_1002091612 | 403 |
| 281 | 3300006931 | Ga0097620_100217534 | Ga0097620_1002175342 | 403 |
| 282 | 3300007076 | Ga0075435_100225529 | Ga0075435_1002255292 | 403 |
| 283 | 3300009094 | Ga0111539_10011257 | Ga0111539_100112577 | 403 |
| 284 | 3300009094 | Ga0111539_10012494 | Ga0111539_100124948 | 403 |
| 285 | 3300009094 | Ga0111539_10193743 | Ga0111539_101937432 | 403 |
| 286 | 3300009101 | Ga0105247_10000536 | Ga0105247_1000053632 | 403 |
| 287 | 3300009147 | Ga0114129_10047631 | Ga0114129_100476313 | 403 |
| 288 | 3300009148 | Ga0105243_10000027 | Ga0105243_1000002731 | 403 |
| 289 | 3300009148 | Ga0105243_10026660 | Ga0105243_100266603 | 403 |
| 290 | 3300009176 | Ga0105242_10000056 | Ga0105242_1000005633 | 403 |
| 291 | 3300009176 | Ga0105242_10019209 | Ga0105242_100192092 | 403 |
| 292 | 3300009177 | Ga0105248_10001767 | Ga0105248_1000176719 | 403 |
| 293 | 3300009551 | Ga0105238_10104209 | Ga0105238_101042091 | 403 |
| 294 | 3300010375 | Ga0105239_10092011 | Ga0105239_100920113 | 403 |
| 295 | 3300010375 | Ga0105239_10247816 | Ga0105239_102478161 | 403 |
| 296 | 3300011119 | Ga0105246_10062594 | Ga0105246_100625943 | 403 |
| 297 | 3300013100 | Ga0157373_10081491 | Ga0157373_100814912 | 403 |
| 298 | 3300013297 | Ga0157378_10026566 | Ga0157378_100265663 | 403 |
| 299 | 3300013308 | Ga0157375_10003297 | Ga0157375_100032972 | 403 |
| 300 | 3300013308 | Ga0157375_10034015 | Ga0157375_100340152 | 403 |
| 301 | 3300013308 | Ga0157375_10081078 | Ga0157375_100810782 | 403 |
| 302 | 3300014325 | Ga0163163_10118360 | Ga0163163_101183603 | 403 |
| 303 | 3300014326 | Ga0157380_10022220 | Ga0157380_100222205 | 403 |
| 304 | 3300014968 | Ga0157379_10103279 | Ga0157379_101032792 | 403 |
| 305 | 3300014969 | Ga0157376_10002143 | Ga0157376_100021438 | 403 |
| 306 | 3300025893 | Ga0207682_10004090 | Ga0207682_100040901 | 403 |
| 307 | 3300025899 | Ga0207642_10011050 | Ga0207642_100110502 | 403 |
| 308 | 3300025900 | Ga0207710_10000212 | Ga0207710_100002126 | 403 |
| 309 | 3300025903 | Ga0207680_10042657 | Ga0207680_100426573 | 403 |
| 310 | 3300025904 | Ga0207647_10041567 | Ga0207647_100415673 | 403 |
| 311 | 3300025907 | Ga0207645_10005982 | Ga0207645_100059823 | 403 |
| 312 | 3300025907 | Ga0207645_10034632 | Ga0207645_100346323 | 403 |
| 313 | 3300025908 | Ga0207643_10033243 | Ga0207643_100332434 | 403 |
| 314 | 3300025908 | Ga0207643_10034714 | Ga0207643_100347142 | 403 |
| 315 | 3300025910 | Ga0207684_10009547 | Ga0207684_100095472 | 403 |
| 316 | 3300025912 | Ga0207707_10079691 | Ga0207707_100796913 | 403 |
| 317 | 3300025915 | Ga0207693_10135545 | Ga0207693_101355452 | 403 |
| 318 | 3300025915 | Ga0207693_10227210 | Ga0207693_102272101 | 403 |
