F451899

General Info

Members Datasets Scaffolds Average Seq Length
478 227 956 218

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100445860|Ga0307408_1004458602
Length 249
Sequence MRPDRLSLQKWARLAIGARPCQSAASMSSPASPPKSSRPILIAVDGPAASGKGTIARALAQHFGLPHMDTGILYRAVALTMVRFGGDPANEFEAVRACEGTPQVDPTDPDLRTEIVGSIASRISAYPGVRAALLERQRNFAAQPSGAVLDGRDIGTVIAPNATAKLFVTASAEVRARRRVAELLARGIQAHLPDVLIDIRARDERDSGRDTAPLKQAEDADLLDTSEMDIDEAIAAAIELVETRIAARA

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
132 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
133 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
226 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
227 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 3.35
Rhizosphere 90.17
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100445860 3300031548 Bacteria 1122
2 SwRhRL3b_contig_2430896 2162886006 Bacteria 984
3 JGI24736J21556_1000458 3300001904 Bacteria 7671
4 JGI24740J21852_10004923 3300001979 Bacteria 5681
5 JGI24740J21852_10020181 3300001979 Bacteria 2331
6 JGI24740J21852_10027561 3300001979 Bacteria 1889
7 JGI24740J21852_10049214 3300001979 Bacteria 1219
8 JGI24739J22299_10003612 3300001989 Bacteria 5909
9 JGI24737J22298_10010040 3300001990 Bacteria 3135
10 JGI24737J22298_10025276 3300001990 Bacteria 1878
11 JGI24735J21928_10003940 3300002067 Bacteria 5022
12 JGI24735J21928_10044593 3300002067 Bacteria 1288
13 JGI25150J39212_1000126 3300002774 Bacteria 42982
14 JGI25153J46596_10000305 3300003215 Bacteria 36679
15 rootH1_10152439 3300003323 Bacteria 1215
16 Ga0055526_1007718 3300003771 Bacteria 5523
17 Ga0055537_1004112 3300003773 Bacteria 4251
18 Ga0055536_1019790 3300003781 Bacteria 2103
19 Ga0055540_1000521 3300003792 Bacteria 29043
20 JGI25405J52794_10005305 3300003911 Bacteria 2321
21 Ga0065707_10000505 3300005295 Bacteria 50569
22 Ga0070658_10069571 3300005327 Bacteria 2880
23 Ga0070658_10084531 3300005327 Bacteria 2609
24 Ga0070658_10110755 3300005327 Bacteria 2274
25 Ga0070683_100135987 3300005329 Bacteria 2327
26 Ga0070683_100197311 3300005329 Bacteria 1911
27 Ga0070670_100150058 3300005331 Bacteria 2017
28 Ga0070677_10036575 3300005333 Bacteria 1911
29 Ga0068869_100348593 3300005334 Bacteria 1206
30 Ga0070680_100028641 3300005336 Bacteria 4469
31 Ga0068868_100094302 3300005338 Bacteria 2414
32 Ga0070660_100004038 3300005339 Bacteria 10136
33 Ga0070660_100079246 3300005339 Bacteria 2577
34 Ga0070660_100173617 3300005339 Bacteria 1742
35 Ga0070660_100252499 3300005339 Bacteria 1438
36 Ga0070660_100264823 3300005339 Bacteria 1404
37 Ga0070660_100830395 3300005339 Bacteria 778
38 Ga0070689_100800056 3300005340 Bacteria 829
39 Ga0070691_10011238 3300005341 Bacteria 4085
40 Ga0070661_100000041 3300005344 Bacteria 99916
41 Ga0070661_100001752 3300005344 Bacteria 15061
42 Ga0070661_100007298 3300005344 Bacteria 7622
43 Ga0070661_100094810 3300005344 Bacteria 2212
44 Ga0070668_100062336 3300005347 Bacteria 2889
45 Ga0070669_100053045 3300005353 Bacteria 2968
46 Ga0070669_100055238 3300005353 Bacteria 2910
47 Ga0070675_100079783 3300005354 Bacteria 2727
48 Ga0070675_100127814 3300005354 Bacteria 2164
49 Ga0070675_100374627 3300005354 Bacteria 1266
50 Ga0070671_100041419 3300005355 Bacteria 3828
51 Ga0070671_100073478 3300005355 Bacteria 2856
52 Ga0070659_100012271 3300005366 Bacteria 6354
53 Ga0070659_100312928 3300005366 Bacteria 1311
54 Ga0070667_100067450 3300005367 Bacteria 3042
55 Ga0070667_100362779 3300005367 Bacteria 1313
56 Ga0070714_100044626 3300005435 Bacteria 3753
57 Ga0070714_100174987 3300005435 Bacteria 1950
58 Ga0070663_100070851 3300005455 Bacteria 2536
59 Ga0070663_100152726 3300005455 Bacteria 1772
60 Ga0070662_100011232 3300005457 Bacteria 5903
61 Ga0070662_100052264 3300005457 Bacteria 2952
62 Ga0070662_100136175 3300005457 Bacteria 1899
63 Ga0070662_100415892 3300005457 Unclassified 1111
64 Ga0070681_10045388 3300005458 Bacteria 4397
65 Ga0070681_10392441 3300005458 Bacteria 1299
66 Ga0070679_100212360 3300005530 Bacteria 1899
67 Ga0070684_100146000 3300005535 Bacteria 2141
68 Ga0068853_100017003 3300005539 Bacteria 5997
69 Ga0068853_100020412 3300005539 Bacteria 5510
70 Ga0068853_100031229 3300005539 Bacteria 4505
71 Ga0068853_100043581 3300005539 Bacteria 3838
72 Ga0070672_100186843 3300005543 Bacteria 1728
73 Ga0070665_100007276 3300005548 Bacteria 11250
74 Ga0070665_100200794 3300005548 Bacteria 1994
75 Ga0068855_100478182 3300005563 Bacteria 1356
76 Ga0070664_100011210 3300005564 Bacteria 7270
77 Ga0068857_100028699 3300005577 Bacteria 4909
