F451852

General Info

Members Datasets Scaffolds Average Seq Length
478 235 476 436

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100065650|Ga0070698_1000656503
Length 490
Sequence MGMGTSFWEDLRADELQKAESEFSESWSHPRHAGQGCQGTLLMPKSISSTVTSIDATQRKLIIGIVIATVMALAIAIADLASGGRPDPPTLRAAATLLDGAWRFHTGDDPRWADANTQDNGWETIDLTAVPGSHDGDVGLPDYVGGWMAHGHPGYHGYAWYRRAVTVPAGRASWDILGPTLVEDGYELYWNGQRLGGSGRLGPAPRVVGTRPMRFALPTDAAGTTGVLAVRAYMRPSSGVSADGGGMHSAPILAPRPISDKLHRVQWERTVAGYIVDVIEPIAMLALIGLAFGCRSGSSHKGFLIFASIALALTAARRLNNAITAWTDLMDLATYAWLASVMWVPVVAAWTLAWNRWCLRSWRSIDVAAVVLAVAGIIGALIHSASVTSGSRLGSIALFVVVGARIVRSGPMRILALVTLASIVAGLFGGELLDPLGVPGIWFPFGIGVSRTQYVYAIVTPLLAFLIVRTLLFKENASIERRRSVVPIAT

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
234 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 0
Rhizoplane 7.53
Rhizosphere 84.73
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10274347 3300003320 Bacteria 2080
2 rootL2_10049188 3300003322 Bacteria 3595
3 rootH1_10021045 3300003323 Unclassified 2798
4 rootH1_10096388 3300003323 Bacteria 3780
5 Ga0070658_10004926 3300005327 Bacteria 10881
6 Ga0070658_10123678 3300005327 Bacteria 2151
7 Ga0070658_10136905 3300005327 Bacteria 2044
8 Ga0070676_10001897 3300005328 Bacteria 10624
9 Ga0070676_10024325 3300005328 Bacteria 3411
10 Ga0070683_100020633 3300005329 Bacteria 5865
11 Ga0070690_100000834 3300005330 Bacteria 15640
12 Ga0070690_100006272 3300005330 Bacteria 6744
13 Ga0070690_100021025 3300005330 Bacteria 3981
14 Ga0070670_100006502 3300005331 Bacteria 9894
15 Ga0070670_100011270 3300005331 Bacteria 7644
16 Ga0070670_100113049 3300005331 Bacteria 2340
17 Ga0070670_100138726 3300005331 Bacteria 2102
18 Ga0070670_100154417 3300005331 Bacteria 1987
19 Ga0068869_100031824 3300005334 Bacteria 3713
20 Ga0068869_100033501 3300005334 Bacteria 3627
21 Ga0068869_100064706 3300005334 Bacteria 2690
22 Ga0070666_10000010 3300005335 Bacteria 264789
23 Ga0070666_10000193 3300005335 Bacteria 41355
24 Ga0070666_10002750 3300005335 Bacteria 10624
25 Ga0070666_10007561 3300005335 Bacteria 6701
26 Ga0070666_10034515 3300005335 Bacteria 3352
27 Ga0070666_10069027 3300005335 Bacteria 2402
28 Ga0070682_100026495 3300005337 Bacteria 3471
29 Ga0070682_100081156 3300005337 Bacteria 2099
30 Ga0070689_100002142 3300005340 Bacteria 12806
31 Ga0070661_100018371 3300005344 Bacteria 4971
32 Ga0070661_100092243 3300005344 Bacteria 2244
33 Ga0070661_100101649 3300005344 Unclassified 2139
34 Ga0070668_100035529 3300005347 Bacteria 3800
35 Ga0070669_100014669 3300005353 Bacteria 5578
36 Ga0070669_100016036 3300005353 Bacteria 5346
37 Ga0070669_100126912 3300005353 Bacteria 1953
38 Ga0070675_100003000 3300005354 Bacteria 12737
39 Ga0070675_100016640 3300005354 Bacteria 5838
40 Ga0070675_100020143 3300005354 Bacteria 5322
41 Ga0070675_100036178 3300005354 Bacteria 4015
42 Ga0070675_100041139 3300005354 Bacteria 3775
43 Ga0070675_100044842 3300005354 Bacteria 3616
44 Ga0070675_100072155 3300005354 Bacteria 2866
45 Ga0070671_100009164 3300005355 Bacteria 7946
46 Ga0070671_100171432 3300005355 Bacteria 1835
47 Ga0070674_100008191 3300005356 Bacteria 6207
48 Ga0070674_100038800 3300005356 Bacteria 3212
49 Ga0070674_100233771 3300005356 Bacteria 1436
50 Ga0070673_100041396 3300005364 Bacteria 3543
51 Ga0070673_100154612 3300005364 Bacteria 1946
52 Ga0070667_100016832 3300005367 Bacteria 6050
53 Ga0070667_100047243 3300005367 Bacteria 3622
54 Ga0070700_100003761 3300005441 Bacteria 7857
55 Ga0070700_100185547 3300005441 Bacteria 1451
56 Ga0070694_100003463 3300005444 Bacteria 9452
57 Ga0070708_100000910 3300005445 Bacteria 22396
58 Ga0070663_100089442 3300005455 Bacteria 2279
59 Ga0070678_100070231 3300005456 Bacteria 2617
60 Ga0070678_100130234 3300005456 Bacteria 1997
61 Ga0070662_100002210 3300005457 Bacteria 11942
62 Ga0070681_10192239 3300005458 Bacteria 1960
63 Ga0068867_100002149 3300005459 Bacteria 13830
64 Ga0068867_100039522 3300005459 Bacteria 3440
65 Ga0068867_100085062 3300005459 Bacteria 2391
66 Ga0070706_100004218 3300005467 Bacteria 13949
67 Ga0070706_100008230 3300005467 Bacteria 9726
68 Ga0070698_100065650 3300005471 Bacteria 3653
69 Ga0070698_100094163 3300005471 Bacteria 2974
70 Ga0070698_100098816 3300005471 Bacteria 2892
71 Ga0070699_100159859 3300005518 Bacteria 1994
72 Ga0070679_100098463 3300005530 Unclassified 2912
73 Ga0070684_100030426 3300005535 Bacteria 4586
74 Ga0070697_100005218 3300005536 Bacteria 9980
75 Ga0068853_100002236 3300005539 Bacteria 14458
76 Ga0070672_100014577 3300005543 Bacteria 5574
77 Ga0070672_100017382 3300005543 Bacteria 5175
78 Ga0070672_100171376 3300005543 Bacteria 1805
79 Ga0070686_100002579 3300005544 Bacteria 9997
80 Ga0070686_100032134 3300005544 Bacteria 3215
81 Ga0070686_100036001 3300005544 Bacteria 3061
82 Ga0070665_100010580 3300005548 Bacteria 9339
83 Ga0070665_100013372 3300005548 Bacteria 8260
84 Ga0070665_100014505 3300005548 Bacteria 7904
85 Ga0070665_100097221 3300005548 Bacteria 2949
86 Ga0070665_100107039 3300005548 Bacteria 2798
87 Ga0070665_100139346 3300005548 Bacteria 2429
88 Ga0070665_100165248 3300005548 Bacteria 2215
89 Ga0068855_100013012 3300005563 Bacteria 10040
90 Ga0070664_100006087 3300005564 Bacteria 9753
91 Ga0070664_100024555 3300005564 Bacteria 4986
92 Ga0070664_100063115 3300005564 Bacteria 3159
93 Ga0070664_100110717 3300005564 Unclassified 2396
94 Ga0068854_100021063 3300005578 Bacteria 4420
95 Ga0068856_100000086 3300005614 Bacteria 87570
96 Ga0068856_100007548 3300005614 Bacteria 10610
97 Ga0068856_100091780 3300005614 Bacteria 3021
98 Ga0068859_100001867 3300005617 Bacteria 21439
99 Ga0068859_100033836 3300005617 Bacteria 5131
100 Ga0068859_100047764 3300005617 Bacteria 4301
101 Ga0068859_100066772 3300005617 Bacteria 3632
102 Ga0068859_100103335 3300005617 Bacteria 2907
103 Ga0068859_100103526 3300005617 Bacteria 2905
104 Ga0068859_100109960 3300005617 Bacteria 2818
105 Ga0068859_100166462 3300005617 Bacteria 2284
106 Ga0068859_100209161 3300005617 Bacteria 2037
107 Ga0068859_100217533 3300005617 Bacteria 1998
108 Ga0068864_100060587 3300005618 Bacteria 3277
109 Ga0068864_100074707 3300005618 Bacteria 2958
110 Ga0068864_100136445 3300005618 Bacteria 2209
111 Ga0068864_100147625 3300005618 Bacteria 2127
112 Ga0068864_100226954 3300005618 Bacteria 1725
113 Ga0068864_100245596 3300005618 Bacteria 1660
114 Ga0068866_10037680 3300005718 Bacteria 2376
115 Ga0068861_100001931 3300005719 Bacteria 13351
116 Ga0068861_100012556 3300005719 Bacteria 5909
117 Ga0068861_100172315 3300005719 Bacteria 1794
118 Ga0068851_10031160 3300005834 Bacteria 2647
119 Ga0068870_10001259 3300005840 Bacteria 10159
120 Ga0068863_100009364 3300005841 Bacteria 9557
121 Ga0068863_100014316 3300005841 Bacteria 7641
122 Ga0068863_100016748 3300005841 Bacteria 7032
123 Ga0068863_100027907 3300005841 Bacteria 5388