| 319 | 3300025918 | Ga0207662_10008551 | Ga0207662_100085513 | 403 |
| 320 | 3300025925 | Ga0207650_10062156 | Ga0207650_100621562 | 403 |
| 321 | 3300025926 | Ga0207659_10007853 | Ga0207659_100078535 | 403 |
| 322 | 3300025926 | Ga0207659_10034596 | Ga0207659_100345962 | 403 |
| 323 | 3300025932 | Ga0207690_10000285 | Ga0207690_1000028525 | 403 |
| 324 | 3300025932 | Ga0207690_10006534 | Ga0207690_100065342 | 403 |
| 325 | 3300025933 | Ga0207706_10019662 | Ga0207706_100196624 | 403 |
| 326 | 3300025933 | Ga0207706_10021575 | Ga0207706_100215752 | 403 |
| 327 | 3300025934 | Ga0207686_10000008 | Ga0207686_1000000831 | 403 |
| 328 | 3300025935 | Ga0207709_10000025 | Ga0207709_10000025113 | 403 |
| 329 | 3300025935 | Ga0207709_10060507 | Ga0207709_100605071 | 403 |
| 330 | 3300025936 | Ga0207670_10049975 | Ga0207670_100499752 | 403 |
| 331 | 3300025936 | Ga0207670_10158529 | Ga0207670_101585292 | 403 |
| 332 | 3300025940 | Ga0207691_10033968 | Ga0207691_100339683 | 403 |
| 333 | 3300025940 | Ga0207691_10048351 | Ga0207691_100483512 | 403 |
| 334 | 3300025941 | Ga0207711_10156128 | Ga0207711_101561282 | 403 |
| 335 | 3300025942 | Ga0207689_10093223 | Ga0207689_100932232 | 403 |
| 336 | 3300025949 | Ga0207667_10054538 | Ga0207667_100545381 | 403 |
| 337 | 3300025960 | Ga0207651_10082766 | Ga0207651_100827662 | 403 |
| 338 | 3300025972 | Ga0207668_10146301 | Ga0207668_101463012 | 403 |
| 339 | 3300025986 | Ga0207658_10001950 | Ga0207658_1000195017 | 403 |
| 340 | 3300025986 | Ga0207658_10042978 | Ga0207658_100429784 | 403 |
| 341 | 3300025986 | Ga0207658_10073339 | Ga0207658_100733392 | 403 |
| 342 | 3300026035 | Ga0207703_10103256 | Ga0207703_101032562 | 403 |
| 343 | 3300026067 | Ga0207678_10088781 | Ga0207678_100887812 | 403 |
| 344 | 3300026088 | Ga0207641_10015006 | Ga0207641_100150064 | 403 |
| 345 | 3300026088 | Ga0207641_10029705 | Ga0207641_100297053 | 403 |
| 346 | 3300026089 | Ga0207648_10025223 | Ga0207648_100252234 | 403 |
| 347 | 3300026089 | Ga0207648_10161616 | Ga0207648_101616162 | 403 |
| 348 | 3300026095 | Ga0207676_10024024 | Ga0207676_100240244 | 403 |
| 349 | 3300026095 | Ga0207676_10062583 | Ga0207676_100625833 | 403 |
| 350 | 3300026095 | Ga0207676_10080407 | Ga0207676_100804072 | 403 |
| 351 | 3300026095 | Ga0207676_10188342 | Ga0207676_101883422 | 403 |
| 352 | 3300026116 | Ga0207674_10128453 | Ga0207674_101284533 | 403 |
| 353 | 3300026116 | Ga0207674_10139849 | Ga0207674_101398492 | 403 |
| 354 | 3300026118 | Ga0207675_100052985 | Ga0207675_1000529853 | 403 |
| 355 | 3300026121 | Ga0207683_10056723 | Ga0207683_100567232 | 403 |
| 356 | 3300027907 | Ga0207428_10032544 | Ga0207428_100325443 | 403 |
