F451884

General Info

Members Datasets Scaffolds Average Seq Length
478 264 461 310

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10061865|Ga0207645_100618652
Length 358
Sequence MQCGNSEEDAPLERRAPSASPSEIKKRTAFRDDSSSDAGDLMILYALRRLIYLVPVAFGVSLLVFALVHLAPGDPISAIVPPDTPKEVVDKLKEYYGFDKPLPVQYVRWLLVTLSGDFGTSIGTGRPVSQEVGSAFGNTIILAIAACCLAFSLAIFLGTAAAYAKSRIVDRLVTSIALVGVSVPHFWLAIVLVIIFSVELGMLPPMGLGPENATGWRLDWPHIRHMILPTIALSVIPLGVMTRTVRSTIKEILSMEFVTALQAKGMNDRQILFHVLKNAAPVCLAVMGLQAGNLIGGSILIETVFAWPGTGFLLNSAIFRRDLPILQGTTLVLAFFFMMLNLTVDVIQTLVDPRIKRG

Samples

Sample ID Description Type Environment
1 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
2 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
3 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
4 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
5 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
6 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
7 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
8 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
9 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
10 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
11 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
12 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
233 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
237 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
240 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
241 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
244 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
247 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
248 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
249 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
250 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
251 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
252 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
253 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
254 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
255 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
261 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
262 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
263 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
264 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.04
Nodule 0.84
Rhizoplane 2.93
Rhizosphere 79.92
Stem 0
Stem Tuber 0
Unclassified 6.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10013058 3300003203 Bacteria 3585
2 JGI25406J46586_10020886 3300003203 Bacteria 2637
3 Ga0055536_1010640 3300003781 Bacteria 3623
4 Ga0070683_100032765 3300005329 Bacteria 4735
5 Ga0070683_100034925 3300005329 Bacteria 4595
6 Ga0070690_100234566 3300005330 Bacteria 1291
7 Ga0068869_100020455 3300005334 Bacteria 4538
8 Ga0070680_100024355 3300005336 Bacteria 4835
9 Ga0070680_100035760 3300005336 Bacteria 4011
10 Ga0070680_100094711 3300005336 Bacteria 2475
11 Ga0068868_100230085 3300005338 Bacteria 1555
12 Ga0070689_100101081 3300005340 Bacteria 2282
13 Ga0070691_10003803 3300005341 Bacteria 6817
14 Ga0070661_100029732 3300005344 Bacteria 3944
15 Ga0070692_10078739 3300005345 Bacteria 1770
16 Ga0070675_100350911 3300005354 Bacteria 1308
17 Ga0070671_100301100 3300005355 Bacteria 1365
18 Ga0070674_100206160 3300005356 Bacteria 1521
19 Ga0070673_100232252 3300005364 Bacteria 1600
20 Ga0070667_100110022 3300005367 Bacteria 2388
21 Ga0070667_100220735 3300005367 Bacteria 1687
22 Ga0070714_100151670 3300005435 Bacteria 2089
23 Ga0070713_100021523 3300005436 Bacteria 4962
24 Ga0070713_100291907 3300005436 Bacteria 1499
25 Ga0070701_10021346 3300005438 Bacteria 3088
26 Ga0070711_100080862 3300005439 Bacteria 2315
27 Ga0070711_100106812 3300005439 Bacteria 2047
28 Ga0070705_100002651 3300005440 Bacteria 8953
29 Ga0070705_100025177 3300005440 Bacteria 3223
30 Ga0070700_100079015 3300005441 Bacteria 2119
31 Ga0070694_100026319 3300005444 Bacteria 3769
32 Ga0070694_100091936 3300005444 Bacteria 2131
33 Ga0070708_100004836 3300005445 Bacteria 10627
34 Ga0070708_100025333 3300005445 Bacteria 5070
35 Ga0070708_100037885 3300005445 Bacteria 4208
36 Ga0070708_100085039 3300005445 Bacteria 2870
37 Ga0070708_100086431 3300005445 Bacteria 2848
38 Ga0070708_100184320 3300005445 Bacteria 1952
39 Ga0070708_100249396 3300005445 Bacteria 1668
40 Ga0070708_100257424 3300005445 Bacteria 1640
41 Ga0070663_100100553 3300005455 Bacteria 2157
42 Ga0070678_100123342 3300005456 Bacteria 2047
43 Ga0070662_100023349 3300005457 Bacteria 4246
44 Ga0070662_100216518 3300005457 Bacteria 1526
45 Ga0068867_100465959 3300005459 Bacteria 1080
46 Ga0070706_100015721 3300005467 Bacteria 6990
47 Ga0070706_100070677 3300005467 Bacteria 3228
48 Ga0070707_100001920 3300005468 Bacteria 19925
49 Ga0070707_100054467 3300005468 Bacteria 3835
50 Ga0070707_100118421 3300005468 Bacteria 2571
51 Ga0070698_100004284 3300005471 Bacteria 15685
52 Ga0070698_100012971 3300005471 Bacteria 8823
53 Ga0070698_100074615 3300005471 Bacteria 3397
54 Ga0070698_100153720 3300005471 Bacteria 2247
55 Ga0070699_100003894 3300005518 Bacteria 13196
56 Ga0070699_100017468 3300005518 Bacteria 6157
57 Ga0070699_100017551 3300005518 Bacteria 6144
58 Ga0070699_100022313 3300005518 Bacteria 5455
59 Ga0070699_100025344 3300005518 Bacteria 5114
60 Ga0070679_100058897 3300005530 Bacteria 3827
61 Ga0070679_100111178 3300005530 Bacteria 2726
62 Ga0070684_100008642 3300005535 Bacteria 7979
63 Ga0070697_100000306 3300005536 Bacteria 38931
64 Ga0070697_100041375 3300005536 Bacteria 3730
65 Ga0070697_100083316 3300005536 Bacteria 2637
66 Ga0070695_100076713 3300005545 Bacteria 2201
67 Ga0070695_100163884 3300005545 Bacteria 1563
68 Ga0070696_100037251 3300005546 Bacteria 3355
69 Ga0070696_100301734 3300005546 Bacteria 1227
70 Ga0070704_100484276 3300005549 Bacteria 1071
71 Ga0068855_100110769 3300005563 Bacteria 3151
72 Ga0068857_100027450 3300005577 Bacteria 5022
73 Ga0068856_100034736 3300005614 Bacteria 4939
74 Ga0068856_100207576 3300005614 Bacteria 1973
75 Ga0070702_100172618 3300005615 Bacteria 1408
76 Ga0068859_100033454 3300005617 Bacteria 5162
77 Ga0068859_100070062 3300005617 Bacteria 3542
78 Ga0068859_100186589 3300005617 Bacteria 2157