124 Ga0068858_100001137 3300005842 Bacteria 27530
125 Ga0068858_100284182 3300005842 Bacteria 1576
126 Ga0068860_100009086 3300005843 Bacteria 9889
127 Ga0068860_100071889 3300005843 Bacteria 3287
128 Ga0068860_100089427 3300005843 Bacteria 2932
129 Ga0068860_100139827 3300005843 Bacteria 2326
130 Ga0068860_100176554 3300005843 Bacteria 2064
131 Ga0068862_100002215 3300005844 Bacteria 17418
132 Ga0068862_100010286 3300005844 Bacteria 7719
133 Ga0081455_10176824 3300005937 Bacteria 1620
134 Ga0081539_10002981 3300005985 Bacteria 22205
135 Ga0075364_10022681 3300006051 Bacteria 3968
136 Ga0097621_100000341 3300006237 Bacteria 31966
137 Ga0068871_100000340 3300006358 Bacteria 32379
138 Ga0068871_100029051 3300006358 Unclassified 4341
139 Ga0075428_100009361 3300006844 Bacteria 10868
140 Ga0075428_100157466 3300006844 Bacteria 2466
141 Ga0075431_100000953 3300006847 Bacteria 25591
142 Ga0075433_10010865 3300006852 Bacteria 7320
143 Ga0075433_10050310 3300006852 Bacteria 3627
144 Ga0075434_100064378 3300006871 Bacteria 3650
145 Ga0075434_100082835 3300006871 Bacteria 3205
146 Ga0075434_100132465 3300006871 Bacteria 2512
147 Ga0075429_100049672 3300006880 Bacteria 3648
148 Ga0075429_100212978 3300006880 Bacteria 1692
149 Ga0068865_100005131 3300006881 Bacteria 7928
150 Ga0068865_100115834 3300006881 Bacteria 1984
151 Ga0097620_100001867 3300006931 Bacteria 21439
152 Ga0097620_100033837 3300006931 Bacteria 5131
153 Ga0097620_100047762 3300006931 Bacteria 4301
154 Ga0097620_100066769 3300006931 Bacteria 3632
155 Ga0097620_100103322 3300006931 Bacteria 2907
156 Ga0097620_100103527 3300006931 Bacteria 2905
157 Ga0097620_100109957 3300006931 Bacteria 2818
158 Ga0097620_100166480 3300006931 Bacteria 2284
159 Ga0097620_100209161 3300006931 Bacteria 2037
160 Ga0097620_100217534 3300006931 Bacteria 1998
161 Ga0075435_100012970 3300007076 Bacteria 6182
162 Ga0075435_100225529 3300007076 Bacteria 1591
163 Ga0105240_10001400 3300009093 Bacteria 41411
164 Ga0105240_10002378 3300009093 Bacteria 30334
165 Ga0111539_10011257 3300009094 Bacteria 11241
166 Ga0111539_10012494 3300009094 Bacteria 10643
167 Ga0111539_10030476 3300009094 Bacteria 6556
168 Ga0111539_10035427 3300009094 Bacteria 6043
169 Ga0111539_10047896 3300009094 Bacteria 5107
170 Ga0111539_10050704 3300009094 Bacteria 4944
171 Ga0111539_10124653 3300009094 Bacteria 3019
172 Ga0111539_10193743 3300009094 Bacteria 2371
173 Ga0105247_10000536 3300009101 Bacteria 30808
174 Ga0114129_10047631 3300009147 Bacteria 6023
175 Ga0105243_10000027 3300009148 Bacteria 191224
176 Ga0105243_10004854 3300009148 Bacteria 10561
177 Ga0105243_10026660 3300009148 Bacteria 4424
178 Ga0105241_10000436 3300009174 Bacteria 31406
179 Ga0105242_10000056 3300009176 Bacteria 76052
180 Ga0105242_10001559 3300009176 Bacteria 18042
181 Ga0105242_10008632 3300009176 Bacteria 7823
182 Ga0105242_10019209 3300009176 Bacteria 5354
183 Ga0105248_10001767 3300009177 Bacteria 24053
184 Ga0105248_10007658 3300009177 Bacteria 11865
185 Ga0105248_10051695 3300009177 Bacteria 4610
186 Ga0105237_10000070 3300009545 Bacteria 136694
187 Ga0105237_10031809 3300009545 Bacteria 5345
188 Ga0105238_10000044 3300009551 Bacteria 151485
189 Ga0105238_10000736 3300009551 Bacteria 34203
190 Ga0105238_10104209 3300009551 Bacteria 2818
191 Ga0105249_10017449 3300009553 Bacteria 6372
192 Ga0105239_10092011 3300010375 Bacteria 3347
193 Ga0105239_10247816 3300010375 Bacteria 2000
194 Ga0105246_10062594 3300011119 Bacteria 2593
195 Ga0157373_10081491 3300013100 Bacteria 2281
196 Ga0157369_10022988 3300013105 Bacteria 6950
197 Ga0157374_10222142 3300013296 Bacteria 1854
198 Ga0157378_10026566 3300013297 Bacteria 5103
199 Ga0163162_10102623 3300013306 Bacteria 2953
200 Ga0157375_10003297 3300013308 Bacteria 13977
201 Ga0157375_10034015 3300013308 Bacteria 4850
202 Ga0157375_10081078 3300013308 Bacteria 3284
203 Ga0157375_10160800 3300013308 Unclassified 2387
204 Ga0163163_10118360 3300014325 Unclassified 2681
205 Ga0157380_10014094 3300014326 Bacteria 5843
206 Ga0157380_10022220 3300014326 Bacteria 4771
207 Ga0157380_10076921 3300014326 Bacteria 2718
208 Ga0157377_10027960 3300014745 Bacteria 3032
209 Ga0157379_10103279 3300014968 Bacteria 2558
210 Ga0157376_10002143 3300014969 Bacteria 13292
211 Ga0157376_10007517 3300014969 Bacteria 7787
212 Ga0157376_10166866 3300014969 Bacteria 2001
213 Ga0183369_1003 3300015685 Bacteria 726443
214 Ga0163161_10006219 3300017792 Bacteria 8273
215 Ga0163161_10037241 3300017792 Bacteria 3486
216 Ga0213876_10017563 3300021384 Bacteria 3777
217 Ga0207427_100251 3300025231 Bacteria 42496
218 Ga0209026_1000378 3300025250 Bacteria 40841
219 Ga0209759_1021271 3300025256 Bacteria 1481
220 Ga0209759_1021272 3300025256 Bacteria 1481
221 Ga0209455_1000151 3300025272 Bacteria 129842
222 Ga0209051_1004999 3300025303 Bacteria 7904
223 Ga0207682_10004090 3300025893 Bacteria 6193
224 Ga0207642_10011050 3300025899 Bacteria 3207
225 Ga0207710_10000212 3300025900 Bacteria 51768
226 Ga0207688_10047236 3300025901 Bacteria 2404
227 Ga0207680_10042657 3300025903 Bacteria 2655
228 Ga0207647_10041567 3300025904 Bacteria 2890
229 Ga0207645_10005982 3300025907 Bacteria 8756
230 Ga0207645_10013082 3300025907 Bacteria 5605
231 Ga0207645_10034632 3300025907 Bacteria 3244
232 Ga0207643_10000629 3300025908 Bacteria 22222
233 Ga0207643_10033243 3300025908 Bacteria 2885
234 Ga0207643_10034714 3300025908 Bacteria 2826
235 Ga0207705_10001527 3300025909 Bacteria 18362
236 Ga0207684_10009547 3300025910 Bacteria 8557
237 Ga0207684_10054714 3300025910 Bacteria 3386
238 Ga0207654_10000604 3300025911 Bacteria 20264
239 Ga0207707_10079691 3300025912 Bacteria 2859
240 Ga0207707_10160504 3300025912 Bacteria 1966
241 Ga0207695_10000943 3300025913 Bacteria 51800
242 Ga0207695_10001814 3300025913 Bacteria 33622
243 Ga0207695_10006277 3300025913 Bacteria 15474
244 Ga0207671_10000429 3300025914 Bacteria 57986
245 Ga0207671_10186636 3300025914 Bacteria 1615
246 Ga0207693_10135545 3300025915 Bacteria 1936
247 Ga0207693_10227210 3300025915 Bacteria 1466
248 Ga0207662_10008551 3300025918 Bacteria 5610
249 Ga0207657_10202794 3300025919 Bacteria 1595
250 Ga0207649_10013683 3300025920 Bacteria 4534
251 Ga0207681_10003774 3300025923 Bacteria 9413
252 Ga0207694_10000109 3300025924 Bacteria 86216
253 Ga0207694_10006182 3300025924 Bacteria 9145
254 Ga0207650_10023348 3300025925 Bacteria 4384
255 Ga0207650_10062156 3300025925 Bacteria 2790
256 Ga0207659_10001820 3300025926 Bacteria 12625
257 Ga0207659_10007853 3300025926 Bacteria 6594
258 Ga0207659_10034596 3300025926 Bacteria 3485
259 Ga0207659_10049922 3300025926 Bacteria 2970
260 Ga0207644_10163691 3300025931 Bacteria 1731
261 Ga0207690_10000285 3300025932 Bacteria 35963
262 Ga0207690_10006534 3300025932 Bacteria 6914
263 Ga0207706_10019662 3300025933 Bacteria 6075