78 Ga0068854_100004251 3300005578 Bacteria 9020
79 Ga0068854_100018212 3300005578 Bacteria 4712
80 Ga0068854_100056403 3300005578 Bacteria 2831
81 Ga0068854_100770042 3300005578 Bacteria 836
82 Ga0068856_100007943 3300005614 Bacteria 10360
83 Ga0068856_100071995 3300005614 Bacteria 3422
84 Ga0068856_100086923 3300005614 Bacteria 3107
85 Ga0068856_100339871 3300005614 Bacteria 1519
86 Ga0068856_100818848 3300005614 Bacteria 950
87 Ga0068852_100999716 3300005616 Bacteria 855
88 Ga0068859_100123766 3300005617 Bacteria 2653
89 Ga0068864_100001105 3300005618 Bacteria 22558
90 Ga0068864_100010992 3300005618 Bacteria 7485
91 Ga0068866_10139064 3300005718 Bacteria 1392
92 Ga0068863_100007010 3300005841 Bacteria 11048
93 Ga0068863_100019009 3300005841 Bacteria 6576
94 Ga0068860_100000944 3300005843 Bacteria 32201
95 Ga0068860_100120291 3300005843 Bacteria 2514
96 Ga0068862_100000280 3300005844 Bacteria 56780
97 Ga0068862_100014177 3300005844 Bacteria 6609
98 Ga0068862_100041438 3300005844 Bacteria 3917
99 Ga0081455_10000255 3300005937 Bacteria 69927
100 Ga0075370_10074500 3300006353 Bacteria 1945
101 Ga0068871_100150217 3300006358 Bacteria 1986
102 Ga0068865_100142304 3300006881 Bacteria 1810
103 Ga0097620_100123766 3300006931 Bacteria 2653
104 Ga0105240_10028067 3300009093 Bacteria 7359
105 Ga0105240_10556578 3300009093 Bacteria 1268
106 Ga0111539_10386723 3300009094 Bacteria 1629
107 Ga0105243_10017813 3300009148 Bacteria 5374
108 Ga0105241_10147136 3300009174 Bacteria 1923
109 Ga0105241_10367059 3300009174 Bacteria 1254
110 Ga0105248_10025650 3300009177 Bacteria 6555
111 Ga0105248_10081532 3300009177 Bacteria 3636
112 Ga0105238_10267270 3300009551 Bacteria 1691
113 Ga0105238_10377741 3300009551 Bacteria 1408
114 Ga0105238_10460163 3300009551 Bacteria 1270
115 Ga0105249_10000103 3300009553 Bacteria 118397
116 Ga0157373_10014018 3300013100 Bacteria 5877
117 Ga0157373_10053279 3300013100 Bacteria 2877
118 Ga0157373_10083688 3300013100 Bacteria 2249
119 Ga0157373_10095064 3300013100 Bacteria 2098
120 Ga0157373_10349771 3300013100 Bacteria 1054
121 Ga0157371_10063498 3300013102 Bacteria 2617
122 Ga0157371_10147436 3300013102 Bacteria 1677
123 Ga0157371_10176559 3300013102 Bacteria 1527
124 Ga0157371_10176678 3300013102 Bacteria 1527
125 Ga0157370_10007637 3300013104 Bacteria 11739
126 Ga0157370_10007721 3300013104 Bacteria 11663
127 Ga0157370_10062685 3300013104 Bacteria 3525
128 Ga0157370_10068173 3300013104 Bacteria 3362
129 Ga0157370_10121075 3300013104 Bacteria 2443
130 Ga0157369_10010712 3300013105 Bacteria 10433
131 Ga0157369_10102647 3300013105 Bacteria 3047
132 Ga0157369_10172849 3300013105 Bacteria 2276
133 Ga0157369_10184226 3300013105 Bacteria 2196
134 Ga0157369_10349735 3300013105 Bacteria 1535
135 Ga0163162_10302177 3300013306 Bacteria 1732
136 Ga0157372_10014336 3300013307 Bacteria 8475
137 Ga0157372_10110780 3300013307 Bacteria 3144
138 Ga0157372_10367412 3300013307 Bacteria 1676
139 Ga0157375_10066063 3300013308 Bacteria 3609
140 Ga0157375_11012889 3300013308 Bacteria 970
141 Ga0157375_11389172 3300013308 Bacteria 827
142 Ga0157380_10110229 3300014326 Bacteria 2311
143 Ga0157380_10209029 3300014326 Bacteria 1738
144 Ga0157380_10232345 3300014326 Bacteria 1657
145 Ga0157380_10340797 3300014326 Bacteria 1398
146 Ga0157376_10138893 3300014969 Bacteria 2177
147 Ga0207425_1000041 3300025245 Bacteria 210441
148 Ga0209129_1000359 3300025258 Bacteria 37937
149 Ga0209565_1000134 3300025263 Bacteria 104013
150 Ga0209676_1020341 3300025292 Bacteria 2257
151 Ga0209025_1000068 3300025294 Bacteria 294129
152 Ga0209564_1001020 3300025295 Bacteria 34568
153 Ga0209758_1000004 3300025297 Bacteria 1375322
154 Ga0209050_1000001 3300025298 Bacteria 3563507
155 Ga0207426_1025518 3300025302 Bacteria 1989
156 Ga0209051_1000232 3300025303 Bacteria 93680
157 Ga0209257_1019016 3300025304 Bacteria 2608
158 Ga0209257_1019023 3300025304 Bacteria 2607
159 Ga0207697_10028378 3300025315 Bacteria 2289
160 Ga0207656_10116322 3300025321 Bacteria 1241
161 Ga0207642_10100452 3300025899 Bacteria 1451
162 Ga0207688_10014422 3300025901 Bacteria 4296
163 Ga0207647_10002253 3300025904 Bacteria 14695
164 Ga0207647_10011905 3300025904 Bacteria 6077
165 Ga0207647_10012651 3300025904 Bacteria 5866
166 Ga0207645_10031820 3300025907 Bacteria 3392
167 Ga0207705_10010133 3300025909 Bacteria 6861
168 Ga0207705_10082101 3300025909 Bacteria 2350
169 Ga0207654_10330956 3300025911 Bacteria 1044
170 Ga0207707_10110130 3300025912 Bacteria 2407