| 357 | 3300027907 | Ga0207428_10076265 | Ga0207428_100762653 | 403 |
| 358 | 3300028381 | Ga0268264_10119343 | Ga0268264_101193432 | 403 |
| 359 | 3300028381 | Ga0268264_10195996 | Ga0268264_101959961 | 403 |
| 360 | 3300031456 | Ga0307513_10008910 | Ga0307513_100089103 | 403 |
| 361 | 3300031456 | Ga0307513_10124642 | Ga0307513_101246422 | 403 |
| 362 | 3300031507 | Ga0307509_10038884 | Ga0307509_100388845 | 403 |
| 363 | 3300031616 | Ga0307508_10026468 | Ga0307508_100264682 | 403 |
| 364 | 3300031901 | Ga0307406_10095122 | Ga0307406_100951222 | 403 |
| 365 | 3300036401 | Ga0373937_0035783 | Ga0373937_0035783_2813_4192 | 403 |
| 366 | 3300038443 | Ga0395901_0000604 | Ga0395901_0000604_15632_16954 | 403 |
| 367 | 3300042876 | Ga0451577_0022660 | Ga0451577_0022660_3251_4582 | 403 |
| 368 | 3300044712 | Ga0453684_0080848 | Ga0453684_0080848_2127_3458 | 403 |
| 369 | 3300046460 | Ga0495638_0009044 | Ga0495638_0009044_1761_3077 | 403 |
| 370 | 3300046473 | Ga0495582_0015610 | Ga0495582_0015610_1107_2486 | 403 |
| 371 | 3300046473 | Ga0495582_0027993 | Ga0495582_0027993_663_2015 | 403 |
| 372 | 3300046557 | Ga0495622_0032975 | Ga0495622_0032975_718_2031 | 403 |
| 373 | 3300046615 | Ga0495656_0075157 | Ga0495656_0075157_56_1405 | 403 |
| 374 | 3300046683 | Ga0495658_0078192 | Ga0495658_0078192_354_1688 | 403 |
| 375 | 3300046809 | Ga0495600_0096360 | Ga0495600_0096360_36_1346 | 403 |
| 376 | 3300047317 | Ga0495604_0021923 | Ga0495604_0021923_1088_2410 | 403 |
| 377 | 3300047318 | Ga0495636_0024179 | Ga0495636_0024179_225_1562 | 403 |
| 378 | 3300047319 | Ga0495674_0039335 | Ga0495674_0039335_1519_2841 | 403 |
| 379 | 3300047472 | Ga0495686_0000946 | Ga0495686_0000946_16796_18094 | 403 |
| 380 | 3300048904 | Ga0496101_0167343 | Ga0496101_0167343_245_1621 | 403 |
| 381 | 3300048907 | Ga0496104_0010105 | Ga0496104_0010105_5514_6857 | 403 |
| 382 | 3300048907 | Ga0496104_0053242 | Ga0496104_0053242_944_2200 | 403 |
| 383 | 3300048907 | Ga0496104_0144011 | Ga0496104_0144011_679_2004 | 403 |
| 384 | 3300048907 | Ga0496104_0244461 | Ga0496104_0244461_60_1436 | 403 |
| 385 | 3300048909 | Ga0496106_0002225 | Ga0496106_0002225_750_2126 | 403 |
| 386 | 3300048910 | Ga0496107_0008832 | Ga0496107_0008832_74_1450 | 403 |
| 387 | 3300048910 | Ga0496107_0174424 | Ga0496107_0174424_141_1451 | 403 |
| 388 | 3300048911 | Ga0496108_0017834 | Ga0496108_0017834_432_1688 | 403 |
| 389 | 3300048911 | Ga0496108_0029664 | Ga0496108_0029664_140_1516 | 403 |
| 390 | 3300048912 | Ga0496109_0000397 | Ga0496109_0000397_34208_35548 | 403 |
| 391 | 3300048912 | Ga0496109_0021919 | Ga0496109_0021919_788_2044 | 403 |
| 392 | 3300048913 | Ga0496110_0120299 | Ga0496110_0120299_24_1280 | 403 |