264 Ga0207706_10021575 3300025933 Bacteria 5782
265 Ga0207706_10085194 3300025933 Bacteria 2778
266 Ga0207686_10000008 3300025934 Bacteria 245575
267 Ga0207709_10000025 3300025935 Bacteria 364795
268 Ga0207709_10008990 3300025935 Bacteria 5506
269 Ga0207709_10060507 3300025935 Bacteria 2362
270 Ga0207670_10049975 3300025936 Bacteria 2799
271 Ga0207670_10122396 3300025936 Bacteria 1893
272 Ga0207670_10158529 3300025936 Bacteria 1687
273 Ga0207704_10016391 3300025938 Bacteria 3807
274 Ga0207691_10008078 3300025940 Bacteria 10109
275 Ga0207691_10009281 3300025940 Bacteria 9437
276 Ga0207691_10009607 3300025940 Bacteria 9281
277 Ga0207691_10033968 3300025940 Bacteria 4747
278 Ga0207691_10048351 3300025940 Bacteria 3901
279 Ga0207691_10064511 3300025940 Bacteria 3318
280 Ga0207711_10040534 3300025941 Bacteria 3962
281 Ga0207711_10050459 3300025941 Bacteria 3562
282 Ga0207711_10156128 3300025941 Bacteria 2062
283 Ga0207689_10001673 3300025942 Bacteria 21051
284 Ga0207689_10070618 3300025942 Bacteria 2869
285 Ga0207689_10093223 3300025942 Bacteria 2474
286 Ga0207661_10038991 3300025944 Bacteria 3727
287 Ga0207679_10002837 3300025945 Bacteria 10746
288 Ga0207679_10055191 3300025945 Bacteria 2927
289 Ga0207679_10121734 3300025945 Bacteria 2078
290 Ga0207667_10014977 3300025949 Bacteria 8820
291 Ga0207667_10054538 3300025949 Bacteria 4204
292 Ga0207651_10003017 3300025960 Bacteria 8156
293 Ga0207651_10010900 3300025960 Bacteria 5060
294 Ga0207651_10029048 3300025960 Bacteria 3498
295 Ga0207651_10082766 3300025960 Bacteria 2318
296 Ga0207712_10041534 3300025961 Bacteria 3161
297 Ga0207668_10146301 3300025972 Bacteria 1824
298 Ga0207640_10001631 3300025981 Bacteria 12021
299 Ga0207640_10065325 3300025981 Bacteria 2427
300 Ga0207658_10001950 3300025986 Bacteria 15409
301 Ga0207658_10042978 3300025986 Bacteria 3282
302 Ga0207658_10073339 3300025986 Bacteria 2598
303 Ga0207658_10110339 3300025986 Unclassified 2173
304 Ga0207703_10103256 3300026035 Bacteria 2420
305 Ga0207678_10038003 3300026067 Bacteria 4186
306 Ga0207678_10088781 3300026067 Bacteria 2642
307 Ga0207708_10008383 3300026075 Bacteria 7651
308 Ga0207702_10000160 3300026078 Bacteria 79708
309 Ga0207641_10015006 3300026088 Bacteria 6351
310 Ga0207641_10029705 3300026088 Bacteria 4521
311 Ga0207648_10000973 3300026089 Bacteria 32318
312 Ga0207648_10025223 3300026089 Bacteria 5298
313 Ga0207648_10095090 3300026089 Bacteria 2606
314 Ga0207648_10161616 3300026089 Bacteria 1978
315 Ga0207676_10024024 3300026095 Bacteria 4506
316 Ga0207676_10062583 3300026095 Bacteria 2952
317 Ga0207676_10080407 3300026095 Bacteria 2645
318 Ga0207676_10188342 3300026095 Bacteria 1813
319 Ga0207674_10039459 3300026116 Bacteria 4894
320 Ga0207674_10128453 3300026116 Bacteria 2499
321 Ga0207674_10139849 3300026116 Bacteria 2381
322 Ga0207675_100001134 3300026118 Bacteria 26415
323 Ga0207675_100003190 3300026118 Bacteria 16090
324 Ga0207675_100004461 3300026118 Bacteria 13527
325 Ga0207675_100052985 3300026118 Bacteria 3786
326 Ga0207675_100070198 3300026118 Bacteria 3274
327 Ga0207683_10054559 3300026121 Bacteria 3504
328 Ga0207683_10056723 3300026121 Bacteria 3437
329 Ga0207683_10062019 3300026121 Bacteria 3292
330 Ga0207428_10006505 3300027907 Bacteria 10785
331 Ga0207428_10032544 3300027907 Bacteria 4287
332 Ga0207428_10039155 3300027907 Bacteria 3848
333 Ga0207428_10076265 3300027907 Bacteria 2625
334 Ga0268266_10000004 3300028379 Bacteria 1495817
335 Ga0268266_10065155 3300028379 Bacteria 3149
336 Ga0268266_10070181 3300028379 Bacteria 3036
337 Ga0268265_10001596 3300028380 Bacteria 18723
338 Ga0268265_10112366 3300028380 Bacteria 2227
339 Ga0268264_10071056 3300028381 Bacteria 2948
340 Ga0268264_10119343 3300028381 Bacteria 2322
341 Ga0268264_10195996 3300028381 Bacteria 1844
342 Ga0307515_10159193 3300028794 Bacteria 2313
343 Ga0307513_10008910 3300031456 Bacteria 12759
344 Ga0307513_10070070 3300031456 Bacteria 3667
345 Ga0307513_10124642 3300031456 Bacteria 2535
346 Ga0307509_10001087 3300031507 Bacteria 46534
347 Ga0307509_10038884 3300031507 Bacteria 5186
348 Ga0307508_10006470 3300031616 Bacteria 11020
349 Ga0307508_10026468 3300031616 Bacteria 5257
350 Ga0307516_10012872 3300031730 Bacteria 8976
351 Ga0307406_10095122 3300031901 Bacteria 2015
352 Ga0373961_0000787 3300035241 Bacteria 10887
353 Ga0373937_0035783 3300036401 Bacteria 4521
354 Ga0373925_0025126 3300037068 Bacteria 4350
355 Ga0395899_0005425 3300037312 Bacteria 9899
356 Ga0395900_0002085 3300037418 Bacteria 22422
357 Ga0395901_0000604 3300038443 Bacteria 41808
358 Ga0395901_0100935 3300038443 Bacteria 3027
359 Ga0436365_1749406 3300039437 Bacteria 18798
360 Ga0451577_0022660 3300042876 Bacteria 5734
361 Ga0453684_0080848 3300044712 Bacteria 4056
362 Ga0451576_0026362 3300045051 Bacteria 6253
363 Ga0451576_0348054 3300045051 Bacteria 1552
364 Ga0495638_0000783 3300046460 Bacteria 33554
365 Ga0495638_0004874 3300046460 Bacteria 10097
366 Ga0495638_0009044 3300046460 Bacteria 7022
367 Ga0495580_0002707 3300046472 Bacteria 15322
368 Ga0495580_0008311 3300046472 Bacteria 8260
369 Ga0495582_0015610 3300046473 Bacteria 4170
370 Ga0495582_0027993 3300046473 Bacteria 3092
371 Ga0495639_0053417 3300046475 Bacteria 1841
372 Ga0495664_0036664 3300046477 Bacteria 2891
373 Ga0495584_0061669 3300046491 Bacteria 1885
374 Ga0495583_0000149 3300046506 Bacteria 117980
375 Ga0495606_0007250 3300046507 Bacteria 9992
376 Ga0495665_0081006 3300046531 Bacteria 1707
377 Ga0495622_0032975 3300046557 Bacteria 2418
378 Ga0495656_0075157 3300046615 Bacteria 1511
379 Ga0495668_0085586 3300046616 Bacteria 1729
380 Ga0495625_0016273 3300046660 Bacteria 5857
381 Ga0495657_0146773 3300046675 Bacteria 1467
382 Ga0495599_0046645 3300046678 Bacteria 2717
383 Ga0495658_0078192 3300046683 Bacteria 1936
384 Ga0495613_0028910 3300046689 Bacteria 4123
385 Ga0495649_0001149 3300046694 Bacteria 20618
386 Ga0495600_0096360 3300046809 Bacteria 1929
387 Ga0495604_0021923 3300047317 Bacteria 5099
388 Ga0495636_0024179 3300047318 Bacteria 2462
389 Ga0495674_0039335 3300047319 Bacteria 4240
390 Ga0495674_0113661 3300047319 Bacteria 2293
391 Ga0495686_0000946 3300047472 Bacteria 36027
392 Ga0495686_0001902 3300047472 Bacteria 20837
393 Ga0496101_0167343 3300048904 Bacteria 1688
394 Ga0496102_0123891 3300048905 Bacteria 2415
395 Ga0496104_0010105 3300048907 Bacteria 8426
396 Ga0496104_0053242 3300048907 Bacteria 3823
397 Ga0496104_0055003 3300048907 Bacteria 3762
398 Ga0496104_0144011 3300048907 Bacteria 2289
399 Ga0496104_0244461 3300048907 Bacteria 1707
400 Ga0496106_0002225 3300048909 Bacteria 14464
401 Ga0496107_0008832 3300048910 Bacteria 6982
402 Ga0496107_0174424 3300048910 Bacteria 1596
403 Ga0496108_0017834 3300048911 Bacteria 5806
404 Ga0496108_0029664 3300048911 Bacteria 4532