171 Ga0207707_10281119 3300025912 Bacteria 1442
172 Ga0207695_10001859 3300025913 Bacteria 33075
173 Ga0207695_10012204 3300025913 Bacteria 10320
174 Ga0207695_10021549 3300025913 Bacteria 7349
175 Ga0207693_10097682 3300025915 Bacteria 2303
176 Ga0207657_10003172 3300025919 Bacteria 17595
177 Ga0207657_10003570 3300025919 Bacteria 16599
178 Ga0207657_10024573 3300025919 Bacteria 5574
179 Ga0207657_10236893 3300025919 Bacteria 1458
180 Ga0207649_10000285 3300025920 Bacteria 39556
181 Ga0207649_10000968 3300025920 Bacteria 17785
182 Ga0207649_10012781 3300025920 Bacteria 4670
183 Ga0207649_10019105 3300025920 Bacteria 3912
184 Ga0207649_10128443 3300025920 Bacteria 1718
185 Ga0207652_10228711 3300025921 Bacteria 1676
186 Ga0207681_10107174 3300025923 Bacteria 2026
187 Ga0207694_10041889 3300025924 Bacteria 3530
188 Ga0207694_10120918 3300025924 Bacteria 2091
189 Ga0207694_10123150 3300025924 Bacteria 2072
190 Ga0207694_10745564 3300025924 Bacteria 826
191 Ga0207659_10086378 3300025926 Bacteria 2332
192 Ga0207659_10608600 3300025926 Bacteria 932
193 Ga0207700_10131070 3300025928 Bacteria 2047
194 Ga0207664_10372257 3300025929 Bacteria 1267
195 Ga0207644_10006412 3300025931 Bacteria 7667
196 Ga0207644_10043358 3300025931 Bacteria 3192
197 Ga0207644_10101049 3300025931 Bacteria 2166
198 Ga0207644_10310152 3300025931 Bacteria 1274
199 Ga0207690_10009750 3300025932 Bacteria 5705
200 Ga0207690_10035205 3300025932 Bacteria 3232
201 Ga0207690_10036083 3300025932 Bacteria 3199
202 Ga0207706_10000920 3300025933 Bacteria 30195
203 Ga0207706_10003677 3300025933 Bacteria 14643
204 Ga0207706_10064210 3300025933 Bacteria 3232
205 Ga0207706_10178827 3300025933 Bacteria 1863
206 Ga0207706_10576797 3300025933 Bacteria 967
207 Ga0207691_10150751 3300025940 Bacteria 2044
208 Ga0207691_10507424 3300025940 Bacteria 1024
209 Ga0207711_10000567 3300025941 Bacteria 37685
210 Ga0207711_10000762 3300025941 Bacteria 31637
211 Ga0207689_10148457 3300025942 Bacteria 1932
212 Ga0207679_10024177 3300025945 Bacteria 4163
213 Ga0207667_10010740 3300025949 Bacteria 10680
214 Ga0207667_10020973 3300025949 Bacteria 7246
215 Ga0207667_10367635 3300025949 Bacteria 1466
216 Ga0207651_10062894 3300025960 Bacteria 2589
217 Ga0207712_10000069 3300025961 Bacteria 127318
218 Ga0207668_10038696 3300025972 Bacteria 3204
219 Ga0207640_10000260 3300025981 Bacteria 35737
220 Ga0207640_10017180 3300025981 Bacteria 4226
221 Ga0207640_10066381 3300025981 Bacteria 2411
222 Ga0207640_10130616 3300025981 Bacteria 1815
223 Ga0207640_10150897 3300025981 Bacteria 1707
224 Ga0207658_10195747 3300025986 Bacteria 1684
225 Ga0207658_10199817 3300025986 Bacteria 1668
226 Ga0207658_10414515 3300025986 Bacteria 1186
227 Ga0207677_10163329 3300026023 Bacteria 1733
228 Ga0207639_10017393 3300026041 Bacteria 5097
229 Ga0207639_10114486 3300026041 Bacteria 2204
230 Ga0207639_10225124 3300026041 Bacteria 1622
231 Ga0207639_10288378 3300026041 Bacteria 1446
232 Ga0207678_10005397 3300026067 Bacteria 11453
233 Ga0207678_10041420 3300026067 Bacteria 3994
234 Ga0207678_10066065 3300026067 Bacteria 3106
235 Ga0207678_10354466 3300026067 Bacteria 1266
236 Ga0207678_10886798 3300026067 Bacteria 789
237 Ga0207702_10008403 3300026078 Bacteria 8712
238 Ga0207702_10036938 3300026078 Bacteria 4086
239 Ga0207702_10037971 3300026078 Bacteria 4034
240 Ga0207702_10113830 3300026078 Bacteria 2410
241 Ga0207702_10146951 3300026078 Bacteria 2140
242 Ga0207702_10693547 3300026078 Bacteria 1003
243 Ga0207641_10002917 3300026088 Bacteria 15486
244 Ga0207641_10005629 3300026088 Bacteria 10676
245 Ga0207676_10003955 3300026095 Bacteria 10462
246 Ga0207676_10092132 3300026095 Bacteria 2491
247 Ga0207674_10002803 3300026116 Bacteria 21702
248 Ga0207674_10005074 3300026116 Bacteria 15715
249 Ga0207674_10027999 3300026116 Bacteria 5955
250 Ga0207674_10081707 3300026116 Bacteria 3233
251 Ga0207674_10125499 3300026116 Bacteria 2532
252 Ga0207683_10301192 3300026121 Bacteria 1467
253 Ga0207698_10002590 3300026142 Bacteria 10755
254 Ga0207698_10018532 3300026142 Bacteria 4745
255 Ga0207698_10223596 3300026142 Bacteria 1703
256 Ga0207698_10395844 3300026142 Bacteria 1319
257 Ga0268266_10006044 3300028379 Bacteria 11158
258 Ga0268266_10012945 3300028379 Bacteria 7194
259 Ga0268265_10000739 3300028380 Bacteria 31842
260 Ga0268265_10005687 3300028380 Bacteria 8513
261 Ga0268265_10220119 3300028380 Bacteria 1660
262 Ga0268265_10671583 3300028380 Bacteria 998
263 Ga0268264_10002308 3300028381 Bacteria 16874
264 Ga0268264_10002751 3300028381 Bacteria 15360
265 Ga0314311_1225350 3300030733 Bacteria 1498
266 Ga0316183_1184565 3300030742 Bacteria 2673
267 Ga0316182_1062397 3300030745 Bacteria 1580
268 Ga0265340_10142593 3300031247 Bacteria 1095
269 Ga0265331_10000020 3300031250 Bacteria 258149
270 Ga0265331_10021274 3300031250 Bacteria 3322
271 Ga0265327_10000869 3300031251 Bacteria 44810
272 Ga0307513_10005226 3300031456 Bacteria 17195
273 Ga0307408_100020741 3300031548 Bacteria 4439
274 Ga0307408_100145755 3300031548 Bacteria 1863
275 Ga0265314_10010899 3300031711 Bacteria 7557
276 Ga0265314_10127543 3300031711 Bacteria 1591
277 Ga0307405_10138279 3300031731 Bacteria 1694
278 Ga0307405_10275166 3300031731 Bacteria 1264
279 Ga0307413_10051474 3300031824 Bacteria 2482
280 Ga0307413_10171559 3300031824 Bacteria 1536
281 Ga0307413_10211716 3300031824 Bacteria 1408
282 Ga0307413_10216967 3300031824 Bacteria 1394
283 Ga0307413_10260503 3300031824 Bacteria 1292
284 Ga0307413_10300177 3300031824 Bacteria 1217
285 Ga0307410_10011694 3300031852 Bacteria 5033
286 Ga0307410_10029035 3300031852 Bacteria 3516
287 Ga0307410_10135789 3300031852 Bacteria 1813
288 Ga0307410_10300640 3300031852 Bacteria 1266
289 Ga0307406_10109186 3300031901 Bacteria 1901
290 Ga0307406_10140353 3300031901 Bacteria 1709
291 Ga0307407_10007248 3300031903 Bacteria 5010
292 Ga0307407_10252317 3300031903 Bacteria 1209
293 Ga0307412_10084252 3300031911 Bacteria 2206
294 Ga0307412_10142472 3300031911 Bacteria 1757
295 Ga0307412_10199453 3300031911 Bacteria 1518
296 Ga0307409_100007710 3300031995 Bacteria 6467
297 Ga0307409_100059207 3300031995 Bacteria 2980
298 Ga0307409_100106602 3300031995 Bacteria 2339
299 Ga0307409_100107865 3300031995 Bacteria 2327
300 Ga0307416_100096896 3300032002 Bacteria 2552
301 Ga0307416_100365066 3300032002 Bacteria 1468
302 Ga0307416_100913316 3300032002 Bacteria 978
303 Ga0307416_101174093 3300032002 Bacteria 873
304 Ga0307414_10015043 3300032004 Bacteria 4661
305 Ga0307414_10016847 3300032004 Bacteria 4456
306 Ga0307414_10078454 3300032004 Bacteria 2407
307 Ga0307414_10180666 3300032004 Bacteria 1696
308 Ga0307414_10311430 3300032004 Bacteria 1336
309 Ga0307411_10016586 3300032005 Bacteria 4171
310 Ga0307411_10115829 3300032005 Bacteria 1928
311 Ga0307411_10255307 3300032005 Bacteria 1381
312 Ga0307415_100010576 3300032126 Bacteria 5232
313 Ga0307415_100120992 3300032126 Bacteria 1963
314 Ga0307415_101184000 3300032126 Bacteria 719
315 Ga0373933_0048810 3300035724 Bacteria 2522
316 Ga0373937_0017416 3300036401 Bacteria 6400
317 Ga0395899_0003327 3300037312 Bacteria 12741
318 Ga0395899_0022685 3300037312 Bacteria 4755
319 Ga0395899_0036016 3300037312 Bacteria 3713
320 Ga0395899_0084916 3300037312 Bacteria 2301
321 Ga0395899_0089926 3300037312 Bacteria 2226
322 Ga0395899_0094003 3300037312 Bacteria 2170
323 Ga0395899_0100953 3300037312 Bacteria 2083
324 Ga0395899_0120687 3300037312 Bacteria 1878
325 Ga0395900_0003073 3300037418 Bacteria 18154
326 Ga0395900_0014574 3300037418 Bacteria 8020
327 Ga0395900_0017888 3300037418 Bacteria 7234
328 Ga0395900_0018181 3300037418 Bacteria 7170
329 Ga0395900_0070989 3300037418 Bacteria 3579
330 Ga0395900_0080712 3300037418 Bacteria 3343
331 Ga0395900_0085924 3300037418 Bacteria 3233
332 Ga0395900_0108598 3300037418 Bacteria 2850
333 Ga0395900_0130558 3300037418 Bacteria 2575
334 Ga0395900_0172284 3300037418 Bacteria 2202
335 Ga0395900_0172296 3300037418 Bacteria 2202
336 Ga0395900_0192553 3300037418 Bacteria 2067
337 Ga0395900_0278611 3300037418 Bacteria 1665
338 Ga0395900_0515844 3300037418 Bacteria 1144
339 Ga0395900_0700206 3300037418 Bacteria 947
340 Ga0395900_0830544 3300037418 Bacteria 850
341 Ga0395900_1050989 3300037418 Bacteria 733
342 Ga0395898_0035179 3300037466 Bacteria 4985
343 Ga0395898_0048695 3300037466 Bacteria 4154
344 Ga0395898_0056562 3300037466 Bacteria 3823
345 Ga0395898_0064297 3300037466 Bacteria 3558
346 Ga0395898_0078115 3300037466 Bacteria 3194
347 Ga0395898_0160724 3300037466 Bacteria 2148
348 Ga0395898_0252888 3300037466 Bacteria 1680
349 Ga0395898_0286793 3300037466 Bacteria 1570
350 Ga0395898_0486298 3300037466 Bacteria 1174
351 Ga0395905_0003006 3300037471 Bacteria 18282
352 Ga0395905_0004108 3300037471 Bacteria 15252
353 Ga0395905_0005974 3300037471 Bacteria 12329
354 Ga0395905_0007579 3300037471 Bacteria 10784
355 Ga0395905_0012053 3300037471 Bacteria 8334
356 Ga0395905_0019827 3300037471 Bacteria 6372
357 Ga0395905_0025027 3300037471 Bacteria 5630
358 Ga0395905_0037015 3300037471 Bacteria 4583
359 Ga0395905_0052370 3300037471 Bacteria 3821
360 Ga0395905_0053499 3300037471 Bacteria 3778
361 Ga0395905_0086422 3300037471 Bacteria 2939
362 Ga0395905_0117483 3300037471 Bacteria 2499
363 Ga0395905_0153732 3300037471 Bacteria 2164
364 Ga0395905_0194575 3300037471 Bacteria 1901
365 Ga0395905_0290612 3300037471 Bacteria 1521
366 Ga0395905_0322958 3300037471 Bacteria 1433
367 Ga0395905_0556902 3300037471 Bacteria 1048
368 Ga0395901_0012271 3300038443 Bacteria 8696
369 Ga0395901_0014166 3300038443 Bacteria 8119
370 Ga0395901_0014621 3300038443 Bacteria 7977
371 Ga0395901_0042144 3300038443 Bacteria 4732
372 Ga0395901_0045192 3300038443 Bacteria 4569
373 Ga0395901_0070354 3300038443 Bacteria 3645
374 Ga0395901_0093445 3300038443 Bacteria 3149
375 Ga0395901_0189021 3300038443 Bacteria 2160
376 Ga0395901_0342794 3300038443 Bacteria 1543
377 Ga0395901_0376558 3300038443 Unclassified 1462
378 Ga0395901_0687742 3300038443 Bacteria 1022
379 Ga0436361_0278225 3300039447 Bacteria 1387
380 Ga0439458_0000201 3300042157 Bacteria 13777
381 Ga0466969_0003298 3300044656 Bacteria 8579
382 Ga0466966_0000001 3300044684 Bacteria 410376
383 Ga0466966_0008406 3300044684 Bacteria 6828
384 Ga0466966_0021628 3300044684 Bacteria 4223
385 Ga0466966_0164484 3300044684 Bacteria 1350
386 Ga0466961_0010598 3300044693 Bacteria 5881
387 Ga0466961_0023070 3300044693 Bacteria 4001
388 Ga0466963_0039134 3300044694 Bacteria 3104
389 Ga0466963_0077120 3300044694 Bacteria 2251
390 Ga0466963_0150447 3300044694 Bacteria 1616
391 Ga0466964_0248736 3300044706 Unclassified 875
392 Ga0466971_0020307 3300044719 Bacteria 2953
393 Ga0466971_0095590 3300044719 Bacteria 1362
394 Ga0466970_0052170 3300044765 Bacteria 2183
395 Ga0466970_0065666 3300044765 Bacteria 1947
396 Ga0466957_0060194 3300044842 Bacteria 2328
397 Ga0466957_0404899 3300044842 Bacteria 934
398 Ga0466957_0454185 3300044842 Unclassified 883
399 Ga0466959_0023633 3300045049 Bacteria 4549
400 Ga0466959_0031963 3300045049 Bacteria 3895
401 Ga0451576_0000023 3300045051 Bacteria 477965
402 Ga0466958_0000281 3300045836 Bacteria 19782
403 Ga0466958_0093794 3300045836 Bacteria 1859
404 Ga0466958_0128495 3300045836 Bacteria 1590
405 Ga0466958_0328018 3300045836 Bacteria 984
406 Ga0466967_0954231 3300045976 Bacteria 853
407 Ga0495663_0010363 3300046525 Bacteria 2592
408 Ga0495663_0089012 3300046525 Bacteria 1004
409 Ga0495642_0091478 3300046528 Bacteria 1288
410 Ga0495654_0010002 3300046530 Bacteria 5180
411 Ga0495621_0035718 3300046539 Bacteria 1722
412 Ga0495633_0127230 3300046558 Bacteria 1179
413 Ga0495668_0011758 3300046616 Bacteria 5222
414 Ga0495668_0028910 3300046616 Bacteria 3133
415 Ga0495668_0076653 3300046616 Bacteria 1835
416 Ga0495625_0275959 3300046660 Bacteria 1083
417 Ga0495669_0006918 3300046684 Bacteria 4751
418 Ga0495669_0067851 3300046684 Bacteria 1622
419 Ga0495669_0182097 3300046684 Bacteria 1002
420 Ga0495589_0011649 3300046794 Bacteria 4565
421 Ga0495602_0019233 3300048088 Bacteria 6790
422 Ga0496101_0259588 3300048904 Bacteria 1355
423 Ga0496106_0128932 3300048909 Bacteria 1982
424 Ga0496107_0019944 3300048910 Bacteria 4734
425 Ga0496108_0002291 3300048911 Bacteria 15334
426 Ga0496108_0013000 3300048911 Bacteria 6782
427 Ga0496108_0040562 3300048911 Bacteria 3881
428 Ga0496109_0003046 3300048912 Bacteria 13969
429 Ga0496109_0003157 3300048912 Bacteria 13734
430 Ga0496110_0002679 3300048913 Bacteria 13443
431 Ga0496110_0818909 3300048913 Bacteria 836
432 Ga0496111_0002348 3300048914 Bacteria 11406
433 Ga0496111_0238001 3300048914 Bacteria 1352
434 Ga0496112_0001210 3300048915 Bacteria 19388
435 Ga0496112_0011765 3300048915 Bacteria 8013
436 Ga0496113_0013293 3300048916 Bacteria 5570
437 Ga0496115_0001130 3300048918 Bacteria 19264
438 Ga0496122_0220668 3300048925 Bacteria 1088
439 Ga0496123_0152245 3300048926 Bacteria 1246
440 Ga0496124_0426401 3300048927 Bacteria 912
441 Ga0496126_0002015 3300048929 Bacteria 28714
442 Ga0501032_0077365 3300049569 Bacteria 2215
443 Ga0501033_0005866 3300049570 Bacteria 9654
444 Ga0501034_0002130 3300049571 Bacteria 24593
445 Ga0501034_0058816 3300049571 Bacteria 3861
446 Ga0501036_0323002 3300049572 Bacteria 1289
447 Ga0501038_0055680 3300049574 Bacteria 3397
448 Ga0501039_0169233 3300049575 Bacteria 1718
449 Ga0501042_0087687 3300049578 Bacteria 2233
450 Ga0501046_0114192 3300049580 Bacteria 2060
451 Ga0501046_0136745 3300049580 Bacteria 1856
452 Ga0501047_0097660 3300049581 Bacteria 2815
453 Ga0501047_0267161 3300049581 Bacteria 1557
454 Ga0501068_0056564 3300049584 Bacteria 2378
455 Ga0501069_0095164 3300049585 Bacteria 1687
456 Ga0501070_0071776 3300049586 Bacteria 2866
457 Ga0501073_0045022 3300049589 Bacteria 3109
458 Ga0501223_000367 3300049663 Bacteria 11110
459 Ga0501224_000028 3300049664 Bacteria 53596
460 Ga0501233_000183 3300049668 Bacteria 9154
461 Ga0501234_007228 3300049707 Bacteria 1738
462 Ga0501080_0296678 3300049742 Bacteria 1467
463 Ga0501081_0383348 3300049743 Unclassified 1039
464 Ga0501035_0060114 3300049822 Bacteria 3383
465 Ga0501044_0063974 3300049823 Bacteria 3756
466 Ga0501045_0184334 3300049824 Bacteria 1555
467 Ga0501226_000191 3300049853 Bacteria 9822
468 nmdc:mga07m45_186491_c1 3300050496 Bacteria 1206
469 Ga0500562_045540 3300053108 Bacteria 1169
470 Ga0500592_001060 3300053116 Bacteria 4499
471 Ga0500595_002230 3300053119 Bacteria 9841
472 Ga0500559_0224129 3300053136 Bacteria 886
473 Ga0500627_0000889 3300053158 Bacteria 8007
474 Ga0466962_0049177 3300061719 Bacteria 2015
475 Ga0466962_0297413 3300061719 Bacteria 798
476 2885430332 2885429604 Bacteria 3642894
477 2896430926 2896429255 Bacteria 2557483
478 2928528473 2928526807 Bacteria 4760224
479 Ga0307408_100445860
480 SwRhRL3b_contig_2430896
481 JGI24736J21556_1000458
482 JGI24740J21852_10004923
483 JGI24740J21852_10020181
484 JGI24740J21852_10027561
485 JGI24740J21852_10049214
486 JGI24739J22299_10003612
487 JGI24737J22298_10010040
488 JGI24737J22298_10025276
489 JGI24735J21928_10003940
490 JGI24735J21928_10044593
491 JGI25150J39212_1000126
492 JGI25153J46596_10000305
493 rootH1_10152439
494 Ga0055526_1007718
495 Ga0055537_1004112
496 Ga0055536_1019790
497 Ga0055540_1000521
498 JGI25405J52794_10005305
499 Ga0065707_10000505
500 Ga0070658_10069571
501 Ga0070658_10084531
502 Ga0070658_10110755
503 Ga0070683_100135987
504 Ga0070683_100197311
505 Ga0070670_100150058
506 Ga0070677_10036575
507 Ga0068869_100348593
508 Ga0070680_100028641
509 Ga0068868_100094302
510 Ga0070660_100004038
511 Ga0070660_100079246
512 Ga0070660_100173617
513 Ga0070660_100252499
514 Ga0070660_100264823
515 Ga0070660_100830395
516 Ga0070689_100800056
517 Ga0070691_10011238
518 Ga0070661_100000041
519 Ga0070661_100001752
520 Ga0070661_100007298
521 Ga0070661_100094810
522 Ga0070668_100062336
523 Ga0070669_100053045
524 Ga0070669_100055238
525 Ga0070675_100079783
526 Ga0070675_100127814
527 Ga0070675_100374627
528 Ga0070671_100041419
529 Ga0070671_100073478
530 Ga0070659_100012271
531 Ga0070659_100312928
532 Ga0070667_100067450
533 Ga0070667_100362779
534 Ga0070714_100044626
535 Ga0070714_100174987
536 Ga0070663_100070851
537 Ga0070663_100152726
538 Ga0070662_100011232
539 Ga0070662_100052264
540 Ga0070662_100136175
541 Ga0070662_100415892
542 Ga0070681_10045388
543 Ga0070681_10392441
544 Ga0070679_100212360
545 Ga0070684_100146000
546 Ga0068853_100017003
547 Ga0068853_100020412
548 Ga0068853_100031229
549 Ga0068853_100043581
550 Ga0070672_100186843
551 Ga0070665_100007276
552 Ga0070665_100200794
553 Ga0068855_100478182
554 Ga0070664_100011210
555 Ga0068857_100028699
556 Ga0068854_100004251
557 Ga0068854_100018212
558 Ga0068854_100056403
559 Ga0068854_100770042
560 Ga0068856_100007943
561 Ga0068856_100071995
562 Ga0068856_100086923
563 Ga0068856_100339871
564 Ga0068856_100818848
565 Ga0068852_100999716
566 Ga0068859_100123766
567 Ga0068864_100001105
568 Ga0068864_100010992
569 Ga0068866_10139064
570 Ga0068863_100007010
571 Ga0068863_100019009
572 Ga0068860_100000944
573 Ga0068860_100120291
574 Ga0068862_100000280
575 Ga0068862_100014177
576 Ga0068862_100041438
577 Ga0081455_10000255
578 Ga0075370_10074500
579 Ga0068871_100150217
580 Ga0068865_100142304
581 Ga0097620_100123766
582 Ga0105240_10028067
583 Ga0105240_10556578
584 Ga0111539_10386723
585 Ga0105243_10017813
586 Ga0105241_10147136
587 Ga0105241_10367059
588 Ga0105248_10025650
589 Ga0105248_10081532
590 Ga0105238_10267270
591 Ga0105238_10377741
592 Ga0105238_10460163
593 Ga0105249_10000103
594 Ga0157373_10014018
595 Ga0157373_10053279
596 Ga0157373_10083688
597 Ga0157373_10095064
598 Ga0157373_10349771
599 Ga0157371_10063498
600 Ga0157371_10147436
601 Ga0157371_10176559
602 Ga0157371_10176678
603 Ga0157370_10007637
604 Ga0157370_10007721
605 Ga0157370_10062685
606 Ga0157370_10068173
607 Ga0157370_10121075
608 Ga0157369_10010712
609 Ga0157369_10102647
610 Ga0157369_10172849
611 Ga0157369_10184226
612 Ga0157369_10349735
613 Ga0163162_10302177
614 Ga0157372_10014336
615 Ga0157372_10110780
616 Ga0157372_10367412
617 Ga0157375_10066063
618 Ga0157375_11012889
619 Ga0157375_11389172
620 Ga0157380_10110229
621 Ga0157380_10209029
622 Ga0157380_10232345
623 Ga0157380_10340797
624 Ga0157376_10138893
625 Ga0207425_1000041
626 Ga0209129_1000359
627 Ga0209565_1000134
628 Ga0209676_1020341
629 Ga0209025_1000068
630 Ga0209564_1001020
631 Ga0209758_1000004
632 Ga0209050_1000001
633 Ga0207426_1025518
634 Ga0209051_1000232
635 Ga0209257_1019016
636 Ga0209257_1019023
637 Ga0207697_10028378
638 Ga0207656_10116322
639 Ga0207642_10100452
640 Ga0207688_10014422
641 Ga0207647_10002253
642 Ga0207647_10011905
643 Ga0207647_10012651
644 Ga0207645_10031820
645 Ga0207705_10010133
646 Ga0207705_10082101
647 Ga0207654_10330956
648 Ga0207707_10110130
649 Ga0207707_10281119
650 Ga0207695_10001859
651 Ga0207695_10012204
652 Ga0207695_10021549
653 Ga0207693_10097682
654 Ga0207657_10003172
655 Ga0207657_10003570
656 Ga0207657_10024573
657 Ga0207657_10236893
658 Ga0207649_10000285
659 Ga0207649_10000968
660 Ga0207649_10012781
661 Ga0207649_10019105
662 Ga0207649_10128443
663 Ga0207652_10228711
664 Ga0207681_10107174
665 Ga0207694_10041889
666 Ga0207694_10120918
667 Ga0207694_10123150
668 Ga0207694_10745564
669 Ga0207659_10086378
670 Ga0207659_10608600
671 Ga0207700_10131070
672 Ga0207664_10372257
673 Ga0207644_10006412
674 Ga0207644_10043358
675 Ga0207644_10101049
676 Ga0207644_10310152
677 Ga0207690_10009750
678 Ga0207690_10035205
679 Ga0207690_10036083
680 Ga0207706_10000920
681 Ga0207706_10003677
682 Ga0207706_10064210
683 Ga0207706_10178827
684 Ga0207706_10576797
685 Ga0207691_10150751
686 Ga0207691_10507424
687 Ga0207711_10000567
688 Ga0207711_10000762
689 Ga0207689_10148457
690 Ga0207679_10024177
691 Ga0207667_10010740
692 Ga0207667_10020973
693 Ga0207667_10367635
694 Ga0207651_10062894
695 Ga0207712_10000069
696 Ga0207668_10038696
697 Ga0207640_10000260
698 Ga0207640_10017180
699 Ga0207640_10066381
700 Ga0207640_10130616
701 Ga0207640_10150897
702 Ga0207658_10195747
703 Ga0207658_10199817
704 Ga0207658_10414515
705 Ga0207677_10163329
706 Ga0207639_10017393
707 Ga0207639_10114486
708 Ga0207639_10225124
709 Ga0207639_10288378
710 Ga0207678_10005397
711 Ga0207678_10041420
712 Ga0207678_10066065
713 Ga0207678_10354466
714 Ga0207678_10886798
715 Ga0207702_10008403
716 Ga0207702_10036938
717 Ga0207702_10037971
718 Ga0207702_10113830
719 Ga0207702_10146951
720 Ga0207702_10693547
721 Ga0207641_10002917
722 Ga0207641_10005629
723 Ga0207676_10003955
724 Ga0207676_10092132
725 Ga0207674_10002803
726 Ga0207674_10005074
727 Ga0207674_10027999
728 Ga0207674_10081707
729 Ga0207674_10125499
730 Ga0207683_10301192
731 Ga0207698_10002590
732 Ga0207698_10018532
733 Ga0207698_10223596
734 Ga0207698_10395844
735 Ga0268266_10006044
736 Ga0268266_10012945
737 Ga0268265_10000739
738 Ga0268265_10005687
739 Ga0268265_10220119
740 Ga0268265_10671583
741 Ga0268264_10002308
742 Ga0268264_10002751
743 Ga0314311_1225350
744 Ga0316183_1184565
745 Ga0316182_1062397
746 Ga0265340_10142593
747 Ga0265331_10000020
748 Ga0265331_10021274
749 Ga0265327_10000869
750 Ga0307513_10005226
751 Ga0307408_100020741
752 Ga0307408_100145755
753 Ga0265314_10010899
754 Ga0265314_10127543
755 Ga0307405_10138279
756 Ga0307405_10275166
757 Ga0307413_10051474
758 Ga0307413_10171559
759 Ga0307413_10211716
760 Ga0307413_10216967
761 Ga0307413_10260503
762 Ga0307413_10300177
763 Ga0307410_10011694
764 Ga0307410_10029035
765 Ga0307410_10135789
766 Ga0307410_10300640
767 Ga0307406_10109186
768 Ga0307406_10140353
769 Ga0307407_10007248
770 Ga0307407_10252317
771 Ga0307412_10084252
772 Ga0307412_10142472
773 Ga0307412_10199453
774 Ga0307409_100007710
775 Ga0307409_100059207
776 Ga0307409_100106602
777 Ga0307409_100107865
778 Ga0307416_100096896
779 Ga0307416_100365066
780 Ga0307416_100913316
781 Ga0307416_101174093
782 Ga0307414_10015043
783 Ga0307414_10016847
784 Ga0307414_10078454
785 Ga0307414_10180666
786 Ga0307414_10311430
787 Ga0307411_10016586
788 Ga0307411_10115829
789 Ga0307411_10255307
790 Ga0307415_100010576
791 Ga0307415_100120992
792 Ga0307415_101184000
793 Ga0373933_0048810
794 Ga0373937_0017416
795 Ga0395899_0003327
796 Ga0395899_0022685
797 Ga0395899_0036016
798 Ga0395899_0084916
799 Ga0395899_0089926
800 Ga0395899_0094003
801 Ga0395899_0100953
802 Ga0395899_0120687
803 Ga0395900_0003073
804 Ga0395900_0014574
805 Ga0395900_0017888
806 Ga0395900_0018181
807 Ga0395900_0070989
808 Ga0395900_0080712
809 Ga0395900_0085924
810 Ga0395900_0108598
811 Ga0395900_0130558
812 Ga0395900_0172284
813 Ga0395900_0172296
814 Ga0395900_0192553
815 Ga0395900_0278611
816 Ga0395900_0515844
817 Ga0395900_0700206
818 Ga0395900_0830544
819 Ga0395900_1050989
820 Ga0395898_0035179
821 Ga0395898_0048695
822 Ga0395898_0056562
823 Ga0395898_0064297
824 Ga0395898_0078115
825 Ga0395898_0160724
826 Ga0395898_0252888
827 Ga0395898_0286793
828 Ga0395898_0486298
829 Ga0395905_0003006
830 Ga0395905_0004108
831 Ga0395905_0005974
832 Ga0395905_0007579
833 Ga0395905_0012053
834 Ga0395905_0019827
835 Ga0395905_0025027
836 Ga0395905_0037015
837 Ga0395905_0052370
838 Ga0395905_0053499
839 Ga0395905_0086422
840 Ga0395905_0117483
841 Ga0395905_0153732
842 Ga0395905_0194575
843 Ga0395905_0290612
844 Ga0395905_0322958
845 Ga0395905_0556902
846 Ga0395901_0012271
847 Ga0395901_0014166
848 Ga0395901_0014621
849 Ga0395901_0042144
850 Ga0395901_0045192
851 Ga0395901_0070354
852 Ga0395901_0093445
853 Ga0395901_0189021
854 Ga0395901_0342794
855 Ga0395901_0376558
856 Ga0395901_0687742
857 Ga0436361_0278225
858 Ga0439458_0000201
859 Ga0466969_0003298
860 Ga0466966_0000001
861 Ga0466966_0008406
862 Ga0466966_0021628
863 Ga0466966_0164484
864 Ga0466961_0010598
865 Ga0466961_0023070
866 Ga0466963_0039134
867 Ga0466963_0077120
868 Ga0466963_0150447
869 Ga0466964_0248736
870 Ga0466971_0020307
871 Ga0466971_0095590
872 Ga0466970_0052170
873 Ga0466970_0065666
874 Ga0466957_0060194
875 Ga0466957_0404899
876 Ga0466957_0454185
877 Ga0466959_0023633
878 Ga0466959_0031963
879 Ga0451576_0000023
880 Ga0466958_0000281
881 Ga0466958_0093794
882 Ga0466958_0128495
883 Ga0466958_0328018
884 Ga0466967_0954231
885 Ga0495663_0010363
886 Ga0495663_0089012
887 Ga0495642_0091478
888 Ga0495654_0010002
889 Ga0495621_0035718
890 Ga0495633_0127230
891 Ga0495668_0011758
892 Ga0495668_0028910
893 Ga0495668_0076653
894 Ga0495625_0275959
895 Ga0495669_0006918
896 Ga0495669_0067851
897 Ga0495669_0182097
898 Ga0495589_0011649
899 Ga0495602_0019233
900 Ga0496101_0259588
901 Ga0496106_0128932
902 Ga0496107_0019944
903 Ga0496108_0002291
904 Ga0496108_0013000
905 Ga0496108_0040562
906 Ga0496109_0003046
907 Ga0496109_0003157
908 Ga0496110_0002679
909 Ga0496110_0818909
910 Ga0496111_0002348
911 Ga0496111_0238001
912 Ga0496112_0001210
913 Ga0496112_0011765
914 Ga0496113_0013293
915 Ga0496115_0001130
916 Ga0496122_0220668
917 Ga0496123_0152245
918 Ga0496124_0426401
919 Ga0496126_0002015
920 Ga0501032_0077365
921 Ga0501033_0005866
922 Ga0501034_0002130
923 Ga0501034_0058816
924 Ga0501036_0323002
925 Ga0501038_0055680
926 Ga0501039_0169233
927 Ga0501042_0087687
928 Ga0501046_0114192
929 Ga0501046_0136745
930 Ga0501047_0097660
931 Ga0501047_0267161
932 Ga0501068_0056564
933 Ga0501069_0095164
934 Ga0501070_0071776
935 Ga0501073_0045022
936 Ga0501223_000367
937 Ga0501224_000028
938 Ga0501233_000183
939 Ga0501234_007228
940 Ga0501080_0296678
941 Ga0501081_0383348
942 Ga0501035_0060114
943 Ga0501044_0063974
944 Ga0501045_0184334
945 Ga0501226_000191
946 nmdc:mga07m45_186491_c1
947 Ga0500562_045540
948 Ga0500592_001060
949 Ga0500595_002230
950 Ga0500559_0224129
951 Ga0500627_0000889
952 Ga0466962_0049177
953 Ga0466962_0297413
954 2885430332
955 2896430926
956 2928528473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

42

243

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.9053 1 200
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.8884 2 205
2feo-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp 0.8785 1 203
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.8722 2 205
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.8722 1 200
ID Description Score Start End Superfamily
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8544 1 203 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8353 1 203 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8324 1 203 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8207 1 203 3.40.50.300
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8164 2 207 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A520GVC1-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9942 1 134 GO:0005524
GO:0036430
GO:0036431
AF-A0A520GVC1-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9796 1 134 GO:0005524
GO:0036430
GO:0036431
AF-A0A7W6RZH5-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9771 1 205 GO:0004127
GO:0005524
GO:0005737
GO:0006220
GO:0016765
AF-A0A1G6Z0F0-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9713 1 206 GO:0005524
GO:0005737
GO:0006220
GO:0016765
GO:0036430
GO:0036431
AF-A0A1Q3JMQ5-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9705 1 160 GO:0004127
GO:0005524

Map