79 Ga0068870_10013007 3300005840 Bacteria 3900
80 Ga0068863_100050263 3300005841 Bacteria 3952
81 Ga0068863_100228882 3300005841 Bacteria 1793
82 Ga0068858_100270625 3300005842 Bacteria 1617
83 Ga0068858_100478145 3300005842 Bacteria 1202
84 Ga0068860_100099808 3300005843 Bacteria 2769
85 Ga0068860_100206669 3300005843 Bacteria 1904
86 Ga0068862_100011546 3300005844 Bacteria 7288
87 Ga0068862_100105229 3300005844 Bacteria 2473
88 Ga0068862_100164894 3300005844 Bacteria 1980
89 Ga0068862_100228563 3300005844 Bacteria 1687
90 Ga0081455_10001267 3300005937 Bacteria 31568
91 Ga0081455_10051457 3300005937 Bacteria 3533
92 Ga0081455_10194188 3300005937 Bacteria 1526
93 Ga0081538_10041497 3300005981 Bacteria 2919
94 Ga0081540_1011593 3300005983 Bacteria 5884
95 Ga0081539_10000002 3300005985 Bacteria 601032
96 Ga0081539_10001636 3300005985 Bacteria 36507
97 Ga0081539_10015058 3300005985 Bacteria 5663
98 Ga0081539_10015289 3300005985 Bacteria 5588
99 Ga0070717_10392008 3300006028 Bacteria 1246
100 Ga0075365_10013672 3300006038 Bacteria 4866
101 Ga0075363_100046090 3300006048 Bacteria 2312
102 Ga0075364_10000505 3300006051 Bacteria 19862
103 Ga0075364_10242019 3300006051 Bacteria 1225
104 Ga0070712_100162069 3300006175 Bacteria 1728
105 Ga0075362_10002007 3300006177 Bacteria 6701
106 Ga0075362_10019863 3300006177 Bacteria 2800
107 Ga0075367_10017571 3300006178 Bacteria 3929
108 Ga0075367_10183781 3300006178 Bacteria 1304
109 Ga0075366_10011825 3300006195 Bacteria 4937
110 Ga0075428_100000401 3300006844 Bacteria 42962
111 Ga0075428_100015828 3300006844 Bacteria 8350
112 Ga0075428_100022877 3300006844 Bacteria 6916
113 Ga0075428_100155813 3300006844 Bacteria 2482
114 Ga0075428_100358852 3300006844 Bacteria 1564
115 Ga0075430_100000656 3300006846 Bacteria 26394
116 Ga0075430_100000986 3300006846 Bacteria 22472
117 Ga0075430_100048144 3300006846 Bacteria 3600
118 Ga0075430_100081661 3300006846 Bacteria 2708
119 Ga0075430_100090233 3300006846 Bacteria 2564
120 Ga0075430_100124329 3300006846 Bacteria 2150
121 Ga0075430_100185850 3300006846 Bacteria 1728
122 Ga0075431_100000044 3300006847 Bacteria 65584
123 Ga0075431_100003635 3300006847 Bacteria 14948
124 Ga0075431_100005687 3300006847 Bacteria 12318
125 Ga0075431_100010929 3300006847 Bacteria 9133
126 Ga0075431_100037812 3300006847 Bacteria 4970
127 Ga0075431_100037923 3300006847 Bacteria 4962
128 Ga0075431_100147327 3300006847 Bacteria 2425
129 Ga0075431_100213060 3300006847 Bacteria 1973
130 Ga0075433_10000086 3300006852 Bacteria 42813
131 Ga0075433_10000254 3300006852 Bacteria 31002
132 Ga0075433_10086649 3300006852 Bacteria 2765
133 Ga0075434_100000607 3300006871 Bacteria 27762
134 Ga0075434_100028183 3300006871 Bacteria 5517
135 Ga0075434_100054284 3300006871 Bacteria 3981
136 Ga0075434_100136984 3300006871 Bacteria 2467
137 Ga0075434_100170342 3300006871 Bacteria 2197
138 Ga0075429_100001283 3300006880 Bacteria 20443
139 Ga0075429_100005659 3300006880 Bacteria 10779
140 Ga0075429_100021840 3300006880 Bacteria 5549
141 Ga0075429_100071549 3300006880 Bacteria 3020
142 Ga0075429_100081271 3300006880 Bacteria 2825
143 Ga0075429_100093197 3300006880 Bacteria 2627
144 Ga0075429_100314336 3300006880 Bacteria 1371
145 Ga0097620_100033454 3300006931 Bacteria 5162
146 Ga0097620_100070066 3300006931 Bacteria 3542
147 Ga0097620_100186589 3300006931 Bacteria 2157
148 Ga0075435_100011744 3300007076 Bacteria 6462
149 Ga0075435_100012307 3300007076 Bacteria 6329
150 Ga0075435_100022696 3300007076 Bacteria 4843
151 Ga0075435_100022762 3300007076 Bacteria 4836
152 Ga0075435_100038399 3300007076 Bacteria 3817
153 Ga0075435_100039189 3300007076 Bacteria 3781
154 Ga0099794_10009671 3300007265 Bacteria 4066
155 Ga0099794_10024052 3300007265 Bacteria 2792
156 Ga0099794_10034025 3300007265 Bacteria 2398
157 Ga0099795_10038470 3300007788 Bacteria 1688
158 Ga0105240_10241125 3300009093 Bacteria 2095
159 Ga0111539_10000882 3300009094 Bacteria 39163
160 Ga0111539_10002669 3300009094 Bacteria 23627
161 Ga0111539_10043476 3300009094 Bacteria 5386
162 Ga0111539_10076635 3300009094 Bacteria 3937
163 Ga0114129_10000089 3300009147 Bacteria 86570
164 Ga0114129_10000385 3300009147 Bacteria 51411
165 Ga0114129_10001642 3300009147 Bacteria 30374
166 Ga0114129_10001648 3300009147 Bacteria 30350
167 Ga0114129_10003578 3300009147 Bacteria 21865
168 Ga0114129_10010238 3300009147 Bacteria 13377
169 Ga0114129_10088019 3300009147 Bacteria 4306
170 Ga0114129_10099954 3300009147 Bacteria 4014
171 Ga0114129_10127077 3300009147 Bacteria 3505
172 Ga0114129_10374072 3300009147 Bacteria 1882
173 Ga0114129_10487191 3300009147 Bacteria 1612
174 Ga0105243_10045119 3300009148 Bacteria 3462
175 Ga0105243_10082060 3300009148 Bacteria 2634
176 Ga0105243_10225603 3300009148 Bacteria 1659
177 Ga0105241_10275061 3300009174 Bacteria 1436
178 Ga0105242_10152184 3300009176 Bacteria 2018
179 Ga0105242_10476777 3300009176 Bacteria 1182
180 Ga0105248_10200788 3300009177 Bacteria 2246
181 Ga0105237_10024949 3300009545 Bacteria 6116
182 Ga0105238_10004760 3300009551 Bacteria 13427
183 Ga0105238_10227639 3300009551 Bacteria 1841
184 Ga0105249_10048044 3300009553 Bacteria 3891
185 Ga0105249_10083571 3300009553 Bacteria 2972
186 Ga0105249_10296720 3300009553 Bacteria 1619
187 Ga0105239_10043978 3300010375 Bacteria 4897
188 Ga0105246_10136393 3300011119 Bacteria 1840
189 Ga0157371_10063448 3300013102 Bacteria 2618
190 Ga0157370_10335545 3300013104 Bacteria 1394
191 Ga0157369_10039349 3300013105 Bacteria 5168
192 Ga0157378_10110795 3300013297 Bacteria 2516
193 Ga0157378_10608440 3300013297 Bacteria 1105
194 Ga0163162_10048372 3300013306 Bacteria 4260
195 Ga0163162_10096407 3300013306 Bacteria 3046
196 Ga0157372_10012094 3300013307 Bacteria 9192
197 Ga0157375_10235742 3300013308 Bacteria 1989
198 Ga0163163_10106486 3300014325 Bacteria 2830
199 Ga0213873_10003417 3300021358 Bacteria 2858
200 Ga0213872_10105124 3300021361 Bacteria 1257
201 Ga0213876_10001802 3300021384 Bacteria 12976
202 Ga0213876_10088217 3300021384 Bacteria 1643
203 Ga0213875_10003536 3300021388 Bacteria 8878
204 Ga0209676_1000515 3300025292 Bacteria 60624
205 Ga0207426_1023005 3300025302 Bacteria 2131