405 Ga0496108_0043312 3300048911 Bacteria 3760
406 Ga0496109_0000397 3300048912 Bacteria 39356
407 Ga0496109_0021919 3300048912 Bacteria 5656
408 Ga0496109_0034542 3300048912 Bacteria 4555
409 Ga0496109_0146235 3300048912 Bacteria 2211
410 Ga0496110_0015795 3300048913 Bacteria 6294
411 Ga0496110_0120299 3300048913 Bacteria 2365
412 Ga0496110_0166949 3300048913 Bacteria 1996
413 Ga0496110_0241307 3300048913 Bacteria 1644
414 Ga0496111_0009989 3300048914 Bacteria 6350
415 Ga0496111_0013749 3300048914 Bacteria 5514
416 Ga0496111_0150980 3300048914 Bacteria 1723
417 Ga0496112_0007198 3300048915 Bacteria 9858
418 Ga0496112_0029356 3300048915 Bacteria 5318
419 Ga0496112_0038969 3300048915 Bacteria 4642
420 Ga0496113_0000284 3300048916 Bacteria 23973
421 Ga0496113_0038362 3300048916 Bacteria 3522
422 Ga0496113_0056408 3300048916 Bacteria 2949
423 Ga0496114_0000064 3300048917 Bacteria 83513
424 Ga0496114_0000550 3300048917 Bacteria 27773
425 Ga0496114_0204193 3300048917 Unclassified 1732
426 Ga0496114_0305663 3300048917 Bacteria 1404
427 Ga0496115_0000354 3300048918 Bacteria 38566
428 Ga0496115_0100608 3300048918 Unclassified 2370
429 Ga0496118_0082421 3300048921 Bacteria 2254
430 Ga0496121_0001659 3300048924 Bacteria 36737
431 Ga0496125_0031533 3300048928 Bacteria 4723
432 Ga0501047_0000443 3300049581 Bacteria 45792
433 Ga0501069_0018688 3300049585 Bacteria 3743
434 Ga0501070_0007236 3300049586 Bacteria 9426
435 Ga0501070_0021035 3300049586 Bacteria 5473
436 Ga0501070_0104110 3300049586 Unclassified 2347
437 Ga0501071_0055916 3300049587 Bacteria 2849
438 Ga0501074_0001565 3300049590 Bacteria 15472
439 Ga0501077_0004900 3300049593 Bacteria 8127
440 Ga0501080_0008896 3300049742 Bacteria 9130
441 Ga0501080_0216173 3300049742 Bacteria 1755
442 Ga0501035_0160437 3300049822 Bacteria 1946
443 Ga0501044_0021521 3300049823 Bacteria 6878
444 Ga0501044_0188823 3300049823 Bacteria 2024
445 nmdc:mga05p37_10270_c1 3300050507 Bacteria 11117
446 nmdc:mga05p37_65248_c2 3300050507 Bacteria 3852
447 nmdc:mga09592_46066_c1 3300050508 Bacteria 3674
448 nmdc:mga09592_50643_c1 3300050508 Bacteria 3502
449 nmdc:mga06r32_2052_c1 3300050510 Bacteria 18014
450 nmdc:mga06r32_27220_c1 3300050510 Bacteria 5339
451 nmdc:mga08y16_17057_c1 3300050511 Bacteria 7647
452 nmdc:mga08y16_19632_c1 3300050511 Bacteria 7127
453 nmdc:mga08y16_22652_c1 3300050511 Bacteria 6632
454 nmdc:mga08y16_45345_c1 3300050511 Bacteria 4607
455 nmdc:mga08y16_51591_c1 3300050511 Bacteria 4304
456 nmdc:mga08y16_54337_c1 3300050511 Bacteria 4185
457 nmdc:mga0n895_10328_c1 3300050512 Bacteria 8237
458 nmdc:mga0n895_105123_c1 3300050512 Bacteria 2836
459 nmdc:mga0n895_109161_c1 3300050512 Bacteria 2782
460 nmdc:mga0n895_249853_c1 3300050512 Bacteria 1800
461 nmdc:mga0rr50_277887_c1 3300050513 Bacteria 1397
462 nmdc:mga0a205_167531_c1 3300050515 Bacteria 2093
463 Ga0495601_0023428 3300053077 Bacteria 3793
464 Ga0495601_0029769 3300053077 Bacteria 3389
465 Ga0495601_0075424 3300053077 Bacteria 2159
466 Ga0500635_0000011 3300053080 Bacteria 144219
467 Ga0500635_0012182 3300053080 Bacteria 2462
468 Ga0495619_0007794 3300053085 Bacteria 6778
469 Ga0500583_0000447 3300053092 Bacteria 12938
470 Ga0500568_0005076 3300053139 Bacteria 6887
471 Ga0500588_0007263 3300053146 Bacteria 2547
472 Ga0500616_0065689 3300053153 Bacteria 1865
473 Ga0500622_0020874 3300053156 Bacteria 3475
474 Ga0500636_0001344 3300053177 Bacteria 13342
475 Ga0500637_0017899 3300053178 Bacteria 3800
476 Ga0501082_0206453 3300060353 Bacteria 1709

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_100185547 Ga0070700_1001855471 336
2 3300038443 Ga0395901_0100935 Ga0395901_0100935_405_1727 365
3 3300049585 Ga0501069_0018688 Ga0501069_0018688_157_1467 366
4 3300049586 Ga0501070_0007236 Ga0501070_0007236_4455_5765 366
5 3300013308 Ga0157375_10160800 Ga0157375_101608002 367
6 3300025986 Ga0207658_10110339 Ga0207658_101103393 367
7 3300049581 Ga0501047_0000443 Ga0501047_0000443_11850_13157 368
8 3300009551 Ga0105238_10000044 Ga0105238_10000044128 370
9 3300005841 Ga0068863_100027907 Ga0068863_1000279075 371
10 3300005617 Ga0068859_100103526 Ga0068859_1001035263 372
11 3300006931 Ga0097620_100103527 Ga0097620_1001035273 372
12 3300005719 Ga0068861_100012556 Ga0068861_1000125562 373
13 3300025936 Ga0207670_10122396 Ga0207670_101223962 373
14 3300026118 Ga0207675_100004461 Ga0207675_1000044613 373
15 3300009176 Ga0105242_10008632 Ga0105242_100086323 374
16 3300046460 Ga0495638_0000783 Ga0495638_0000783_20859_22166 374
17 3300049590 Ga0501074_0001565 Ga0501074_0001565_794_2146 374
18 3300049742 Ga0501080_0008896 Ga0501080_0008896_673_2025 374
19 3300049822 Ga0501035_0160437 Ga0501035_0160437_371_1723 374
20 3300049823 Ga0501044_0021521 Ga0501044_0021521_5425_6777 374
21 3300005937 Ga0081455_10176824 Ga0081455_101768242 375
22 3300013306 Ga0163162_10102623 Ga0163162_101026231 375
23 3300005327 Ga0070658_10136905 Ga0070658_101369052 378
24 3300005344 Ga0070661_100092243 Ga0070661_1000922432 378
25 3300005564 Ga0070664_100063115 Ga0070664_1000631153 378
26 3300005834 Ga0068851_10031160 Ga0068851_100311602 378
27 3300013296 Ga0157374_10222142 Ga0157374_102221421 378
28 3300025944 Ga0207661_10038991 Ga0207661_100389912 378
29 3300025945 Ga0207679_10055191 Ga0207679_100551913 378
30 3300003323 rootH1_10021045 rootH1_100210453 379
31 3300009545 Ga0105237_10031809 Ga0105237_100318096 379
32 3300031507 Ga0307509_10001087 Ga0307509_1000108723 379
33 3300046660 Ga0495625_0016273 Ga0495625_0016273_1732_3039 380
34 3300009174 Ga0105241_10000436 Ga0105241_1000043616 381
35 3300013105 Ga0157369_10022988 Ga0157369_100229884 381
36 3300025911 Ga0207654_10000604 Ga0207654_100006043 381
37 3300046507 Ga0495606_0007250 Ga0495606_0007250_1329_2636 381
38 3300053080 Ga0500635_0000011 Ga0500635_0000011_29772_31079 381
39 3300003322 rootL2_10049188 rootL2_100491882 382
40 3300025303 Ga0209051_1004999 Ga0209051_10049996 382
41 3300048918 Ga0496115_0100608 Ga0496115_0100608_84_1457 382
42 3300031616 Ga0307508_10006470 Ga0307508_100064705 383
43 3300037312 Ga0395899_0005425 Ga0395899_0005425_5825_7162 384
44 3300037418 Ga0395900_0002085 Ga0395900_0002085_17655_18992 384
45 3300046472 Ga0495580_0002707 Ga0495580_0002707_9982_11304 384
46 3300046531 Ga0495665_0081006 Ga0495665_0081006_64_1386 384
47 3300037068 Ga0373925_0025126 Ga0373925_0025126_3041_4303 385
48 3300046472 Ga0495580_0008311 Ga0495580_0008311_4416_5678 385
49 3300046675 Ga0495657_0146773 Ga0495657_0146773_39_1301 385
50 3300047319 Ga0495674_0113661 Ga0495674_0113661_285_1547 385
51 3300005843 Ga0068860_100071889 Ga0068860_1000718894 386
52 3300028381 Ga0268264_10071056 Ga0268264_100710563 386
53 3300025231 Ga0207427_100251 Ga0207427_10025147 387
54 3300046506 Ga0495583_0000149 Ga0495583_0000149_33221_34528 387
55 3300046694 Ga0495649_0001149 Ga0495649_0001149_9458_10765 387