| 393 | 3300048913 | Ga0496110_0166949 | Ga0496110_0166949_540_1916 | 403 |
| 394 | 3300048913 | Ga0496110_0241307 | Ga0496110_0241307_110_1417 | 403 |
| 395 | 3300048914 | Ga0496111_0150980 | Ga0496111_0150980_191_1447 | 403 |
| 396 | 3300048915 | Ga0496112_0007198 | Ga0496112_0007198_1790_3046 | 403 |
| 397 | 3300048915 | Ga0496112_0038969 | Ga0496112_0038969_2290_3642 | 403 |
| 398 | 3300048916 | Ga0496113_0056408 | Ga0496113_0056408_1599_2855 | 403 |
| 399 | 3300048917 | Ga0496114_0000550 | Ga0496114_0000550_7149_8441 | 403 |
| 400 | 3300048917 | Ga0496114_0305663 | Ga0496114_0305663_44_1351 | 403 |
| 401 | 3300048924 | Ga0496121_0001659 | Ga0496121_0001659_16839_18191 | 403 |
| 402 | 3300048928 | Ga0496125_0031533 | Ga0496125_0031533_3351_4703 | 403 |
| 403 | 3300049586 | Ga0501070_0021035 | Ga0501070_0021035_22_1335 | 403 |
| 404 | 3300049587 | Ga0501071_0055916 | Ga0501071_0055916_1401_2714 | 403 |
| 405 | 3300049823 | Ga0501044_0188823 | Ga0501044_0188823_385_1698 | 403 |
| 406 | 3300050507 | nmdc:mga05p37_10270_c1 | nmdc:mga05p37_10270_c1_3997_5304 | 403 |
| 407 | 3300050507 | nmdc:mga05p37_65248_c2 | nmdc:mga05p37_65248_c2_491_1831 | 403 |
| 408 | 3300050508 | nmdc:mga09592_46066_c1 | nmdc:mga09592_46066_c1_1027_2334 | 403 |
| 409 | 3300050510 | nmdc:mga06r32_2052_c1 | nmdc:mga06r32_2052_c1_4918_6225 | 403 |
| 410 | 3300050510 | nmdc:mga06r32_27220_c1 | nmdc:mga06r32_27220_c1_2642_3982 | 403 |
| 411 | 3300050511 | nmdc:mga08y16_19632_c1 | nmdc:mga08y16_19632_c1_4138_5463 | 403 |
| 412 | 3300050511 | nmdc:mga08y16_22652_c1 | nmdc:mga08y16_22652_c1_2397_3695 | 403 |
| 413 | 3300050512 | nmdc:mga0n895_105123_c1 | nmdc:mga0n895_105123_c1_478_1818 | 403 |
| 414 | 3300050512 | nmdc:mga0n895_109161_c1 | nmdc:mga0n895_109161_c1_207_1577 | 403 |
| 415 | 3300050513 | nmdc:mga0rr50_277887_c1 | nmdc:mga0rr50_277887_c1_40_1377 | 403 |
| 416 | 3300053077 | Ga0495601_0023428 | Ga0495601_0023428_1092_2423 | 403 |
| 417 | 3300053077 | Ga0495601_0029769 | Ga0495601_0029769_376_1710 | 403 |
| 418 | 3300053077 | Ga0495601_0075424 | Ga0495601_0075424_652_1956 | 403 |
| 419 | 3300053085 | Ga0495619_0007794 | Ga0495619_0007794_2025_3329 | 403 |
| 420 | 3300053139 | Ga0500568_0005076 | Ga0500568_0005076_5047_6303 | 403 |
| 421 | 3300053153 | Ga0500616_0065689 | Ga0500616_0065689_273_1562 | 403 |
| 422 | 3300053156 | Ga0500622_0020874 | Ga0500622_0020874_782_2176 | 403 |
| 423 | 3300060353 | Ga0501082_0206453 | Ga0501082_0206453_176_1516 | 403 |
| 424 | 3300005330 | Ga0070690_100021025 | Ga0070690_1000210253 | 404 |
| 425 | 3300005334 | Ga0068869_100064706 | Ga0068869_1000647062 | 404 |
| 426 | 3300005367 | Ga0070667_100047243 | Ga0070667_1000472432 | 404 |