206 Ga0207688_10211110 3300025901 Bacteria 1166
207 Ga0207647_10094125 3300025904 Bacteria 1785
208 Ga0207645_10061865 3300025907 Bacteria 2391
209 Ga0207643_10076651 3300025908 Bacteria 1932
210 Ga0207684_10000961 3300025910 Bacteria 32329
211 Ga0207684_10014776 3300025910 Bacteria 6723
212 Ga0207684_10029829 3300025910 Bacteria 4644
213 Ga0207684_10082200 3300025910 Bacteria 2742
214 Ga0207684_10131451 3300025910 Bacteria 2148
215 Ga0207695_10172896 3300025913 Bacteria 2085
216 Ga0207693_10004401 3300025915 Bacteria 11915
217 Ga0207693_10021191 3300025915 Bacteria 5166
218 Ga0207660_10317906 3300025917 Bacteria 1243
219 Ga0207649_10380997 3300025920 Bacteria 1051
220 Ga0207652_10126273 3300025921 Bacteria 2279
221 Ga0207646_10144020 3300025922 Bacteria 2147
222 Ga0207646_10414366 3300025922 Bacteria 1216
223 Ga0207694_10024264 3300025924 Bacteria 4604
224 Ga0207700_10051759 3300025928 Bacteria 3066
225 Ga0207700_10355210 3300025928 Bacteria 1277
226 Ga0207664_10129459 3300025929 Bacteria 2123
227 Ga0207690_10040205 3300025932 Bacteria 3056
228 Ga0207706_10017568 3300025933 Bacteria 6446
229 Ga0207706_10215142 3300025933 Bacteria 1684
230 Ga0207686_10317894 3300025934 Bacteria 1162
231 Ga0207709_10012047 3300025935 Bacteria 4769
232 Ga0207709_10162088 3300025935 Bacteria 1560
233 Ga0207670_10177992 3300025936 Bacteria 1600
234 Ga0207669_10325192 3300025937 Bacteria 1179
235 Ga0207704_10107635 3300025938 Bacteria 1876
236 Ga0207665_10068045 3300025939 Bacteria 2426
237 Ga0207691_10123895 3300025940 Bacteria 2288
238 Ga0207691_10133480 3300025940 Bacteria 2191
239 Ga0207689_10039586 3300025942 Bacteria 3902
240 Ga0207689_10119653 3300025942 Bacteria 2167
241 Ga0207661_10136046 3300025944 Bacteria 2110
242 Ga0207679_10103493 3300025945 Bacteria 2231
243 Ga0207667_10124639 3300025949 Bacteria 2653
244 Ga0207712_10103570 3300025961 Bacteria 2121
245 Ga0207677_10295220 3300026023 Bacteria 1337
246 Ga0207703_10347028 3300026035 Bacteria 1366
247 Ga0207708_10016820 3300026075 Bacteria 5507
248 Ga0207674_10021563 3300026116 Bacteria 6935
249 Ga0207675_100090798 3300026118 Bacteria 2872
250 Ga0207683_10042075 3300026121 Bacteria 3990
251 Ga0207683_10104496 3300026121 Bacteria 2531
252 Ga0207698_10560681 3300026142 Bacteria 1121
253 Ga0209281_1000118 3300027111 Bacteria 208448
254 Ga0209971_1023966 3300027682 Bacteria 1457
255 Ga0207428_10000013 3300027907 Bacteria 346742
256 Ga0207428_10000199 3300027907 Bacteria 83918
257 Ga0207428_10014855 3300027907 Bacteria 6744
258 Ga0207428_10019656 3300027907 Bacteria 5757
259 Ga0268266_10030102 3300028379 Bacteria 4612
260 Ga0268265_10009505 3300028380 Bacteria 6566
261 Ga0268265_10088055 3300028380 Bacteria 2473
262 Ga0268265_10262242 3300028380 Bacteria 1537
263 Ga0268264_10178222 3300028381 Bacteria 1928
264 Ga0268264_10554484 3300028381 Bacteria 1127
265 Ga0265340_10021577 3300031247 Bacteria 3303
266 Ga0307408_100161999 3300031548 Bacteria 1778
267 Ga0265342_10161745 3300031712 Bacteria 1237
268 Ga0307416_100007039 3300032002 Bacteria 7100
269 Ga0373926_0013661 3300035083 Bacteria 2756
270 Ga0373941_0004372 3300035115 Bacteria 3261
271 Ga0373946_0032929 3300035171 Bacteria 2084
272 Ga0373946_0103361 3300035171 Bacteria 1280
273 Ga0373955_0315339 3300035172 Bacteria 944
274 Ga0373961_0037023 3300035241 Bacteria 1392
275 Ga0373931_0009179 3300035691 Bacteria 4723
276 Ga0373931_0021535 3300035691 Bacteria 3235
277 Ga0373935_0178499 3300035692 Bacteria 1457
278 Ga0373937_0079290 3300036401 Bacteria 3035
279 Ga0373937_0169183 3300036401 Bacteria 2050
280 Ga0373925_0120826 3300037068 Bacteria 2033
281 Ga0373925_0170406 3300037068 Bacteria 1719
282 Ga0373925_0208466 3300037068 Bacteria 1556
283 Ga0395899_0013475 3300037312 Bacteria 6251
284 Ga0395899_0189044 3300037312 Bacteria 1441
285 Ga0395900_0016407 3300037418 Bacteria 7551
286 Ga0395900_0022757 3300037418 Bacteria 6413
287 Ga0395900_0134976 3300037418 Bacteria 2528
288 Ga0395900_0219818 3300037418 Bacteria 1915
289 Ga0395898_0002087 3300037466 Bacteria 24849
290 Ga0395898_0011147 3300037466 Bacteria 9360
291 Ga0395905_0141134 3300037471 Bacteria 2266
292 Ga0436364_0145704 3300037853 Bacteria 13335
293 Ga0436364_0332953 3300037853 Bacteria 1435
294 Ga0436364_0600115 3300037853 Bacteria 1215
295 Ga0436364_1343361 3300037853 Bacteria 5322
296 Ga0395901_0000729 3300038443 Bacteria 37396
297 Ga0395901_0007831 3300038443 Bacteria 10781
298 Ga0395901_0094611 3300038443 Bacteria 3130
299 Ga0242420_018853 3300038996 Bacteria 1218
300 Ga0436365_0467338 3300039437 Bacteria 3865
301 Ga0436365_1424493 3300039437 Bacteria 16000
302 Ga0436365_1712476 3300039437 Bacteria 1458
303 Ga0436360_0935449 3300039438 Bacteria 1958
304 Ga0436360_1221680 3300039438 Bacteria 1595
305 Ga0436360_1226403 3300039438 Bacteria 3985
306 Ga0436360_1285854 3300039438 Bacteria 1123
307 Ga0436361_0550158 3300039447 Bacteria 1635
308 Ga0436361_0677196 3300039447 Bacteria 1201
309 Ga0436361_0803365 3300039447 Bacteria 803
310 Ga0436363_0699607 3300039450 Bacteria 1176
311 Ga0436363_1122706 3300039450 Bacteria 1289
312 Ga0436362_0183551 3300039453 Bacteria 1957
313 Ga0436362_0880966 3300039453 Bacteria 5769
314 Ga0439460_0081337 3300042461 Bacteria 1017
315 Ga0451577_0010775 3300042876 Bacteria 8697
316 Ga0451577_0081413 3300042876 Bacteria 2888
317 Ga0453683_0036979 3300044673 Bacteria 3072
318 Ga0453684_0031644 3300044712 Bacteria 7428
319 Ga0451576_0007250 3300045051 Bacteria 13343
320 Ga0451576_0019113 3300045051 Bacteria 7487
321 Ga0451576_0198815 3300045051 Bacteria 2094
322 Ga0466967_0099220 3300045976 Bacteria 2660
323 Ga0466967_0105297 3300045976 Bacteria 2584
324 Ga0495603_0022866 3300046455 Bacteria 3783
325 Ga0495629_0143170 3300046459 Bacteria 1663
326 Ga0495638_0287248 3300046460 Bacteria 891
327 Ga0495580_0000863 3300046472 Bacteria 26199
328 Ga0495580_0016453 3300046472 Bacteria 5549
329 Ga0495607_0000009 3300046501 Bacteria 216674
330 Ga0495608_0112295 3300046511 Bacteria 1752
331 Ga0495618_0110163 3300046514 Bacteria 1763
332 Ga0495652_0078068 3300046529 Bacteria 2742
333 Ga0495598_0091142 3300046537 Bacteria 994
334 Ga0495667_0205653 3300046559 Bacteria 1259
335 Ga0495656_0009675 3300046615 Bacteria 3476
336 Ga0495634_0179824 3300046642 Bacteria 1325
337 Ga0495659_0005595 3300046664 Bacteria 3953
338 Ga0496100_0064018 3300048903 Bacteria 2432
339 Ga0496102_0014496 3300048905 Bacteria 6848
340 Ga0496102_0188984 3300048905 Bacteria 1941
341 Ga0496105_0122494 3300048908 Bacteria 2144
342 Ga0496107_0134850 3300048910 Bacteria 1824
343 Ga0496108_0184568 3300048911 Bacteria 1807
344 Ga0496109_0250675 3300048912 Bacteria 1667
345 Ga0496109_0260115 3300048912 Bacteria 1635
346 Ga0496109_0401575 3300048912 Bacteria 1295
347 Ga0496109_0892826 3300048912 Bacteria 827
348 Ga0496110_0136669 3300048913 Bacteria 2215
349 Ga0496112_0300777 3300048915 Bacteria 1550
350 Ga0496112_0339678 3300048915 Bacteria 1445
351 Ga0496112_0364388 3300048915 Bacteria 1387
352 Ga0496117_0003108 3300048920 Bacteria 19840
353 Ga0496119_0004587 3300048922 Bacteria 13651
354 Ga0496122_0086100 3300048925 Bacteria 2165
355 Ga0496124_0000004 3300048927 Bacteria 976131
356 Ga0496124_0035552 3300048927 Bacteria 4357
357 Ga0496124_0163118 3300048927 Bacteria 1735
358 Ga0496125_0009347 3300048928 Bacteria 10100
359 Ga0496126_0047525 3300048929 Bacteria 3928
360 Ga0501034_0130935 3300049571 Bacteria 2492
361 Ga0501034_0168423 3300049571 Bacteria 2159
362 Ga0501046_0119956 3300049580 Bacteria 2002
363 Ga0501072_0034375 3300049588 Bacteria 3973
364 Ga0501072_0089670 3300049588 Bacteria 2441
365 Ga0501075_0125150 3300049591 Bacteria 1957
366 Ga0501076_0041832 3300049592 Bacteria 3607
367 Ga0501076_0140360 3300049592 Bacteria 1963
368 Ga0501077_0051554 3300049593 Bacteria 2615
369 Ga0501080_0257080 3300049742 Bacteria 1592
370 Ga0501081_0179641 3300049743 Bacteria 1530
371 Ga0501081_0270771 3300049743 Bacteria 1242
372 nmdc:mga03683_7931_c1 3300050489 Bacteria 3709
373 nmdc:mga03683_9329_c1 3300050489 Bacteria 3483
374 nmdc:mga00v17_1026_c1 3300050491 Bacteria 14905
375 nmdc:mga00v17_44944_c1 3300050491 Bacteria 2666
376 nmdc:mga0k408_11946_c1 3300050493 Bacteria 4738
377 nmdc:mga06z11_10934_c1 3300050494 Bacteria 3891
378 nmdc:mga04h51_88164_c1 3300050495 Bacteria 1112
379 nmdc:mga05p37_15051_c1 3300050507 Bacteria 9287
380 nmdc:mga05p37_1805_c1 3300050507 Bacteria 24956
381 nmdc:mga05p37_19653_c2 3300050507 Bacteria 7535
382 nmdc:mga05p37_266136_c1 3300050507 Bacteria 2050
383 nmdc:mga05p37_324031_c1 3300050507 Bacteria 1823
384 nmdc:mga05p37_412_c1 3300050507 Bacteria 46171
385 nmdc:mga05p37_511_c1 3300050507 Bacteria 42907
386 nmdc:mga05p37_96104_c1 3300050507 Bacteria 3650
387 nmdc:mga09592_14977_c1 3300050508 Bacteria 6335
388 nmdc:mga09592_154536_c1 3300050508 Bacteria 1980
389 nmdc:mga09592_18321_c1 3300050508 Bacteria 5742
390 nmdc:mga09592_1849_c1 3300050508 Bacteria 17026
391 nmdc:mga09592_5226_c1 3300050508 Bacteria 10549
392 nmdc:mga09592_5825_c1 3300050508 Bacteria 10049
393 nmdc:mga09592_76838_c1 3300050508 Bacteria 2840
394 nmdc:mga0qj67_2118_c1 3300050509 Bacteria 14146
395 nmdc:mga0qj67_213187_c1 3300050509 Bacteria 1568
396 nmdc:mga0qj67_261_c1 3300050509 Bacteria 36218
397 nmdc:mga0qj67_40637_c1 3300050509 Bacteria 3655
398 nmdc:mga06r32_1164_c1 3300050510 Bacteria 23678
399 nmdc:mga06r32_18853_c1 3300050510 Bacteria 6325
400 nmdc:mga06r32_2397_c1 3300050510 Bacteria 16778
401 nmdc:mga06r32_247890_c1 3300050510 Bacteria 1769
402 nmdc:mga06r32_261440_c1 3300050510 Bacteria 1718
403 nmdc:mga06r32_4095_c1 3300050510 Bacteria 13070
404 nmdc:mga06r32_57504_c1 3300050510 Bacteria 3736
405 nmdc:mga08y16_1792_c1 3300050511 Bacteria 21772
406 nmdc:mga08y16_259_c1 3300050511 Bacteria 47560
407 nmdc:mga08y16_4477_c1 3300050511 Bacteria 14599
408 nmdc:mga0n895_169394_c1 3300050512 Bacteria 2216
409 nmdc:mga0n895_68439_c1 3300050512 Bacteria 3517
410 nmdc:mga0n895_7116_c1 3300050512 Bacteria 9567
411 nmdc:mga0n895_71316_c1 3300050512 Bacteria 3445
412 nmdc:mga0rr50_38668_c1 3300050513 Bacteria 3455
413 nmdc:mga0rr50_50258_c1 3300050513 Bacteria 3089
414 nmdc:mga0rr50_68271_c1 3300050513 Bacteria 2703
415 nmdc:mga0rr50_821_c1 3300050513 Bacteria 16708
416 nmdc:mga08x19_24991_c2 3300050514 Bacteria 3115
417 nmdc:mga08x19_5074_c1 3300050514 Bacteria 7788
418 nmdc:mga0a205_1494_c1 3300050515 Bacteria 19946
419 nmdc:mga0a205_1910_c1 3300050515 Bacteria 16919
420 nmdc:mga0a205_282936_c1 3300050515 Bacteria 1534
421 nmdc:mga0a205_29740_c1 3300050515 Bacteria 5228
422 nmdc:mga0a205_52204_c1 3300050515 Bacteria 3946
423 nmdc:mga0a205_8947_c1 3300050515 Bacteria 8666
424 nmdc:mga0sz30_396_c1 3300050516 Bacteria 13870
425 nmdc:mga0sz30_73675_c1 3300050516 Bacteria 1472
426 Ga0495601_0007501 3300053077 Bacteria 6399
427 Ga0500610_0054734 3300053079 Bacteria 2081
428 Ga0500635_0001931 3300053080 Bacteria 5061
429 Ga0495595_0101480 3300053084 Bacteria 1389
430 Ga0495619_0014146 3300053085 Bacteria 5039
431 Ga0495619_0030408 3300053085 Bacteria 3496
432 Ga0500583_0059548 3300053092 Bacteria 1798
433 Ga0500566_0000003 3300053094 Bacteria 166820
434 Ga0500641_0000991 3300053096 Bacteria 10086
435 Ga0500641_0057245 3300053096 Bacteria 1617
436 Ga0500591_019258 3300053115 Bacteria 3308
437 Ga0500652_035312 3300053131 Bacteria 1986
438 Ga0500658_0021172 3300053134 Bacteria 2461
439 Ga0500568_0025087 3300053139 Bacteria 2519
440 Ga0500603_000029 3300053150 Bacteria 36423
441 Ga0500604_0051387 3300053151 Bacteria 1273
442 Ga0500616_0003090 3300053153 Bacteria 13066
443 Ga0500616_0021711 3300053153 Bacteria 3595
444 Ga0500620_002413 3300053155 Bacteria 3760
445 Ga0500620_012868 3300053155 Bacteria 2293
446 Ga0500630_000051 3300053159 Bacteria 34539
447 Ga0500638_084776 3300053162 Bacteria 1500
448 Ga0500639_000042 3300053163 Bacteria 61423
449 Ga0500636_0000001 3300053177 Bacteria 324086
450 Ga0500636_0000150 3300053177 Bacteria 36118
451 Ga0500625_081726 3300053729 Bacteria 1409
452 Ga0500609_000258 3300053731 Bacteria 7681
453 Ga0500552_001077 3300053733 Bacteria 2578
454 Ga0500596_002147 3300053735 Bacteria 3914
455 Ga0500601_000148 3300053737 Bacteria 14537
456 Ga0501084_0218355 3300054114 Bacteria 1609
457 Ga0501084_0290416 3300054114 Bacteria 1381
458 Ga0501084_0311333 3300054114 Bacteria 1330
459 Ga0500661_032274 3300055283 Bacteria 924
460 Ga0501082_0412315 3300060353 Bacteria 1179
461 Ga0530510_0076488 3300061734 Bacteria 2432

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0892826 Ga0496109_0892826_13_801 249
2 3300039447 Ga0436361_0803365 Ga0436361_0803365_10_780 256
3 3300026121 Ga0207683_10042075 Ga0207683_100420755 269
4 3300035172 Ga0373955_0315339 Ga0373955_0315339_83_901 272
5 3300035692 Ga0373935_0178499 Ga0373935_0178499_586_1404 272
6 3300048925 Ga0496122_0086100 Ga0496122_0086100_13_909 275
7 3300046615 Ga0495656_0009675 Ga0495656_0009675_1605_2504 277
8 3300009094 Ga0111539_10043476 Ga0111539_100434764 282
9 3300046460 Ga0495638_0287248 Ga0495638_0287248_14_862 282
10 3300053151 Ga0500604_0051387 Ga0500604_0051387_392_1240 282
11 3300005367 Ga0070667_100110022 Ga0070667_1001100222 284
12 3300013297 Ga0157378_10110795 Ga0157378_101107952 289
13 3300027907 Ga0207428_10019656 Ga0207428_100196563 290
14 3300006846 Ga0075430_100081661 Ga0075430_1000816613 292
15 3300039438 Ga0436360_1285854 Ga0436360_1285854_225_1103 292
16 3300055283 Ga0500661_032274 Ga0500661_032274_35_913 292
17 3300048920 Ga0496117_0003108 Ga0496117_0003108_2098_3036 293
18 3300046537 Ga0495598_0091142 Ga0495598_0091142_62_976 294
19 3300005985 Ga0081539_10000002 Ga0081539_10000002502 296
20 3300006844 Ga0075428_100155813 Ga0075428_1001558132 296
21 3300009147 Ga0114129_10010238 Ga0114129_100102382 296
22 3300050507 nmdc:mga05p37_15051_c1 nmdc:mga05p37_15051_c1_8243_9166 296
23 3300003203 JGI25406J46586_10020886 JGI25406J46586_100208862 297
24 3300005985 Ga0081539_10001636 Ga0081539_100016365 297
25 3300048905 Ga0496102_0014496 Ga0496102_0014496_635_1612 297
26 3300050491 nmdc:mga00v17_44944_c1 nmdc:mga00v17_44944_c1_443_1387 297
27 3300003781 Ga0055536_1010640 Ga0055536_10106402 298
28 3300006844 Ga0075428_100358852 Ga0075428_1003588522 298
29 3300025292 Ga0209676_1000515 Ga0209676_100051538 298
30 3300025901 Ga0207688_10211110 Ga0207688_102111102 298
31 3300005445 Ga0070708_100085039 Ga0070708_1000850392 299
32 3300005518 Ga0070699_100017551 Ga0070699_1000175515 299
33 3300053096 Ga0500641_0000991 Ga0500641_0000991_2726_3679 299
34 3300053153 Ga0500616_0021711 Ga0500616_0021711_1148_2101 299
35 3300054114 Ga0501084_0311333 Ga0501084_0311333_81_983 299
36 3300006038 Ga0075365_10013672 Ga0075365_100136724 300
37 3300006048 Ga0075363_100046090 Ga0075363_1000460903 300
38 3300006051 Ga0075364_10242019 Ga0075364_102420191 300
39 3300006177 Ga0075362_10002007 Ga0075362_100020077 300
40 3300006178 Ga0075367_10017571 Ga0075367_100175713 300
41 3300037312 Ga0395899_0189044 Ga0395899_0189044_44_982 300
42 3300037418 Ga0395900_0134976 Ga0395900_0134976_234_1172 300
43 3300037471 Ga0395905_0141134 Ga0395905_0141134_70_1008 300
44 3300049571 Ga0501034_0130935 Ga0501034_0130935_1511_2464 300
45 3300050489 nmdc:mga03683_9329_c1 nmdc:mga03683_9329_c1_1315_2268 300
46 3300050495 nmdc:mga04h51_88164_c1 nmdc:mga04h51_88164_c1_122_1075 300
47 3300050516 nmdc:mga0sz30_396_c1 nmdc:mga0sz30_396_c1_2868_3821 300
48 3300005457 Ga0070662_100023349 Ga0070662_1000233494 302
49 3300009094 Ga0111539_10002669 Ga0111539_100026697 302
50 3300009176 Ga0105242_10152184 Ga0105242_101521842 302
51 3300013297 Ga0157378_10608440 Ga0157378_106084402 302
52 3300025933 Ga0207706_10215142 Ga0207706_102151422 302
53 3300025940 Ga0207691_10133480 Ga0207691_101334802 302
54 3300027907 Ga0207428_10014855 Ga0207428_100148552 302
55 3300028381 Ga0268264_10178222 Ga0268264_101782222 302
56 3300050511 nmdc:mga08y16_4477_c1 nmdc:mga08y16_4477_c1_3396_4352 302
57 3300050515 nmdc:mga0a205_282936_c1 nmdc:mga0a205_282936_c1_415_1371 302
58 3300005356 Ga0070674_100206160 Ga0070674_1002061601 303
59 3300005456 Ga0070678_100123342 Ga0070678_1001233422 303
60 3300026121 Ga0207683_10104496 Ga0207683_101044962 303
61 3300048928 Ga0496125_0009347 Ga0496125_0009347_3703_4653 303
62 3300005330 Ga0070690_100234566 Ga0070690_1002345661 304
63 3300005334 Ga0068869_100020455 Ga0068869_1000204552 304
64 3300005336 Ga0070680_100024355 Ga0070680_1000243552 304
65 3300005336 Ga0070680_100035760 Ga0070680_1000357602 304
66 3300005341 Ga0070691_10003803 Ga0070691_100038032 304
67 3300005345 Ga0070692_10078739 Ga0070692_100787391 304
68 3300005354 Ga0070675_100350911 Ga0070675_1003509111 304
69 3300005355 Ga0070671_100301100 Ga0070671_1003011002 304
70 3300005435 Ga0070714_100151670 Ga0070714_1001516702 304
71 3300005438 Ga0070701_10021346 Ga0070701_100213462 304
72 3300005440 Ga0070705_100002651 Ga0070705_1000026513 304
73 3300005440 Ga0070705_100025177 Ga0070705_1000251775 304
74 3300005441 Ga0070700_100079015 Ga0070700_1000790153 304
75 3300005444 Ga0070694_100026319 Ga0070694_1000263192 304
76 3300005444 Ga0070694_100091936 Ga0070694_1000919362 304
77 3300005445 Ga0070708_100004836 Ga0070708_10000483611 304
78 3300005445 Ga0070708_100086431 Ga0070708_1000864312 304
79 3300005445 Ga0070708_100184320 Ga0070708_1001843202 304
80 3300005445 Ga0070708_100249396 Ga0070708_1002493962 304
81 3300005445 Ga0070708_100257424 Ga0070708_1002574242 304
82 3300005455 Ga0070663_100100553 Ga0070663_1001005532 304
83 3300005457 Ga0070662_100216518 Ga0070662_1002165182 304
84 3300005459 Ga0068867_100465959 Ga0068867_1004659591 304
85 3300005468 Ga0070707_100001920 Ga0070707_1000019208 304
86 3300005468 Ga0070707_100054467 Ga0070707_1000544672 304
87 3300005468 Ga0070707_100118421 Ga0070707_1001184213 304
88 3300005471 Ga0070698_100074615 Ga0070698_1000746152 304
89 3300005471 Ga0070698_100153720 Ga0070698_1001537202 304
90 3300005518 Ga0070699_100003894 Ga0070699_10000389416 304
91 3300005518 Ga0070699_100022313 Ga0070699_1000223132 304
92 3300005518 Ga0070699_100025344 Ga0070699_1000253443 304
93 3300005536 Ga0070697_100000306 Ga0070697_10000030632 304
94 3300005545 Ga0070695_100076713 Ga0070695_1000767133 304
95 3300005545 Ga0070695_100163884 Ga0070695_1001638842 304
96 3300005546 Ga0070696_100037251 Ga0070696_1000372512 304
97 3300005549 Ga0070704_100484276 Ga0070704_1004842761 304
98 3300005577 Ga0068857_100027450 Ga0068857_1000274502 304
99 3300005615 Ga0070702_100172618 Ga0070702_1001726182 304
100 3300005617 Ga0068859_100033454 Ga0068859_1000334544 304
101 3300005617 Ga0068859_100070062 Ga0068859_1000700623 304
102 3300005617 Ga0068859_100186589 Ga0068859_1001865892 304
103 3300005840 Ga0068870_10013007 Ga0068870_100130074 304
104 3300005841 Ga0068863_100050263 Ga0068863_1000502633 304
105 3300005843 Ga0068860_100206669 Ga0068860_1002066691 304
106 3300005844 Ga0068862_100011546 Ga0068862_1000115465 304
107 3300005844 Ga0068862_100105229 Ga0068862_1001052293 304
108 3300005844 Ga0068862_100164894 Ga0068862_1001648942 304
109 3300005844 Ga0068862_100228563 Ga0068862_1002285631 304
110 3300005981 Ga0081538_10041497 Ga0081538_100414972 304
111 3300005983 Ga0081540_1011593 Ga0081540_10115934 304
112 3300006844 Ga0075428_100000401 Ga0075428_10000040118 304
113 3300006844 Ga0075428_100015828 Ga0075428_1000158286 304
114 3300006844 Ga0075428_100022877 Ga0075428_1000228775 304
115 3300006846 Ga0075430_100000656 Ga0075430_10000065615 304
116 3300006846 Ga0075430_100000986 Ga0075430_1000009863 304
117 3300006846 Ga0075430_100048144 Ga0075430_1000481442 304
118 3300006846 Ga0075430_100090233 Ga0075430_1000902332 304
119 3300006846 Ga0075430_100124329 Ga0075430_1001243292 304
120 3300006846 Ga0075430_100185850 Ga0075430_1001858502 304
121 3300006847 Ga0075431_100000044 Ga0075431_10000004472 304
122 3300006847 Ga0075431_100005687 Ga0075431_1000056872 304
123 3300006847 Ga0075431_100010929 Ga0075431_1000109296 304
124 3300006847 Ga0075431_100037812 Ga0075431_1000378123 304
125 3300006847 Ga0075431_100037923 Ga0075431_1000379238 304
126 3300006847 Ga0075431_100147327 Ga0075431_1001473272 304
127 3300006847 Ga0075431_100213060 Ga0075431_1002130602 304
128 3300006852 Ga0075433_10000086 Ga0075433_1000008616 304
129 3300006852 Ga0075433_10000254 Ga0075433_100002545 304
130 3300006852 Ga0075433_10086649 Ga0075433_100866492 304
131 3300006871 Ga0075434_100000607 Ga0075434_10000060723 304
132 3300006871 Ga0075434_100054284 Ga0075434_1000542842 304
133 3300006871 Ga0075434_100136984 Ga0075434_1001369843 304
134 3300006871 Ga0075434_100170342 Ga0075434_1001703422 304
135 3300006880 Ga0075429_100001283 Ga0075429_1000012832 304
136 3300006880 Ga0075429_100005659 Ga0075429_1000056594 304
137 3300006880 Ga0075429_100021840 Ga0075429_1000218404 304
138 3300006880 Ga0075429_100071549 Ga0075429_1000715493 304
139 3300006880 Ga0075429_100081271 Ga0075429_1000812714 304
140 3300006880 Ga0075429_100093197 Ga0075429_1000931973 304
141 3300006880 Ga0075429_100314336 Ga0075429_1003143362 304
142 3300006931 Ga0097620_100033454 Ga0097620_1000334544 304
143 3300006931 Ga0097620_100070066 Ga0097620_1000700663 304
144 3300006931 Ga0097620_100186589 Ga0097620_1001865892 304
145 3300007076 Ga0075435_100011744 Ga0075435_1000117442 304
146 3300007076 Ga0075435_100012307 Ga0075435_1000123072 304
147 3300007076 Ga0075435_100038399 Ga0075435_1000383993 304
148 3300007076 Ga0075435_100039189 Ga0075435_1000391895 304
149 3300007265 Ga0099794_10009671 Ga0099794_100096712 304
150 3300009094 Ga0111539_10000882 Ga0111539_1000088215 304
151 3300009094 Ga0111539_10076635 Ga0111539_100766354 304
152 3300009147 Ga0114129_10000089 Ga0114129_1000008953 304
153 3300009147 Ga0114129_10000385 Ga0114129_100003854 304
154 3300009147 Ga0114129_10001642 Ga0114129_100016427 304
155 3300009147 Ga0114129_10001648 Ga0114129_1000164814 304
156 3300009147 Ga0114129_10003578 Ga0114129_100035785 304
157 3300009147 Ga0114129_10088019 Ga0114129_100880193 304
158 3300009147 Ga0114129_10099954 Ga0114129_100999543 304
159 3300009147 Ga0114129_10127077 Ga0114129_101270772 304
160 3300009147 Ga0114129_10374072 Ga0114129_103740722 304
161 3300009148 Ga0105243_10045119 Ga0105243_100451193 304
162 3300009148 Ga0105243_10082060 Ga0105243_100820602 304
163 3300009174 Ga0105241_10275061 Ga0105241_102750612 304
164 3300009553 Ga0105249_10083571 Ga0105249_100835712 304
165 3300009553 Ga0105249_10296720 Ga0105249_102967201 304
166 3300013102 Ga0157371_10063448 Ga0157371_100634482 304
167 3300013306 Ga0163162_10048372 Ga0163162_100483723 304
168 3300013306 Ga0163162_10096407 Ga0163162_100964072 304
169 3300013308 Ga0157375_10235742 Ga0157375_102357422 304
170 3300025908 Ga0207643_10076651 Ga0207643_100766513 304
171 3300025910 Ga0207684_10000961 Ga0207684_1000096112 304
172 3300025910 Ga0207684_10014776 Ga0207684_100147766 304
173 3300025910 Ga0207684_10082200 Ga0207684_100822002 304
174 3300025910 Ga0207684_10131451 Ga0207684_101314511 304
175 3300025915 Ga0207693_10004401 Ga0207693_100044017 304
176 3300025922 Ga0207646_10414366 Ga0207646_104143662 304
177 3300025929 Ga0207664_10129459 Ga0207664_101294592 304
178 3300025933 Ga0207706_10017568 Ga0207706_100175684 304
179 3300025935 Ga0207709_10012047 Ga0207709_100120472 304
180 3300025936 Ga0207670_10177992 Ga0207670_101779922 304
181 3300025937 Ga0207669_10325192 Ga0207669_103251922 304
182 3300025938 Ga0207704_10107635 Ga0207704_101076352 304
183 3300025942 Ga0207689_10039586 Ga0207689_100395862 304
184 3300025942 Ga0207689_10119653 Ga0207689_101196532 304
185 3300025961 Ga0207712_10103570 Ga0207712_101035702 304
186 3300026075 Ga0207708_10016820 Ga0207708_100168207 304
187 3300026116 Ga0207674_10021563 Ga0207674_100215633 304
188 3300026118 Ga0207675_100090798 Ga0207675_1000907982 304
189 3300027682 Ga0209971_1023966 Ga0209971_10239662 304
190 3300027907 Ga0207428_10000013 Ga0207428_1000001373 304
191 3300027907 Ga0207428_10000199 Ga0207428_1000019917 304
192 3300028380 Ga0268265_10009505 Ga0268265_100095052 304
193 3300028380 Ga0268265_10088055 Ga0268265_100880551 304
194 3300028380 Ga0268265_10262242 Ga0268265_102622422 304
195 3300028381 Ga0268264_10554484 Ga0268264_105544841 304
196 3300031548 Ga0307408_100161999 Ga0307408_1001619992 304
197 3300032002 Ga0307416_100007039 Ga0307416_1000070394 304
198 3300035115 Ga0373941_0004372 Ga0373941_0004372_1736_2671 304
199 3300035241 Ga0373961_0037023 Ga0373961_0037023_417_1340 304
200 3300035691 Ga0373931_0009179 Ga0373931_0009179_352_1275 304
201 3300035691 Ga0373931_0021535 Ga0373931_0021535_1571_2506 304
202 3300037418 Ga0395900_0219818 Ga0395900_0219818_605_1528 304
203 3300037466 Ga0395898_0002087 Ga0395898_0002087_20211_21134 304
204 3300037853 Ga0436364_0145704 Ga0436364_0145704_7030_7947 304
205 3300038443 Ga0395901_0000729 Ga0395901_0000729_20583_21506 304
206 3300038996 Ga0242420_018853 Ga0242420_018853_226_1149 304
207 3300039453 Ga0436362_0880966 Ga0436362_0880966_1450_2367 304
208 3300042461 Ga0439460_0081337 Ga0439460_0081337_65_1000 304
209 3300042876 Ga0451577_0010775 Ga0451577_0010775_776_1699 304
210 3300042876 Ga0451577_0081413 Ga0451577_0081413_1027_1962 304
211 3300044673 Ga0453683_0036979 Ga0453683_0036979_1657_2580 304
212 3300044712 Ga0453684_0031644 Ga0453684_0031644_1346_2269 304
213 3300045051 Ga0451576_0007250 Ga0451576_0007250_3502_4425 304
214 3300045051 Ga0451576_0019113 Ga0451576_0019113_202_1125 304
215 3300045051 Ga0451576_0198815 Ga0451576_0198815_26_949 304
216 3300046455 Ga0495603_0022866 Ga0495603_0022866_2452_3375 304
217 3300046472 Ga0495580_0000863 Ga0495580_0000863_4443_5366 304
218 3300046501 Ga0495607_0000009 Ga0495607_0000009_112826_113779 304
219 3300046664 Ga0495659_0005595 Ga0495659_0005595_172_1095 304
220 3300048912 Ga0496109_0260115 Ga0496109_0260115_413_1345 304
221 3300049580 Ga0501046_0119956 Ga0501046_0119956_927_1862 304
222 3300049588 Ga0501072_0034375 Ga0501072_0034375_915_1850 304
223 3300049588 Ga0501072_0089670 Ga0501072_0089670_691_1626 304
224 3300049591 Ga0501075_0125150 Ga0501075_0125150_609_1532 304
225 3300049592 Ga0501076_0041832 Ga0501076_0041832_1483_2418 304
226 3300049592 Ga0501076_0140360 Ga0501076_0140360_179_1102 304
227 3300049593 Ga0501077_0051554 Ga0501077_0051554_1266_2201 304
228 3300049743 Ga0501081_0179641 Ga0501081_0179641_239_1162 304
229 3300049743 Ga0501081_0270771 Ga0501081_0270771_84_1019 304
230 3300050507 nmdc:mga05p37_1805_c1 nmdc:mga05p37_1805_c1_9417_10352 304
231 3300050507 nmdc:mga05p37_19653_c2 nmdc:mga05p37_19653_c2_4784_5707 304
232 3300050507 nmdc:mga05p37_324031_c1 nmdc:mga05p37_324031_c1_166_1089 304
233 3300050507 nmdc:mga05p37_412_c1 nmdc:mga05p37_412_c1_35687_36610 304
234 3300050507 nmdc:mga05p37_511_c1 nmdc:mga05p37_511_c1_3333_4256 304
235 3300050507 nmdc:mga05p37_96104_c1 nmdc:mga05p37_96104_c1_510_1433 304
236 3300050508 nmdc:mga09592_14977_c1 nmdc:mga09592_14977_c1_398_1321 304
237 3300050508 nmdc:mga09592_154536_c1 nmdc:mga09592_154536_c1_907_1830 304
238 3300050508 nmdc:mga09592_18321_c1 nmdc:mga09592_18321_c1_4515_5438 304
239 3300050508 nmdc:mga09592_1849_c1 nmdc:mga09592_1849_c1_14589_15512 304
240 3300050508 nmdc:mga09592_5226_c1 nmdc:mga09592_5226_c1_4845_5768 304
241 3300050508 nmdc:mga09592_5825_c1 nmdc:mga09592_5825_c1_7865_8788 304
242 3300050508 nmdc:mga09592_76838_c1 nmdc:mga09592_76838_c1_1370_2293 304
243 3300050509 nmdc:mga0qj67_2118_c1 nmdc:mga0qj67_2118_c1_314_1249 304
244 3300050509 nmdc:mga0qj67_213187_c1 nmdc:mga0qj67_213187_c1_622_1545 304
245 3300050509 nmdc:mga0qj67_261_c1 nmdc:mga0qj67_261_c1_14741_15664 304
246 3300050509 nmdc:mga0qj67_40637_c1 nmdc:mga0qj67_40637_c1_1973_2896 304
247 3300050510 nmdc:mga06r32_1164_c1 nmdc:mga06r32_1164_c1_13286_14209 304
248 3300050510 nmdc:mga06r32_2397_c1 nmdc:mga06r32_2397_c1_10586_11509 304
249 3300050510 nmdc:mga06r32_247890_c1 nmdc:mga06r32_247890_c1_729_1652 304
250 3300050510 nmdc:mga06r32_261440_c1 nmdc:mga06r32_261440_c1_717_1640 304
251 3300050510 nmdc:mga06r32_4095_c1 nmdc:mga06r32_4095_c1_9636_10559 304
252 3300050510 nmdc:mga06r32_57504_c1 nmdc:mga06r32_57504_c1_1232_2155 304
253 3300050511 nmdc:mga08y16_1792_c1 nmdc:mga08y16_1792_c1_11547_12470 304
254 3300050511 nmdc:mga08y16_259_c1 nmdc:mga08y16_259_c1_21754_22677 304
255 3300050512 nmdc:mga0n895_169394_c1 nmdc:mga0n895_169394_c1_277_1200 304
256 3300050512 nmdc:mga0n895_7116_c1 nmdc:mga0n895_7116_c1_7224_8147 304
257 3300050512 nmdc:mga0n895_71316_c1 nmdc:mga0n895_71316_c1_224_1147 304
258 3300050513 nmdc:mga0rr50_38668_c1 nmdc:mga0rr50_38668_c1_2442_3365 304
259 3300050513 nmdc:mga0rr50_50258_c1 nmdc:mga0rr50_50258_c1_1474_2397 304
260 3300050513 nmdc:mga0rr50_68271_c1 nmdc:mga0rr50_68271_c1_1440_2363 304
261 3300050513 nmdc:mga0rr50_821_c1 nmdc:mga0rr50_821_c1_1709_2632 304
262 3300050514 nmdc:mga08x19_5074_c1 nmdc:mga08x19_5074_c1_1964_2887 304
263 3300050515 nmdc:mga0a205_1494_c1 nmdc:mga0a205_1494_c1_11129_12052 304
264 3300050515 nmdc:mga0a205_1910_c1 nmdc:mga0a205_1910_c1_1911_2834 304
265 3300050515 nmdc:mga0a205_29740_c1 nmdc:mga0a205_29740_c1_523_1446 304
266 3300050515 nmdc:mga0a205_8947_c1 nmdc:mga0a205_8947_c1_5572_6495 304
267 3300054114 Ga0501084_0218355 Ga0501084_0218355_460_1383 304
268 3300054114 Ga0501084_0290416 Ga0501084_0290416_376_1311 304
269 3300060353 Ga0501082_0412315 Ga0501082_0412315_135_1070 304
270 3300061734 Ga0530510_0076488 Ga0530510_0076488_964_1899 304
271 3300005546 Ga0070696_100301734 Ga0070696_1003017342 305
272 3300005842 Ga0068858_100478145 Ga0068858_1004781451 305
273 3300005843 Ga0068860_100099808 Ga0068860_1000998082 305
274 3300009148 Ga0105243_10225603 Ga0105243_102256032 305
275 3300009553 Ga0105249_10048044 Ga0105249_100480442 305
276 3300025935 Ga0207709_10162088 Ga0207709_101620882 305
277 3300048905 Ga0496102_0188984 Ga0496102_0188984_870_1793 305
278 3300048912 Ga0496109_0401575 Ga0496109_0401575_19_942 305
279 3300050507 nmdc:mga05p37_266136_c1 nmdc:mga05p37_266136_c1_134_1057 305
280 3300005367 Ga0070667_100220735 Ga0070667_1002207352 307
281 3300006051 Ga0075364_10000505 Ga0075364_100005059 307
282 3300050491 nmdc:mga00v17_1026_c1 nmdc:mga00v17_1026_c1_4709_5632 307
283 iso_pu_bacteria 8055037949 8055038844 307
284 3300005436 Ga0070713_100021523 Ga0070713_1000215233 309
285 3300005445 Ga0070708_100025333 Ga0070708_1000253333 309
286 3300005536 Ga0070697_100083316 Ga0070697_1000833163 309
287 3300007076 Ga0075435_100022696 Ga0075435_1000226962 309
288 3300025922 Ga0207646_10144020 Ga0207646_101440202 309
289 3300025928 Ga0207700_10051759 Ga0207700_100517592 309
290 iso_pu_bacteria 8004182704 8004182942 309
291 3300021384 Ga0213876_10001802 Ga0213876_100018027 310
292 3300039437 Ga0436365_1424493 Ga0436365_1424493_13174_14109 310
293 3300005467 Ga0070706_100070677 Ga0070706_1000706773 311
294 3300005471 Ga0070698_100012971 Ga0070698_1000129716 311
295 3300025910 Ga0207684_10029829 Ga0207684_100298292 311
296 3300039437 Ga0436365_1712476 Ga0436365_1712476_459_1415 311
297 iso_pu_bacteria 2842775625 2842776352 311
298 iso_pu_bacteria 2929199973 2929204789 311
299 iso_pu_bacteria 8055909800 8055914341 311
300 3300006847 Ga0075431_100003635 Ga0075431_1000036357 313
301 3300011119 Ga0105246_10136393 Ga0105246_101363932 313
302 3300045976 Ga0466967_0099220 Ga0466967_0099220_449_1396 313
303 3300048915 Ga0496112_0364388 Ga0496112_0364388_379_1320 313
304 3300048927 Ga0496124_0035552 Ga0496124_0035552_13_975 313
305 3300049571 Ga0501034_0168423 Ga0501034_0168423_916_1863 313
306 3300050510 nmdc:mga06r32_18853_c1 nmdc:mga06r32_18853_c1_966_1907 313
307 iso_pu_bacteria 2585427608 2585899899 313
308 iso_pu_bacteria 2821123053 2821126905 313
309 iso_pu_bacteria 2838736955 2838740512 313
310 iso_pu_bacteria 2841840854 2841843364 313
311 iso_pu_bacteria 2842140634 2842143085 313
312 iso_pu_bacteria 2857531043 2857535310 313
313 iso_pu_bacteria 2857542790 2857545694 313
314 iso_pu_bacteria 2889790730 2889792121 313
315 iso_pu_bacteria 2928521798 2928526744 313
316 iso_pu_bacteria 3005445848 3005451940 313
317 iso_pu_bacteria 639633055 639645194 313
318 iso_pu_bacteria 8054563764 8054563940 313
319 3300021358 Ga0213873_10003417 Ga0213873_100034173 315
320 3300021388 Ga0213875_10003536 Ga0213875_100035363 315
321 3300039438 Ga0436360_1221680 Ga0436360_1221680_349_1299 316
322 3300039438 Ga0436360_1226403 Ga0436360_1226403_1114_2064 316
323 3300005329 Ga0070683_100034925 Ga0070683_1000349252 317
324 3300005340 Ga0070689_100101081 Ga0070689_1001010811 317
325 3300005344 Ga0070661_100029732 Ga0070661_1000297322 317
326 3300005364 Ga0070673_100232252 Ga0070673_1002322522 317
327 3300005445 Ga0070708_100037885 Ga0070708_1000378852 317
328 3300005467 Ga0070706_100015721 Ga0070706_1000157213 317
329 3300005471 Ga0070698_100004284 Ga0070698_10000428410 317
330 3300005518 Ga0070699_100017468 Ga0070699_1000174684 317
331 3300005536 Ga0070697_100041375 Ga0070697_1000413753 317
332 3300005563 Ga0068855_100110769 Ga0068855_1001107692 317
333 3300005614 Ga0068856_100034736 Ga0068856_1000347362 317
334 3300005841 Ga0068863_100228882 Ga0068863_1002288822 317
335 3300005842 Ga0068858_100270625 Ga0068858_1002706252 317
336 3300005937 Ga0081455_10001267 Ga0081455_100012674 317
337 3300005937 Ga0081455_10051457 Ga0081455_100514573 317
338 3300005985 Ga0081539_10015289 Ga0081539_100152895 317
339 3300006177 Ga0075362_10019863 Ga0075362_100198632 317
340 3300006178 Ga0075367_10183781 Ga0075367_101837812 317
341 3300006195 Ga0075366_10011825 Ga0075366_100118252 317
342 3300009551 Ga0105238_10227639 Ga0105238_102276392 317
343 3300013104 Ga0157370_10335545 Ga0157370_103355452 317
344 3300013105 Ga0157369_10039349 Ga0157369_100393492 317
345 3300013307 Ga0157372_10012094 Ga0157372_100120944 317
346 3300025302 Ga0207426_1023005 Ga0207426_10230052 317
347 3300025904 Ga0207647_10094125 Ga0207647_100941252 317
348 3300025907 Ga0207645_10061865 Ga0207645_100618652 317
349 3300025917 Ga0207660_10317906 Ga0207660_103179062 317
350 3300025920 Ga0207649_10380997 Ga0207649_103809971 317
351 3300025932 Ga0207690_10040205 Ga0207690_100402052 317
352 3300025939 Ga0207665_10068045 Ga0207665_100680452 317
353 3300025940 Ga0207691_10123895 Ga0207691_101238952 317
354 3300025945 Ga0207679_10103493 Ga0207679_101034932 317
355 3300025949 Ga0207667_10124639 Ga0207667_101246393 317
356 3300026142 Ga0207698_10560681 Ga0207698_105606811 317
357 3300027111 Ga0209281_1000118 Ga0209281_1000118184 317
358 3300028379 Ga0268266_10030102 Ga0268266_100301022 317
359 3300031247 Ga0265340_10021577 Ga0265340_100215772 317
360 3300031712 Ga0265342_10161745 Ga0265342_101617452 317
361 3300037312 Ga0395899_0013475 Ga0395899_0013475_947_1900 317
362 3300037418 Ga0395900_0016407 Ga0395900_0016407_5624_6577 317
363 3300037418 Ga0395900_0022757 Ga0395900_0022757_975_1928 317
364 3300037466 Ga0395898_0011147 Ga0395898_0011147_3903_4856 317
365 3300038443 Ga0395901_0007831 Ga0395901_0007831_6773_7726 317
366 3300038443 Ga0395901_0094611 Ga0395901_0094611_1355_2308 317
367 3300039437 Ga0436365_0467338 Ga0436365_0467338_644_1597 317
368 3300039438 Ga0436360_0935449 Ga0436360_0935449_840_1793 317
369 3300039447 Ga0436361_0550158 Ga0436361_0550158_484_1437 317
370 3300039447 Ga0436361_0677196 Ga0436361_0677196_191_1144 317
371 3300048927 Ga0496124_0000004 Ga0496124_0000004_148688_149641 317
372 3300048927 Ga0496124_0163118 Ga0496124_0163118_671_1624 317
373 3300048929 Ga0496126_0047525 Ga0496126_0047525_2751_3704 317
374 3300050489 nmdc:mga03683_7931_c1 nmdc:mga03683_7931_c1_1743_2696 317
375 3300050493 nmdc:mga0k408_11946_c1 nmdc:mga0k408_11946_c1_3516_4469 317
376 3300050494 nmdc:mga06z11_10934_c1 nmdc:mga06z11_10934_c1_2645_3598 317
377 3300050516 nmdc:mga0sz30_73675_c1 nmdc:mga0sz30_73675_c1_106_1059 317
378 3300053139 Ga0500568_0025087 Ga0500568_0025087_240_1193 317
379 3300053153 Ga0500616_0003090 Ga0500616_0003090_469_1422 317
380 3300053155 Ga0500620_012868 Ga0500620_012868_1201_2154 317
381 3300053177 Ga0500636_0000001 Ga0500636_0000001_242073_243026 317
382 3300053733 Ga0500552_001077 Ga0500552_001077_931_1884 317
383 3300003203 JGI25406J46586_10013058 JGI25406J46586_100130582 318
384 3300005329 Ga0070683_100032765 Ga0070683_1000327654 318
385 3300005336 Ga0070680_100094711 Ga0070680_1000947112 318
386 3300005338 Ga0068868_100230085 Ga0068868_1002300852 318
387 3300005436 Ga0070713_100291907 Ga0070713_1002919071 318
388 3300005439 Ga0070711_100080862 Ga0070711_1000808622 318
389 3300005439 Ga0070711_100106812 Ga0070711_1001068122 318
390 3300005530 Ga0070679_100058897 Ga0070679_1000588972 318
391 3300005530 Ga0070679_100111178 Ga0070679_1001111782 318
392 3300005535 Ga0070684_100008642 Ga0070684_1000086426 318
393 3300005614 Ga0068856_100207576 Ga0068856_1002075761 318
394 3300005937 Ga0081455_10194188 Ga0081455_101941881 318
395 3300005985 Ga0081539_10015058 Ga0081539_100150583 318
396 3300006028 Ga0070717_10392008 Ga0070717_103920082 318
397 3300006175 Ga0070712_100162069 Ga0070712_1001620692 318
398 3300006871 Ga0075434_100028183 Ga0075434_1000281832 318
399 3300007076 Ga0075435_100022762 Ga0075435_1000227624 318
400 3300007265 Ga0099794_10024052 Ga0099794_100240522 318
401 3300007265 Ga0099794_10034025 Ga0099794_100340252 318
402 3300007788 Ga0099795_10038470 Ga0099795_100384701 318
403 3300009093 Ga0105240_10241125 Ga0105240_102411252 318
404 3300009147 Ga0114129_10487191 Ga0114129_104871912 318
405 3300009176 Ga0105242_10476777 Ga0105242_104767771 318
406 3300009177 Ga0105248_10200788 Ga0105248_102007882 318
407 3300009545 Ga0105237_10024949 Ga0105237_100249496 318
408 3300009551 Ga0105238_10004760 Ga0105238_100047608 318
409 3300010375 Ga0105239_10043978 Ga0105239_100439783 318
410 3300014325 Ga0163163_10106486 Ga0163163_101064862 318
411 3300021361 Ga0213872_10105124 Ga0213872_101051241 318
412 3300021384 Ga0213876_10088217 Ga0213876_100882172 318
413 3300025913 Ga0207695_10172896 Ga0207695_101728962 318
414 3300025915 Ga0207693_10021191 Ga0207693_100211912 318
415 3300025921 Ga0207652_10126273 Ga0207652_101262732 318
416 3300025924 Ga0207694_10024264 Ga0207694_100242643 318
417 3300025928 Ga0207700_10355210 Ga0207700_103552102 318
418 3300025934 Ga0207686_10317894 Ga0207686_103178942 318
419 3300025944 Ga0207661_10136046 Ga0207661_101360462 318
420 3300026023 Ga0207677_10295220 Ga0207677_102952202 318
421 3300026035 Ga0207703_10347028 Ga0207703_103470281 318
422 3300035083 Ga0373926_0013661 Ga0373926_0013661_439_1395 318
423 3300035171 Ga0373946_0032929 Ga0373946_0032929_1020_1976 318
424 3300035171 Ga0373946_0103361 Ga0373946_0103361_25_981 318
425 3300036401 Ga0373937_0079290 Ga0373937_0079290_1980_2936 318
426 3300036401 Ga0373937_0169183 Ga0373937_0169183_534_1490 318
427 3300037068 Ga0373925_0120826 Ga0373925_0120826_760_1716 318
428 3300037068 Ga0373925_0170406 Ga0373925_0170406_77_1033 318
429 3300037068 Ga0373925_0208466 Ga0373925_0208466_18_974 318
430 3300037853 Ga0436364_0332953 Ga0436364_0332953_126_1082 318
431 3300037853 Ga0436364_0600115 Ga0436364_0600115_140_1096 318
432 3300037853 Ga0436364_1343361 Ga0436364_1343361_4281_5237 318
433 3300039450 Ga0436363_0699607 Ga0436363_0699607_153_1133 318
434 3300039450 Ga0436363_1122706 Ga0436363_1122706_212_1168 318
435 3300039453 Ga0436362_0183551 Ga0436362_0183551_853_1809 318
436 3300045976 Ga0466967_0105297 Ga0466967_0105297_99_1055 318
437 3300046459 Ga0495629_0143170 Ga0495629_0143170_525_1481 318
438 3300046472 Ga0495580_0016453 Ga0495580_0016453_1937_2893 318
439 3300046511 Ga0495608_0112295 Ga0495608_0112295_343_1299 318
440 3300046514 Ga0495618_0110163 Ga0495618_0110163_677_1633 318
441 3300046529 Ga0495652_0078068 Ga0495652_0078068_534_1490 318
442 3300046559 Ga0495667_0205653 Ga0495667_0205653_125_1081 318
443 3300046642 Ga0495634_0179824 Ga0495634_0179824_358_1314 318
444 3300048903 Ga0496100_0064018 Ga0496100_0064018_353_1309 318
445 3300048908 Ga0496105_0122494 Ga0496105_0122494_1109_2065 318
446 3300048910 Ga0496107_0134850 Ga0496107_0134850_395_1351 318
447 3300048911 Ga0496108_0184568 Ga0496108_0184568_683_1639 318
448 3300048912 Ga0496109_0250675 Ga0496109_0250675_607_1563 318
449 3300048913 Ga0496110_0136669 Ga0496110_0136669_817_1773 318
450 3300048915 Ga0496112_0300777 Ga0496112_0300777_489_1445 318
451 3300048915 Ga0496112_0339678 Ga0496112_0339678_61_1017 318
452 3300048922 Ga0496119_0004587 Ga0496119_0004587_1867_2823 318
453 3300049742 Ga0501080_0257080 Ga0501080_0257080_236_1192 318
454 3300050512 nmdc:mga0n895_68439_c1 nmdc:mga0n895_68439_c1_959_1915 318
455 3300050514 nmdc:mga08x19_24991_c2 nmdc:mga08x19_24991_c2_2051_3007 318
456 3300050515 nmdc:mga0a205_52204_c1 nmdc:mga0a205_52204_c1_1729_2685 318
457 3300053077 Ga0495601_0007501 Ga0495601_0007501_399_1355 318
458 3300053079 Ga0500610_0054734 Ga0500610_0054734_630_1586 318
459 3300053080 Ga0500635_0001931 Ga0500635_0001931_3701_4657 318
460 3300053084 Ga0495595_0101480 Ga0495595_0101480_414_1370 318
461 3300053085 Ga0495619_0014146 Ga0495619_0014146_1672_2628 318
462 3300053085 Ga0495619_0030408 Ga0495619_0030408_531_1487 318
463 3300053092 Ga0500583_0059548 Ga0500583_0059548_239_1195 318
464 3300053094 Ga0500566_0000003 Ga0500566_0000003_45855_46811 318
465 3300053096 Ga0500641_0057245 Ga0500641_0057245_477_1433 318
466 3300053115 Ga0500591_019258 Ga0500591_019258_1420_2376 318
467 3300053131 Ga0500652_035312 Ga0500652_035312_819_1775 318
468 3300053134 Ga0500658_0021172 Ga0500658_0021172_1216_2172 318
469 3300053150 Ga0500603_000029 Ga0500603_000029_17861_18817 318
470 3300053155 Ga0500620_002413 Ga0500620_002413_1401_2357 318
471 3300053159 Ga0500630_000051 Ga0500630_000051_17241_18197 318
472 3300053162 Ga0500638_084776 Ga0500638_084776_324_1280 318
473 3300053163 Ga0500639_000042 Ga0500639_000042_30598_31554 318
474 3300053177 Ga0500636_0000150 Ga0500636_0000150_6573_7529 318
475 3300053729 Ga0500625_081726 Ga0500625_081726_189_1145 318
476 3300053731 Ga0500609_000258 Ga0500609_000258_4030_4986 318
477 3300053735 Ga0500596_002147 Ga0500596_002147_1251_2207 318
478 3300053737 Ga0500601_000148 Ga0500601_000148_2631_3587 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

154

357

0.98

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

42

139

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.851 89 312
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.827 91 311
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8136 90 311
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8013 89 312
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7879 91 311
ID Description Score Start End Superfamily
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9463 89 307 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9407 89 312 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9406 86 312 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9365 86 312 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9351 89 312 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A418VLD1-F1-model_v4 ABC transporter permease 0.9842 1 318 GO:0005886
GO:0071916
AF-A0A418VLD1-F1-model_v4 ABC transporter permease 0.9811 1 318 GO:0005886
GO:0071916
AF-A0A3S0DQ18-F1-model_v4 ABC transporter permease 0.9792 1 318 GO:0005886
GO:0071916
AF-A0A1W6L2M5-F1-model_v4 ABC transporter permease 0.9785 1 318 GO:0005886
GO:0071916
AF-A0A4Q3PL55-F1-model_v4 deleted 0.9776 83 316

Feature Viewer

pLDDT pTM Quality
86.47 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map