56 3300048912 Ga0496109_0146235 Ga0496109_0146235_980_2200 387
57 3300005354 Ga0070675_100016640 Ga0070675_1000166404 388
58 3300005356 Ga0070674_100008191 Ga0070674_1000081913 388
59 3300005364 Ga0070673_100041396 Ga0070673_1000413963 388
60 3300009094 Ga0111539_10030476 Ga0111539_100304767 388
61 3300009094 Ga0111539_10035427 Ga0111539_100354275 388
62 3300014326 Ga0157380_10076921 Ga0157380_100769212 388
63 3300025940 Ga0207691_10008078 Ga0207691_100080786 388
64 3300025960 Ga0207651_10029048 Ga0207651_100290482 388
65 3300026121 Ga0207683_10054559 Ga0207683_100545594 388
66 3300027907 Ga0207428_10006505 Ga0207428_100065055 388
67 3300031730 Ga0307516_10012872 Ga0307516_100128722 388
68 3300050511 nmdc:mga08y16_17057_c1 nmdc:mga08y16_17057_c1_2324_3580 388
69 3300050511 nmdc:mga08y16_45345_c1 nmdc:mga08y16_45345_c1_1728_3074 388
70 3300005353 Ga0070669_100014669 Ga0070669_1000146694 389
71 3300005563 Ga0068855_100013012 Ga0068855_1000130126 389
72 3300005844 Ga0068862_100010286 Ga0068862_1000102866 389
73 3300006852 Ga0075433_10050310 Ga0075433_100503103 389
74 3300006871 Ga0075434_100064378 Ga0075434_1000643783 389
75 3300007076 Ga0075435_100012970 Ga0075435_1000129701 389
76 3300009093 Ga0105240_10002378 Ga0105240_100023789 389
77 3300009094 Ga0111539_10124653 Ga0111539_101246533 389
78 3300025913 Ga0207695_10001814 Ga0207695_1000181418 389
79 3300025945 Ga0207679_10121734 Ga0207679_101217343 389
80 3300025949 Ga0207667_10014977 Ga0207667_100149774 389
81 3300025981 Ga0207640_10001631 Ga0207640_100016317 389
82 3300026116 Ga0207674_10039459 Ga0207674_100394593 389
83 3300046616 Ga0495668_0085586 Ga0495668_0085586_458_1717 389
84 3300050511 nmdc:mga08y16_51591_c1 nmdc:mga08y16_51591_c1_2689_4056 389
85 3300050512 nmdc:mga0n895_10328_c1 nmdc:mga0n895_10328_c1_4951_6324 389
86 3300015685 Ga0183369_1003 Ga0183369_100329 390
87 3300025913 Ga0207695_10006277 Ga0207695_100062779 390
88 3300025914 Ga0207671_10186636 Ga0207671_101866362 390
89 3300025961 Ga0207712_10041534 Ga0207712_100415342 390
90 3300005328 Ga0070676_10001897 Ga0070676_100018973 391
91 3300005330 Ga0070690_100006272 Ga0070690_1000062722 391
92 3300005354 Ga0070675_100003000 Ga0070675_1000030005 391
93 3300005441 Ga0070700_100003761 Ga0070700_1000037613 391
94 3300005459 Ga0068867_100002149 Ga0068867_1000021496 391
95 3300005543 Ga0070672_100014577 Ga0070672_1000145772 391
96 3300005617 Ga0068859_100047764 Ga0068859_1000477645 391
97 3300005719 Ga0068861_100001931 Ga0068861_1000019314 391
98 3300006881 Ga0068865_100005131 Ga0068865_1000051313 391
99 3300006931 Ga0097620_100047762 Ga0097620_1000477621 391
100 3300009148 Ga0105243_10004854 Ga0105243_100048543 391
101 3300009176 Ga0105242_10001559 Ga0105242_1000155913 391
102 3300014326 Ga0157380_10014094 Ga0157380_100140942 391
103 3300014745 Ga0157377_10027960 Ga0157377_100279602 391
104 3300025926 Ga0207659_10049922 Ga0207659_100499223 391
105 3300025935 Ga0207709_10008990 Ga0207709_100089902 391
106 3300025940 Ga0207691_10009607 Ga0207691_100096072 391
107 3300025942 Ga0207689_10001673 Ga0207689_100016736 391
108 3300025960 Ga0207651_10003017 Ga0207651_100030174 391
109 3300026075 Ga0207708_10008383 Ga0207708_100083833 391
110 3300026089 Ga0207648_10000973 Ga0207648_1000097316 391
111 3300026118 Ga0207675_100003190 Ga0207675_1000031906 391
112 3300046475 Ga0495639_0053417 Ga0495639_0053417_417_1763 391
113 3300005329 Ga0070683_100020633 Ga0070683_1000206333 392
114 3300005331 Ga0070670_100006502 Ga0070670_1000065023 392
115 3300005344 Ga0070661_100018371 Ga0070661_1000183711 392
116 3300005355 Ga0070671_100171432 Ga0070671_1001714322 392
117 3300005535 Ga0070684_100030426 Ga0070684_1000304264 392
118 3300005548 Ga0070665_100010580 Ga0070665_1000105807 392
119 3300009094 Ga0111539_10047896 Ga0111539_100478963 392
120 3300009177 Ga0105248_10051695 Ga0105248_100516953 392
121 3300014969 Ga0157376_10166866 Ga0157376_101668661 392
122 3300025920 Ga0207649_10013683 Ga0207649_100136833 392
123 3300025931 Ga0207644_10163691 Ga0207644_101636912 392
124 3300025941 Ga0207711_10050459 Ga0207711_100504593 392
125 3300025981 Ga0207640_10065325 Ga0207640_100653253 392
126 3300028379 Ga0268266_10070181 Ga0268266_100701814 392
127 3300046477 Ga0495664_0036664 Ga0495664_0036664_581_1912 392
128 3300046678 Ga0495599_0046645 Ga0495599_0046645_14_1339 392
129 3300048907 Ga0496104_0055003 Ga0496104_0055003_1621_2889 392
130 3300048911 Ga0496108_0043312 Ga0496108_0043312_1199_2467 392
131 3300048912 Ga0496109_0034542 Ga0496109_0034542_1710_2978 392
132 3300048913 Ga0496110_0015795 Ga0496110_0015795_4224_5492 392
133 3300048914 Ga0496111_0013749 Ga0496111_0013749_2206_3474 392
134 3300048915 Ga0496112_0029356 Ga0496112_0029356_3112_4380 392
135 3300048916 Ga0496113_0038362 Ga0496113_0038362_1086_2354 392
136 3300006852 Ga0075433_10010865 Ga0075433_100108656 393
137 3300006871 Ga0075434_100082835 Ga0075434_1000828354 393
138 3300028794 Ga0307515_10159193 Ga0307515_101591932 393
139 3300045051 Ga0451576_0026362 Ga0451576_0026362_4075_5388 393
140 3300048921 Ga0496118_0082421 Ga0496118_0082421_522_1835 393
141 3300050512 nmdc:mga0n895_249853_c1 nmdc:mga0n895_249853_c1_340_1668 393
142 3300050515 nmdc:mga0a205_167531_c1 nmdc:mga0a205_167531_c1_667_1995 393
143 3300053092 Ga0500583_0000447 Ga0500583_0000447_9187_10542 393
144 3300005617 Ga0068859_100166462 Ga0068859_1001664622 394
145 3300006931 Ga0097620_100166480 Ga0097620_1001664802 394
146 3300053146 Ga0500588_0007263 Ga0500588_0007263_559_1872 394
147 3300048917 Ga0496114_0000064 Ga0496114_0000064_75603_76937 395
148 3300006880 Ga0075429_100212978 Ga0075429_1002129781 396
149 3300021384 Ga0213876_10017563 Ga0213876_100175632 396
150 3300039437 Ga0436365_1749406 Ga0436365_1749406_3446_4849 396
151 3300005355 Ga0070671_100009164 Ga0070671_1000091644 397
152 3300005539 Ga0068853_100002236 Ga0068853_1000022362 397
153 3300025901 Ga0207688_10047236 Ga0207688_100472362 397
154 3300025938 Ga0207704_10016391 Ga0207704_100163912 397
155 3300031456 Ga0307513_10070070 Ga0307513_100700702 397
156 3300046460 Ga0495638_0004874 Ga0495638_0004874_5664_6971 397
157 3300047472 Ga0495686_0001902 Ga0495686_0001902_9465_10781 397
158 3300053080 Ga0500635_0012182 Ga0500635_0012182_385_1692 397
159 3300053177 Ga0500636_0001344 Ga0500636_0001344_9942_11249 397
160 3300005335 Ga0070666_10034515 Ga0070666_100345152 398
161 3300005842 Ga0068858_100284182 Ga0068858_1002841821 398
162 3300009177 Ga0105248_10007658 Ga0105248_100076586 398
163 3300017792 Ga0163161_10006219 Ga0163161_100062193 398
164 3300025272 Ga0209455_1000151 Ga0209455_100015190 398
165 3300028379 Ga0268266_10065155 Ga0268266_100651552 398
166 3300005471 Ga0070698_100098816 Ga0070698_1000988163 399
167 3300005518 Ga0070699_100159859 Ga0070699_1001598592 399
168 3300025910 Ga0207684_10054714 Ga0207684_100547143 399
169 3300045051 Ga0451576_0348054 Ga0451576_0348054_200_1504 399
170 3300048905 Ga0496102_0123891 Ga0496102_0123891_929_2227 399
171 3300005353 Ga0070669_100016036 Ga0070669_1000160363 400
172 3300005457 Ga0070662_100002210 Ga0070662_1000022102 400
173 3300005458 Ga0070681_10192239 Ga0070681_101922392 400
174 3300005618 Ga0068864_100245596 Ga0068864_1002455961 400
175 3300005841 Ga0068863_100014316 Ga0068863_1000143162 400
176 3300005844 Ga0068862_100002215 Ga0068862_1000022159 400
177 3300006844 Ga0075428_100157466 Ga0075428_1001574662 400
178 3300009553 Ga0105249_10017449 Ga0105249_100174492 400
179 3300025912 Ga0207707_10160504 Ga0207707_101605042 400
180 3300025919 Ga0207657_10202794 Ga0207657_102027941 400
181 3300025923 Ga0207681_10003774 Ga0207681_100037744 400
182 3300025924 Ga0207694_10000109 Ga0207694_1000010926 400
183 3300025933 Ga0207706_10085194 Ga0207706_100851942 400
184 3300026118 Ga0207675_100001134 Ga0207675_10000113414 400
185 3300028379 Ga0268266_10000004 Ga0268266_10000004180 400
186 3300028380 Ga0268265_10001596 Ga0268265_100015969 400
187 3300035241 Ga0373961_0000787 Ga0373961_0000787_2198_3487 400
188 3300048914 Ga0496111_0009989 Ga0496111_0009989_4133_5449 400
189 3300048916 Ga0496113_0000284 Ga0496113_0000284_4749_6062 400
190 3300050508 nmdc:mga09592_50643_c1 nmdc:mga09592_50643_c1_1947_3278 400
191 3300003323 rootH1_10096388 rootH1_100963882 401
192 3300005331 Ga0070670_100011270 Ga0070670_1000112703 401
193 3300005353 Ga0070669_100126912 Ga0070669_1001269123 401
194 3300005354 Ga0070675_100036178 Ga0070675_1000361782 401
195 3300005564 Ga0070664_100024555 Ga0070664_1000245553 401
196 3300025925 Ga0207650_10023348 Ga0207650_100233482 401
197 3300025940 Ga0207691_10009281 Ga0207691_100092812 401
198 3300046689 Ga0495613_0028910 Ga0495613_0028910_2132_3403 401
199 3300049742 Ga0501080_0216173 Ga0501080_0216173_13_1266 401
200 3300005356 Ga0070674_100233771 Ga0070674_1002337711 402
201 3300017792 Ga0163161_10037241 Ga0163161_100372413 402
202 3300026118 Ga0207675_100070198 Ga0207675_1000701982 402
203 3300005327 Ga0070658_10123678 Ga0070658_101236782 403
204 3300005328 Ga0070676_10024325 Ga0070676_100243253 403
205 3300005330 Ga0070690_100000834 Ga0070690_1000008344 403
206 3300005331 Ga0070670_100113049 Ga0070670_1001130491 403
207 3300005331 Ga0070670_100138726 Ga0070670_1001387262 403
208 3300005331 Ga0070670_100154417 Ga0070670_1001544172 403
209 3300005334 Ga0068869_100031824 Ga0068869_1000318241 403
210 3300005334 Ga0068869_100033501 Ga0068869_1000335012 403
211 3300005335 Ga0070666_10000193 Ga0070666_1000019318 403
212 3300005335 Ga0070666_10002750 Ga0070666_1000275012 403
213 3300005335 Ga0070666_10007561 Ga0070666_100075616 403
214 3300005335 Ga0070666_10069027 Ga0070666_100690271 403
215 3300005337 Ga0070682_100026495 Ga0070682_1000264953 403
216 3300005337 Ga0070682_100081156 Ga0070682_1000811562 403
217 3300005340 Ga0070689_100002142 Ga0070689_1000021423 403
218 3300005344 Ga0070661_100101649 Ga0070661_1001016492 403
219 3300005347 Ga0070668_100035529 Ga0070668_1000355291 403
220 3300005354 Ga0070675_100020143 Ga0070675_1000201433 403
221 3300005354 Ga0070675_100041139 Ga0070675_1000411392 403
222 3300005354 Ga0070675_100044842 Ga0070675_1000448422 403
223 3300005354 Ga0070675_100072155 Ga0070675_1000721552 403
224 3300005356 Ga0070674_100038800 Ga0070674_1000388003 403
225 3300005364 Ga0070673_100154612 Ga0070673_1001546122 403
226 3300005367 Ga0070667_100016832 Ga0070667_1000168326 403
227 3300005444 Ga0070694_100003463 Ga0070694_1000034633 403
228 3300005445 Ga0070708_100000910 Ga0070708_10000091011 403
229 3300005455 Ga0070663_100089442 Ga0070663_1000894422 403
230 3300005456 Ga0070678_100070231 Ga0070678_1000702312 403
231 3300005456 Ga0070678_100130234 Ga0070678_1001302341 403
232 3300005459 Ga0068867_100039522 Ga0068867_1000395224 403
233 3300005459 Ga0068867_100085062 Ga0068867_1000850622 403
234 3300005467 Ga0070706_100004218 Ga0070706_10000421810 403
235 3300005471 Ga0070698_100065650 Ga0070698_1000656503 403
236 3300005471 Ga0070698_100094163 Ga0070698_1000941632 403
237 3300005536 Ga0070697_100005218 Ga0070697_1000052189 403
238 3300005543 Ga0070672_100017382 Ga0070672_1000173823 403
239 3300005543 Ga0070672_100171376 Ga0070672_1001713762 403
240 3300005544 Ga0070686_100032134 Ga0070686_1000321343 403
241 3300005544 Ga0070686_100036001 Ga0070686_1000360012 403
242 3300005548 Ga0070665_100013372 Ga0070665_1000133725 403
243 3300005548 Ga0070665_100097221 Ga0070665_1000972213 403
244 3300005548 Ga0070665_100139346 Ga0070665_1001393463 403
245 3300005548 Ga0070665_100165248 Ga0070665_1001652482 403
246 3300005564 Ga0070664_100110717 Ga0070664_1001107171 403
247 3300005614 Ga0068856_100007548 Ga0068856_1000075482 403
248 3300005614 Ga0068856_100091780 Ga0068856_1000917802 403
249 3300005617 Ga0068859_100001867 Ga0068859_1000018673 403
250 3300005617 Ga0068859_100033836 Ga0068859_1000338364 403
251 3300005617 Ga0068859_100109960 Ga0068859_1001099602 403
252 3300005617 Ga0068859_100209161 Ga0068859_1002091612 403
253 3300005617 Ga0068859_100217533 Ga0068859_1002175332 403
254 3300005618 Ga0068864_100060587 Ga0068864_1000605872 403
255 3300005618 Ga0068864_100074707 Ga0068864_1000747073 403
256 3300005618 Ga0068864_100136445 Ga0068864_1001364452 403
257 3300005618 Ga0068864_100147625 Ga0068864_1001476252 403
258 3300005618 Ga0068864_100226954 Ga0068864_1002269542 403
259 3300005718 Ga0068866_10037680 Ga0068866_100376802 403
260 3300005719 Ga0068861_100172315 Ga0068861_1001723152 403
261 3300005841 Ga0068863_100009364 Ga0068863_1000093643 403
262 3300005841 Ga0068863_100016748 Ga0068863_1000167482 403
263 3300005842 Ga0068858_100001137 Ga0068858_10000113729 403
264 3300005843 Ga0068860_100009086 Ga0068860_1000090868 403
265 3300005843 Ga0068860_100089427 Ga0068860_1000894273 403
266 3300005843 Ga0068860_100139827 Ga0068860_1001398272 403
267 3300005843 Ga0068860_100176554 Ga0068860_1001765542 403
268 3300005985 Ga0081539_10002981 Ga0081539_100029814 403
269 3300006051 Ga0075364_10022681 Ga0075364_100226813 403
270 3300006237 Ga0097621_100000341 Ga0097621_10000034111 403
271 3300006358 Ga0068871_100000340 Ga0068871_10000034021 403
272 3300006844 Ga0075428_100009361 Ga0075428_1000093614 403
273 3300006847 Ga0075431_100000953 Ga0075431_10000095325 403
274 3300006871 Ga0075434_100132465 Ga0075434_1001324651 403
275 3300006880 Ga0075429_100049672 Ga0075429_1000496722 403
276 3300006881 Ga0068865_100115834 Ga0068865_1001158342 403
277 3300006931 Ga0097620_100001867 Ga0097620_10000186719 403
278 3300006931 Ga0097620_100033837 Ga0097620_1000338372 403
279 3300006931 Ga0097620_100109957 Ga0097620_1001099572 403
280 3300006931 Ga0097620_100209161 Ga0097620_1002091612 403
281 3300006931 Ga0097620_100217534 Ga0097620_1002175342 403
282 3300007076 Ga0075435_100225529 Ga0075435_1002255292 403
283 3300009094 Ga0111539_10011257 Ga0111539_100112577 403
284 3300009094 Ga0111539_10012494 Ga0111539_100124948 403
285 3300009094 Ga0111539_10193743 Ga0111539_101937432 403
286 3300009101 Ga0105247_10000536 Ga0105247_1000053632 403
287 3300009147 Ga0114129_10047631 Ga0114129_100476313 403
288 3300009148 Ga0105243_10000027 Ga0105243_1000002731 403
289 3300009148 Ga0105243_10026660 Ga0105243_100266603 403
290 3300009176 Ga0105242_10000056 Ga0105242_1000005633 403
291 3300009176 Ga0105242_10019209 Ga0105242_100192092 403
292 3300009177 Ga0105248_10001767 Ga0105248_1000176719 403
293 3300009551 Ga0105238_10104209 Ga0105238_101042091 403
294 3300010375 Ga0105239_10092011 Ga0105239_100920113 403
295 3300010375 Ga0105239_10247816 Ga0105239_102478161 403
296 3300011119 Ga0105246_10062594 Ga0105246_100625943 403
297 3300013100 Ga0157373_10081491 Ga0157373_100814912 403
298 3300013297 Ga0157378_10026566 Ga0157378_100265663 403
299 3300013308 Ga0157375_10003297 Ga0157375_100032972 403
300 3300013308 Ga0157375_10034015 Ga0157375_100340152 403
301 3300013308 Ga0157375_10081078 Ga0157375_100810782 403
302 3300014325 Ga0163163_10118360 Ga0163163_101183603 403
303 3300014326 Ga0157380_10022220 Ga0157380_100222205 403
304 3300014968 Ga0157379_10103279 Ga0157379_101032792 403
305 3300014969 Ga0157376_10002143 Ga0157376_100021438 403
306 3300025893 Ga0207682_10004090 Ga0207682_100040901 403
307 3300025899 Ga0207642_10011050 Ga0207642_100110502 403
308 3300025900 Ga0207710_10000212 Ga0207710_100002126 403
309 3300025903 Ga0207680_10042657 Ga0207680_100426573 403
310 3300025904 Ga0207647_10041567 Ga0207647_100415673 403
311 3300025907 Ga0207645_10005982 Ga0207645_100059823 403
312 3300025907 Ga0207645_10034632 Ga0207645_100346323 403
313 3300025908 Ga0207643_10033243 Ga0207643_100332434 403
314 3300025908 Ga0207643_10034714 Ga0207643_100347142 403
315 3300025910 Ga0207684_10009547 Ga0207684_100095472 403
316 3300025912 Ga0207707_10079691 Ga0207707_100796913 403
317 3300025915 Ga0207693_10135545 Ga0207693_101355452 403
318 3300025915 Ga0207693_10227210 Ga0207693_102272101 403
319 3300025918 Ga0207662_10008551 Ga0207662_100085513 403
320 3300025925 Ga0207650_10062156 Ga0207650_100621562 403
321 3300025926 Ga0207659_10007853 Ga0207659_100078535 403
322 3300025926 Ga0207659_10034596 Ga0207659_100345962 403
323 3300025932 Ga0207690_10000285 Ga0207690_1000028525 403
324 3300025932 Ga0207690_10006534 Ga0207690_100065342 403
325 3300025933 Ga0207706_10019662 Ga0207706_100196624 403
326 3300025933 Ga0207706_10021575 Ga0207706_100215752 403
327 3300025934 Ga0207686_10000008 Ga0207686_1000000831 403
328 3300025935 Ga0207709_10000025 Ga0207709_10000025113 403
329 3300025935 Ga0207709_10060507 Ga0207709_100605071 403
330 3300025936 Ga0207670_10049975 Ga0207670_100499752 403
331 3300025936 Ga0207670_10158529 Ga0207670_101585292 403
332 3300025940 Ga0207691_10033968 Ga0207691_100339683 403
333 3300025940 Ga0207691_10048351 Ga0207691_100483512 403
334 3300025941 Ga0207711_10156128 Ga0207711_101561282 403
335 3300025942 Ga0207689_10093223 Ga0207689_100932232 403
336 3300025949 Ga0207667_10054538 Ga0207667_100545381 403
337 3300025960 Ga0207651_10082766 Ga0207651_100827662 403
338 3300025972 Ga0207668_10146301 Ga0207668_101463012 403
339 3300025986 Ga0207658_10001950 Ga0207658_1000195017 403
340 3300025986 Ga0207658_10042978 Ga0207658_100429784 403
341 3300025986 Ga0207658_10073339 Ga0207658_100733392 403
342 3300026035 Ga0207703_10103256 Ga0207703_101032562 403
343 3300026067 Ga0207678_10088781 Ga0207678_100887812 403
344 3300026088 Ga0207641_10015006 Ga0207641_100150064 403
345 3300026088 Ga0207641_10029705 Ga0207641_100297053 403
346 3300026089 Ga0207648_10025223 Ga0207648_100252234 403
347 3300026089 Ga0207648_10161616 Ga0207648_101616162 403
348 3300026095 Ga0207676_10024024 Ga0207676_100240244 403
349 3300026095 Ga0207676_10062583 Ga0207676_100625833 403
350 3300026095 Ga0207676_10080407 Ga0207676_100804072 403
351 3300026095 Ga0207676_10188342 Ga0207676_101883422 403
352 3300026116 Ga0207674_10128453 Ga0207674_101284533 403
353 3300026116 Ga0207674_10139849 Ga0207674_101398492 403
354 3300026118 Ga0207675_100052985 Ga0207675_1000529853 403
355 3300026121 Ga0207683_10056723 Ga0207683_100567232 403
356 3300027907 Ga0207428_10032544 Ga0207428_100325443 403
357 3300027907 Ga0207428_10076265 Ga0207428_100762653 403
358 3300028381 Ga0268264_10119343 Ga0268264_101193432 403
359 3300028381 Ga0268264_10195996 Ga0268264_101959961 403
360 3300031456 Ga0307513_10008910 Ga0307513_100089103 403
361 3300031456 Ga0307513_10124642 Ga0307513_101246422 403
362 3300031507 Ga0307509_10038884 Ga0307509_100388845 403
363 3300031616 Ga0307508_10026468 Ga0307508_100264682 403
364 3300031901 Ga0307406_10095122 Ga0307406_100951222 403
365 3300036401 Ga0373937_0035783 Ga0373937_0035783_2813_4192 403
366 3300038443 Ga0395901_0000604 Ga0395901_0000604_15632_16954 403
367 3300042876 Ga0451577_0022660 Ga0451577_0022660_3251_4582 403
368 3300044712 Ga0453684_0080848 Ga0453684_0080848_2127_3458 403
369 3300046460 Ga0495638_0009044 Ga0495638_0009044_1761_3077 403
370 3300046473 Ga0495582_0015610 Ga0495582_0015610_1107_2486 403
371 3300046473 Ga0495582_0027993 Ga0495582_0027993_663_2015 403
372 3300046557 Ga0495622_0032975 Ga0495622_0032975_718_2031 403
373 3300046615 Ga0495656_0075157 Ga0495656_0075157_56_1405 403
374 3300046683 Ga0495658_0078192 Ga0495658_0078192_354_1688 403
375 3300046809 Ga0495600_0096360 Ga0495600_0096360_36_1346 403
376 3300047317 Ga0495604_0021923 Ga0495604_0021923_1088_2410 403
377 3300047318 Ga0495636_0024179 Ga0495636_0024179_225_1562 403
378 3300047319 Ga0495674_0039335 Ga0495674_0039335_1519_2841 403
379 3300047472 Ga0495686_0000946 Ga0495686_0000946_16796_18094 403
380 3300048904 Ga0496101_0167343 Ga0496101_0167343_245_1621 403
381 3300048907 Ga0496104_0010105 Ga0496104_0010105_5514_6857 403
382 3300048907 Ga0496104_0053242 Ga0496104_0053242_944_2200 403
383 3300048907 Ga0496104_0144011 Ga0496104_0144011_679_2004 403
384 3300048907 Ga0496104_0244461 Ga0496104_0244461_60_1436 403
385 3300048909 Ga0496106_0002225 Ga0496106_0002225_750_2126 403
386 3300048910 Ga0496107_0008832 Ga0496107_0008832_74_1450 403
387 3300048910 Ga0496107_0174424 Ga0496107_0174424_141_1451 403
388 3300048911 Ga0496108_0017834 Ga0496108_0017834_432_1688 403
389 3300048911 Ga0496108_0029664 Ga0496108_0029664_140_1516 403
390 3300048912 Ga0496109_0000397 Ga0496109_0000397_34208_35548 403
391 3300048912 Ga0496109_0021919 Ga0496109_0021919_788_2044 403
392 3300048913 Ga0496110_0120299 Ga0496110_0120299_24_1280 403
393 3300048913 Ga0496110_0166949 Ga0496110_0166949_540_1916 403
394 3300048913 Ga0496110_0241307 Ga0496110_0241307_110_1417 403
395 3300048914 Ga0496111_0150980 Ga0496111_0150980_191_1447 403
396 3300048915 Ga0496112_0007198 Ga0496112_0007198_1790_3046 403
397 3300048915 Ga0496112_0038969 Ga0496112_0038969_2290_3642 403
398 3300048916 Ga0496113_0056408 Ga0496113_0056408_1599_2855 403
399 3300048917 Ga0496114_0000550 Ga0496114_0000550_7149_8441 403
400 3300048917 Ga0496114_0305663 Ga0496114_0305663_44_1351 403
401 3300048924 Ga0496121_0001659 Ga0496121_0001659_16839_18191 403
402 3300048928 Ga0496125_0031533 Ga0496125_0031533_3351_4703 403
403 3300049586 Ga0501070_0021035 Ga0501070_0021035_22_1335 403
404 3300049587 Ga0501071_0055916 Ga0501071_0055916_1401_2714 403
405 3300049823 Ga0501044_0188823 Ga0501044_0188823_385_1698 403
406 3300050507 nmdc:mga05p37_10270_c1 nmdc:mga05p37_10270_c1_3997_5304 403
407 3300050507 nmdc:mga05p37_65248_c2 nmdc:mga05p37_65248_c2_491_1831 403
408 3300050508 nmdc:mga09592_46066_c1 nmdc:mga09592_46066_c1_1027_2334 403
409 3300050510 nmdc:mga06r32_2052_c1 nmdc:mga06r32_2052_c1_4918_6225 403
410 3300050510 nmdc:mga06r32_27220_c1 nmdc:mga06r32_27220_c1_2642_3982 403
411 3300050511 nmdc:mga08y16_19632_c1 nmdc:mga08y16_19632_c1_4138_5463 403
412 3300050511 nmdc:mga08y16_22652_c1 nmdc:mga08y16_22652_c1_2397_3695 403
413 3300050512 nmdc:mga0n895_105123_c1 nmdc:mga0n895_105123_c1_478_1818 403
414 3300050512 nmdc:mga0n895_109161_c1 nmdc:mga0n895_109161_c1_207_1577 403
415 3300050513 nmdc:mga0rr50_277887_c1 nmdc:mga0rr50_277887_c1_40_1377 403
416 3300053077 Ga0495601_0023428 Ga0495601_0023428_1092_2423 403
417 3300053077 Ga0495601_0029769 Ga0495601_0029769_376_1710 403
418 3300053077 Ga0495601_0075424 Ga0495601_0075424_652_1956 403
419 3300053085 Ga0495619_0007794 Ga0495619_0007794_2025_3329 403
420 3300053139 Ga0500568_0005076 Ga0500568_0005076_5047_6303 403
421 3300053153 Ga0500616_0065689 Ga0500616_0065689_273_1562 403
422 3300053156 Ga0500622_0020874 Ga0500622_0020874_782_2176 403
423 3300060353 Ga0501082_0206453 Ga0501082_0206453_176_1516 403
424 3300005330 Ga0070690_100021025 Ga0070690_1000210253 404
425 3300005334 Ga0068869_100064706 Ga0068869_1000647062 404
426 3300005367 Ga0070667_100047243 Ga0070667_1000472432 404
427 3300005544 Ga0070686_100002579 Ga0070686_1000025799 404
428 3300005548 Ga0070665_100107039 Ga0070665_1001070392 404
429 3300005564 Ga0070664_100006087 Ga0070664_1000060877 404
430 3300005617 Ga0068859_100066772 Ga0068859_1000667722 404
431 3300005617 Ga0068859_100103335 Ga0068859_1001033353 404
432 3300005840 Ga0068870_10001259 Ga0068870_1000125912 404
433 3300006931 Ga0097620_100066769 Ga0097620_1000667692 404
434 3300006931 Ga0097620_100103322 Ga0097620_1001033222 404
435 3300009094 Ga0111539_10050704 Ga0111539_100507043 404
436 3300025907 Ga0207645_10013082 Ga0207645_1001308210 404
437 3300025908 Ga0207643_10000629 Ga0207643_1000062910 404
438 3300025926 Ga0207659_10001820 Ga0207659_1000182011 404
439 3300025940 Ga0207691_10064511 Ga0207691_100645113 404
440 3300025941 Ga0207711_10040534 Ga0207711_100405343 404
441 3300025942 Ga0207689_10070618 Ga0207689_100706182 404
442 3300025945 Ga0207679_10002837 Ga0207679_100028376 404
443 3300025960 Ga0207651_10010900 Ga0207651_100109007 404
444 3300026089 Ga0207648_10095090 Ga0207648_100950902 404
445 3300026121 Ga0207683_10062019 Ga0207683_100620192 404
446 3300027907 Ga0207428_10039155 Ga0207428_100391551 404
447 3300050511 nmdc:mga08y16_54337_c1 nmdc:mga08y16_54337_c1_2725_4113 404
448 iso_pu_bacteria 2537561836 2538834715 404
449 iso_pu_bacteria 2643221562 2643830959 404
450 3300005530 Ga0070679_100098463 Ga0070679_1000984633 405
451 3300009093 Ga0105240_10001400 Ga0105240_1000140028 405
452 3300025913 Ga0207695_10000943 Ga0207695_1000094322 405
453 3300046491 Ga0495584_0061669 Ga0495584_0061669_48_1406 405
454 3300048917 Ga0496114_0204193 Ga0496114_0204193_336_1601 405
455 3300048918 Ga0496115_0000354 Ga0496115_0000354_36652_37917 405
456 3300049586 Ga0501070_0104110 Ga0501070_0104110_592_1920 405
457 3300049593 Ga0501077_0004900 Ga0501077_0004900_4863_6191 405
458 3300005467 Ga0070706_100008230 Ga0070706_1000082308 406
459 3300005578 Ga0068854_100021063 Ga0068854_1000210632 406
460 3300005614 Ga0068856_100000086 Ga0068856_1000000864 406
461 3300006358 Ga0068871_100029051 Ga0068871_1000290514 406
462 3300009545 Ga0105237_10000070 Ga0105237_1000007063 406
463 3300009551 Ga0105238_10000736 Ga0105238_1000073630 406
464 3300014969 Ga0157376_10007517 Ga0157376_100075174 406
465 3300025250 Ga0209026_1000378 Ga0209026_10003786 406
466 3300025256 Ga0209759_1021271 Ga0209759_10212711 406
467 3300025256 Ga0209759_1021272 Ga0209759_10212721 406
468 3300025914 Ga0207671_10000429 Ga0207671_1000042960 406
469 3300025924 Ga0207694_10006182 Ga0207694_100061828 406
470 3300026067 Ga0207678_10038003 Ga0207678_100380034 406
471 3300026078 Ga0207702_10000160 Ga0207702_1000016017 406
472 3300053178 Ga0500637_0017899 Ga0500637_0017899_1370_2719 406
473 3300005327 Ga0070658_10004926 Ga0070658_100049264 411
474 3300005548 Ga0070665_100014505 Ga0070665_1000145056 411
475 3300025909 Ga0207705_10001527 Ga0207705_1000152710 411
476 3300005335 Ga0070666_10000010 Ga0070666_10000010217 416
477 3300028380 Ga0268265_10112366 Ga0268265_101123661 428
478 3300003320 rootH2_10274347 rootH2_102743471 438

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nzg-assembly1.cif.gz_B bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine 0.7266 39 202
6d50-assembly1.cif.gz_B bacteroides uniforms beta-glucuronidase 2 bound to d-glucaro-1,5-lactone 0.7242 39 202
5uj6-assembly1.cif.gz_A crystal structure of bacteroides uniformis beta-glucuronidase 0.7213 39 202
8dhl-assembly1.cif.gz_A tannerella forsythia beta-glucuronidase (l2) 0.7178 39 200
6d8g-assembly1.cif.gz_B d341a d367a calcium binding mutant of bacteroides uniformis beta-glucuronidase 2 0.7045 39 200
ID Description Score Start End Superfamily
5t99B01 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7548 39 202 2.60.120.260
5uj6B01 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7218 39 200 2.60.120.260
5t99B01 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7135 39 202 2.60.120.260
af_Q54MB2_1_312_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.708 220 424 1.20.1070.10
6ed1D01 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7014 38 203 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A328P713-F1-model_v4 Glycoside hydrolase 0.9381 42 436 GO:0016020
AF-A0A3S0RF82-F1-model_v4 Glycoside hydrolase 0.9287 35 430 GO:0016020
GO:0016787
AF-A0A525JGG7-F1-model_v4 Glycoside hydrolase 0.9205 38 429 GO:0016020
GO:0016787
AF-A0A2T5LFH6-F1-model_v4 Uncharacterized protein 0.9197 201 434 GO:0016020
AF-A0A1V3PP40-F1-model_v4 Beta-galactosidase 0.9178 39 200

Feature Viewer

pLDDT pTM Quality
83.24 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map