| 427 | 3300005544 | Ga0070686_100002579 | Ga0070686_1000025799 | 404 |
| 428 | 3300005548 | Ga0070665_100107039 | Ga0070665_1001070392 | 404 |
| 429 | 3300005564 | Ga0070664_100006087 | Ga0070664_1000060877 | 404 |
| 430 | 3300005617 | Ga0068859_100066772 | Ga0068859_1000667722 | 404 |
| 431 | 3300005617 | Ga0068859_100103335 | Ga0068859_1001033353 | 404 |
| 432 | 3300005840 | Ga0068870_10001259 | Ga0068870_1000125912 | 404 |
| 433 | 3300006931 | Ga0097620_100066769 | Ga0097620_1000667692 | 404 |
| 434 | 3300006931 | Ga0097620_100103322 | Ga0097620_1001033222 | 404 |
| 435 | 3300009094 | Ga0111539_10050704 | Ga0111539_100507043 | 404 |
| 436 | 3300025907 | Ga0207645_10013082 | Ga0207645_1001308210 | 404 |
| 437 | 3300025908 | Ga0207643_10000629 | Ga0207643_1000062910 | 404 |
| 438 | 3300025926 | Ga0207659_10001820 | Ga0207659_1000182011 | 404 |
| 439 | 3300025940 | Ga0207691_10064511 | Ga0207691_100645113 | 404 |
| 440 | 3300025941 | Ga0207711_10040534 | Ga0207711_100405343 | 404 |
| 441 | 3300025942 | Ga0207689_10070618 | Ga0207689_100706182 | 404 |
| 442 | 3300025945 | Ga0207679_10002837 | Ga0207679_100028376 | 404 |
| 443 | 3300025960 | Ga0207651_10010900 | Ga0207651_100109007 | 404 |
| 444 | 3300026089 | Ga0207648_10095090 | Ga0207648_100950902 | 404 |
| 445 | 3300026121 | Ga0207683_10062019 | Ga0207683_100620192 | 404 |
| 446 | 3300027907 | Ga0207428_10039155 | Ga0207428_100391551 | 404 |
| 447 | 3300050511 | nmdc:mga08y16_54337_c1 | nmdc:mga08y16_54337_c1_2725_4113 | 404 |
| 448 | iso_pu_bacteria | 2537561836 | 2538834715 | 404 |
| 449 | iso_pu_bacteria | 2643221562 | 2643830959 | 404 |
| 450 | 3300005530 | Ga0070679_100098463 | Ga0070679_1000984633 | 405 |
| 451 | 3300009093 | Ga0105240_10001400 | Ga0105240_1000140028 | 405 |
| 452 | 3300025913 | Ga0207695_10000943 | Ga0207695_1000094322 | 405 |
| 453 | 3300046491 | Ga0495584_0061669 | Ga0495584_0061669_48_1406 | 405 |
| 454 | 3300048917 | Ga0496114_0204193 | Ga0496114_0204193_336_1601 | 405 |
| 455 | 3300048918 | Ga0496115_0000354 | Ga0496115_0000354_36652_37917 | 405 |
| 456 | 3300049586 | Ga0501070_0104110 | Ga0501070_0104110_592_1920 | 405 |
| 457 | 3300049593 | Ga0501077_0004900 | Ga0501077_0004900_4863_6191 | 405 |
| 458 | 3300005467 | Ga0070706_100008230 | Ga0070706_1000082308 | 406 |
| 459 | 3300005578 | Ga0068854_100021063 | Ga0068854_1000210632 | 406 |
| 460 | 3300005614 | Ga0068856_100000086 | Ga0068856_1000000864 | 406 |
| 461 | 3300006358 | Ga0068871_100029051 | Ga0068871_1000290514 | 406 |
| 462 | 3300009545 | Ga0105237_10000070 | Ga0105237_1000007063 | 406 |
| 463 | 3300009551 | Ga0105238_10000736 | Ga0105238_1000073630 | 406 |
| 464 | 3300014969 | Ga0157376_10007517 | Ga0157376_100075174 | 406 |
| 465 | 3300025250 | Ga0209026_1000378 | Ga0209026_10003786 | 406 |
| 466 | 3300025256 | Ga0209759_1021271 | Ga0209759_10212711 | 406 |
| 467 | 3300025256 | Ga0209759_1021272 | Ga0209759_10212721 | 406 |
| 468 | 3300025914 | Ga0207671_10000429 | Ga0207671_1000042960 | 406 |
| 469 | 3300025924 | Ga0207694_10006182 | Ga0207694_100061828 | 406 |
| 470 | 3300026067 | Ga0207678_10038003 | Ga0207678_100380034 | 406 |
| 471 | 3300026078 | Ga0207702_10000160 | Ga0207702_1000016017 | 406 |
| 472 | 3300053178 | Ga0500637_0017899 | Ga0500637_0017899_1370_2719 | 406 |
| 473 | 3300005327 | Ga0070658_10004926 | Ga0070658_100049264 | 411 |
| 474 | 3300005548 | Ga0070665_100014505 | Ga0070665_1000145056 | 411 |
| 475 | 3300025909 | Ga0207705_10001527 | Ga0207705_1000152710 | 411 |
| 476 | 3300005335 | Ga0070666_10000010 | Ga0070666_10000010217 | 416 |
| 477 | 3300028380 | Ga0268265_10112366 | Ga0268265_101123661 | 428 |
| 478 | 3300003320 | rootH2_10274347 | rootH2_102743471 | 438 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nzg-assembly1.cif.gz_B | bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine | 0.7266 | 39 | 202 |
| 6d50-assembly1.cif.gz_B | bacteroides uniforms beta-glucuronidase 2 bound to d-glucaro-1,5-lactone | 0.7242 | 39 | 202 |
| 5uj6-assembly1.cif.gz_A | crystal structure of bacteroides uniformis beta-glucuronidase | 0.7213 | 39 | 202 |
| 8dhl-assembly1.cif.gz_A | tannerella forsythia beta-glucuronidase (l2) | 0.7178 | 39 | 200 |
| 6d8g-assembly1.cif.gz_B | d341a d367a calcium binding mutant of bacteroides uniformis beta-glucuronidase 2 | 0.7045 | 39 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5t99B01 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.7548 | 39 | 202 | 2.60.120.260 |
| 5uj6B01 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.7218 | 39 | 200 | 2.60.120.260 |
| 5t99B01 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.7135 | 39 | 202 | 2.60.120.260 |
| af_Q54MB2_1_312_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.708 | 220 | 424 | 1.20.1070.10 |
| 6ed1D01 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.7014 | 38 | 203 | 2.60.120.260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328P713-F1-model_v4 | Glycoside hydrolase | 0.9381 | 42 | 436 |
GO:0016020
|
| AF-A0A3S0RF82-F1-model_v4 | Glycoside hydrolase | 0.9287 | 35 | 430 |
GO:0016020
GO:0016787 |
| AF-A0A525JGG7-F1-model_v4 | Glycoside hydrolase | 0.9205 | 38 | 429 |
GO:0016020
GO:0016787 |
| AF-A0A2T5LFH6-F1-model_v4 | Uncharacterized protein | 0.9197 | 201 | 434 |
GO:0016020
|
| AF-A0A1V3PP40-F1-model_v4 | Beta-galactosidase | 0.9178 | 39 | 200 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar