F451983

General Info

Members Datasets Scaffolds Average Seq Length
479 258 958 391

Family's Representative Sequence

Representative Sequence 3300003761|Ga0055535_1001910|Ga0055535_10019101
Length 465
Sequence MKRREFLLAAATAAVAAPALSFSGKLFAAPANSPRFLLVFLRGGYDCNNLLVPYSSDFYYESRPTLAIAKPDAYNTNSAIGLDSNWGLNPVLRDSIYPLWQKRQVAFVPFAGTDDMSRSHFETQDNIESGEQTDQRNNYRSGFMARLSGQMSGVPSIAFTDALPLSFQGSSRDIPNISLRGNPKPVYDERQANILAGMYRNTTLASAAADGLELRQTVSKELQEEMMKANRGAPNAKNFADETQRIATMMRDQYRLGFVDVGGWDTHVNQGSTTGQLANNLANLGKGIAAYADALGDEWNNTVVVVVSEFGRTFRENGNKGTDHGHGTVYWVLGGKVNGGRIAGQQVAVNAQSLLQNRDYPVLNNYRDMLGGLLGRMWGLSGSQLHSVFPGAHPVNAIKPKPLTNMRASGKDDAIQLTPATKFSLEQALDFIDDDELVEVTPKEIRMRKKHLTENDRKKASRGVA

Samples

Sample ID Description Type Environment
1 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
45 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
119 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
198 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
199 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
202 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
203 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
204 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
208 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
209 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
210 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
211 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
212 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
213 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
214 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
215 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
216 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
217 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
218 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
219 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
220 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
221 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
222 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
223 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
224 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
225 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
226 2643221640 Caulobacter sp. Root342 Isolate Unclassified
227 2643221642 Caulobacter sp. Root343 Isolate Unclassified
228 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
229 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
230 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
231 2734482264 Dyella sp. AD052 Isolate Unclassified
232 2738543009 Luteibacter sp. OK325 Isolate Unclassified
233 2739367700 Dyella sp. YR388 Isolate Unclassified
234 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
235 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
236 2818991457 Xanthomonas translucens 569 Isolate Unclassified
237 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
238 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
239 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
240 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
241 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
242 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
243 2884411467 Dyella sp. AD56 Isolate Rhizosphere
244 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
245 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
246 2919085039 Luteibacter sp. 1214 Isolate Unclassified
247 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
248 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
249 2928963466 Dyella japonica 1073 Isolate Unclassified
250 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
251 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
252 2941471342 Luteibacter sp. 621 Isolate Unclassified
253 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
254 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
255 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
256 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
257 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
258 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.52
Metatranscriptomes 0.63
Isolates 10.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.84
Nodule 0
Rhizoplane 7.1
Rhizosphere 49.06
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055535_1001910 3300003761 Bacteria 8751
2 JGI24736J21556_1001101 3300001904 Bacteria 4947
3 JGI24740J21852_10008155 3300001979 Bacteria 4199
4 JGI24739J22299_10000076 3300001989 Bacteria 27668
5 JGI24737J22298_10000304 3300001990 Bacteria 16452
6 JGI24737J22298_10045938 3300001990 Bacteria 1333
7 JGI24738J21930_10000238 3300002075 Bacteria 14950
8 JGI25156J39149_1007901 3300002705 Bacteria 2736
9 JGI25156J39149_1017980 3300002705 Bacteria 1320
10 JGI25162J39368_1000054 3300002737 Bacteria 147779
11 JGI25162J39368_1000132 3300002737 Bacteria 80803
12 JGI25162J39368_1000260 3300002737 Bacteria 50536
13 JGI25162J39368_1000595 3300002737 Bacteria 26219
14 JGI25162J39368_1000979 3300002737 Bacteria 18126
15 JGI25162J39368_1002803 3300002737 Bacteria 6127
16 JGI25162J39368_1003520 3300002737 Unclassified 4440
17 JGI25157J39369_1000364 3300002741 Bacteria 31214
18 JGI25157J39369_1000867 3300002741 Bacteria 14653
19 JGI25157J39369_1002864 3300002741 Bacteria 3880
20 JGI25157J39369_1004922 3300002741 Bacteria 2292
21 JGI25163J39215_1000075 3300002771 Bacteria 44331
22 JGI25163J39215_1000335 3300002771 Bacteria 15610
23 JGI25163J39215_1002334 3300002771 Bacteria 2025
24 JGI25164J39214_1000029 3300002772 Bacteria 147779
25 JGI25164J39214_1000035 3300002772 Bacteria 139987
26 JGI25164J39214_1000106 3300002772 Bacteria 80803
27 JGI25164J39214_1000133 3300002772 Bacteria 71595
28 JGI25164J39214_1000213 3300002772 Bacteria 47862
29 JGI25164J39214_1000256 3300002772 Bacteria 40098
30 JGI25165J46597_1000111 3300003214 Bacteria 147779
31 JGI25165J46597_1000217 3300003214 Bacteria 80803
32 JGI25165J46597_1000255 3300003214 Bacteria 71595
33 JGI25165J46597_1000397 3300003214 Bacteria 46032
34 JGI25165J46597_1000698 3300003214 Bacteria 26762
35 JGI25165J46597_1004667 3300003214 Bacteria 2858
36 rootH2_10162478 3300003320 Bacteria 2172
37 Ga0006562J51391_1062523 3300003578 Bacteria 4270
38 Ga0006562J51391_1062526 3300003578 Bacteria 1810
39 Ga0055538_1000340 3300003751 Bacteria 20779
40 Ga0055533_1001312 3300003756 Bacteria 6757
41 Ga0055525_1000089 3300003759 Bacteria 142096
42 Ga0055527_1000084 3300003760 Bacteria 74303
43 Ga0055527_1000503 3300003760 Bacteria 13896
44 Ga0055527_1001799 3300003760 Bacteria 4090
45 Ga0055527_1004950 3300003760 Bacteria 1781
46 Ga0055535_1000317 3300003761 Bacteria 48674
47 Ga0055535_1000349 3300003761 Bacteria 45885
48 Ga0055535_1000579 3300003761 Bacteria 30773
49 Ga0055535_1000944 3300003761 Bacteria 19266
50 Ga0055535_1001965 3300003761 Bacteria 8529
51 Ga0055542_1000082 3300003762 Bacteria 128120
52 Ga0055542_1000195 3300003762 Bacteria 74303
53 Ga0055542_1000327 3300003762 Bacteria 50536
54 Ga0055542_1000375 3300003762 Bacteria 45897
55 Ga0055542_1000600 3300003762 Bacteria 30773
56 Ga0055542_1000933 3300003762 Bacteria 19266
57 Ga0055529_1000228 3300003763 Bacteria 71595
58 Ga0055529_1000254 3300003763 Bacteria 64036
59 Ga0055529_1000507 3300003763 Bacteria 35026
60 Ga0055529_1000800 3300003763 Bacteria 19266
61 Ga0055529_1001360 3300003763 Bacteria 8004
62 Ga0058692_1000097 3300003856 Bacteria 58810
63 Ga0065165_1000566 3300005262 Bacteria 54948
64 Ga0065165_1004080 3300005262 Bacteria 9458
65 Ga0070658_10011494 3300005327 Bacteria 7100
66 Ga0070670_100001128 3300005331 Bacteria 21227
67 Ga0070689_100004531 3300005340 Bacteria 9407
68 Ga0070669_100141336 3300005353 Bacteria 1856
69 Ga0070714_100026675 3300005435 Bacteria 4777
70 Ga0070714_100187986 3300005435 Bacteria 1883
71 Ga0070713_100001782 3300005436 Bacteria 13876
72 Ga0068855_100004050 3300005563 Bacteria 17881
73 Ga0068857_100000300 3300005577 Bacteria 34132
74 Ga0068854_100000343 3300005578 Bacteria 29961
75 Ga0068854_100002114 3300005578 Bacteria 12177
76 Ga0068856_100057216 3300005614 Bacteria 3849
77 Ga0068852_100010857 3300005616 Bacteria 6825
78 Ga0068858_100096487 3300005842 Bacteria 2755
79 Ga0068860_100024960 3300005843 Bacteria 5771
80 Ga0105251_10000421 3300009011 Bacteria 41190
81 Ga0105251_10000771 3300009011 Bacteria 29136
82 Ga0105244_10025832 3300009036 Bacteria 3185
83 Ga0105240_10001721 3300009093 Bacteria 36937
84 Ga0105240_10007869 3300009093 Bacteria 15381
85 Ga0105240_10009439 3300009093 Bacteria 13810
86 Ga0105240_10051502 3300009093 Bacteria 5178
87 Ga0105240_10069743 3300009093 Bacteria 4350
88 Ga0105240_10289045 3300009093 Bacteria 1880
89 Ga0105247_10010140 3300009101 Bacteria 5707
90 Ga0105243_10000144 3300009148 Bacteria 81484
91 Ga0105243_10002137 3300009148 Bacteria 16716
92 Ga0105243_10132297 3300009148 Bacteria 2118
93 Ga0105237_10000063 3300009545 Bacteria 141759
94 Ga0105238_10020657 3300009551 Bacteria 6708
95 Ga0105239_10000043 3300010375 Bacteria 196600
96 Ga0105239_10014668 3300010375 Bacteria 8691
97 Ga0105239_10132420 3300010375 Bacteria 2774
98 Ga0157314_1000259 3300012500 Bacteria 5714
99 Ga0157347_1001500 3300012502 Bacteria 1843
100 Ga0157371_10000230 3300013102 Bacteria 80303
101 Ga0157370_10000407 3300013104 Bacteria 54357
102 Ga0157370_10001634 3300013104 Bacteria 27668
103 Ga0157370_10013778 3300013104 Bacteria 8308
104 Ga0157370_10208461 3300013104 Bacteria 1812
105 Ga0157369_10000080 3300013105 Bacteria 133011
106 Ga0157369_10014854 3300013105 Bacteria 8788
107 Ga0163162_10001186 3300013306 Bacteria 24300
108 Ga0163162_10073551 3300013306 Bacteria 3474
109 Ga0182008_10000790 3300014497 Bacteria 22189
110 Ga0182008_10004294 3300014497 Bacteria 8348
111 Ga0182006_1000430 3300015261 Bacteria 33536
112 Ga0182006_1000676 3300015261 Bacteria 23945
113 Ga0182006_1010359 3300015261 Bacteria 4146
114 Ga0182007_10002476 3300015262 Bacteria 9153
115 Ga0182005_1000028 3300015265 Bacteria 221889
116 Ga0182005_1000736 3300015265 Bacteria 14997
117 Ga0182005_1003663 3300015265 Bacteria 5152
118 Ga0183369_1009 3300015685 Bacteria 346348
119 Ga0163161_10021567 3300017792 Bacteria 4526
120 Ga0224712_10006317 3300022467 Bacteria 3369
121 Ga0209760_100015 3300025207 Bacteria 176281
122 Ga0209760_100047 3300025207 Bacteria 107520
123 Ga0209760_100727 3300025207 Bacteria 4910
124 Ga0209784_100133 3300025224 Bacteria 72169
125 Ga0209566_102250 3300025225 Bacteria 3775
126 Ga0209674_100148 3300025226 Bacteria 98100
127 Ga0209674_100269 3300025226 Bacteria 39856
128 Ga0209674_100439 3300025226 Bacteria 19443
129 Ga0209674_102759 3300025226 Bacteria 3558
130 Ga0209672_100007 3300025228 Bacteria 959482
131 Ga0209672_100029 3300025228 Bacteria 339298
132 Ga0209672_100058 3300025228 Bacteria 211992
133 Ga0209672_100841 3300025228 Bacteria 14165
134 Ga0209672_102342 3300025228 Bacteria 4783
135 Ga0209672_105200 3300025228 Bacteria 2266
136 Ga0209563_100051 3300025230 Bacteria 340545
137 Ga0207427_100001 3300025231 Bacteria 1410763
138 Ga0207427_100013 3300025231 Bacteria 581419
139 Ga0207427_100029 3300025231 Bacteria 376678
140 Ga0207427_100033 3300025231 Bacteria 338459
141 Ga0207427_100221 3300025231 Bacteria 49111
142 Ga0207427_100463 3300025231 Bacteria 22338
143 Ga0209437_100003 3300025233 Bacteria 1517827
144 Ga0209437_100009 3300025233 Bacteria 915954
145 Ga0209437_100015 3300025233 Bacteria 713457
146 Ga0209437_100020 3300025233 Bacteria 656374
147 Ga0209437_100079 3300025233 Bacteria 275948
148 Ga0209437_100106 3300025233 Bacteria 219071
149 Ga0209437_100352 3300025233 Bacteria 52711
150 Ga0209258_100046 3300025242 Bacteria 369794
151 Ga0209258_100053 3300025242 Bacteria 339233
152 Ga0209258_100095 3300025242 Bacteria 223270
153 Ga0209258_100413 3300025242 Bacteria 51260
154 Ga0209258_100444 3300025242 Bacteria 46475
155 Ga0209258_100991 3300025242 Bacteria 13111
156 Ga0209646_1001493 3300025246 Bacteria 6223
157 Ga0209646_1002278 3300025246 Bacteria 4385
158 Ga0209026_1000051 3300025250 Bacteria 250792
159 Ga0209026_1000074 3300025250 Bacteria 203820
160 Ga0209026_1000092 3300025250 Bacteria 170960
161 Ga0209026_1001965 3300025250 Bacteria 8246
162 Ga0209148_1000002 3300025254 Bacteria 2399500
163 Ga0209148_1000009 3300025254 Bacteria 1395625
164 Ga0209148_1000010 3300025254 Bacteria 1265567
165 Ga0209148_1000039 3300025254 Bacteria 482479
166 Ga0209148_1000087 3300025254 Bacteria 260905
167 Ga0209148_1000098 3300025254 Bacteria 233172
168 Ga0209148_1003324 3300025254 Bacteria 4531
169 Ga0209759_1000110 3300025256 Bacteria 144917
170 Ga0209759_1000278 3300025256 Bacteria 71965
171 Ga0209759_1000353 3300025256 Bacteria 59779
172 Ga0209759_1003639 3300025256 Bacteria 6066
173 Ga0209759_1008632 3300025256 Bacteria 3158
174 Ga0209233_1000007 3300025261 Bacteria 1411234
175 Ga0209233_1000009 3300025261 Bacteria 1265567
176 Ga0209233_1000020 3300025261 Bacteria 798224
177 Ga0209233_1000032 3300025261 Bacteria 623596
178 Ga0209233_1000080 3300025261 Bacteria 338459
179 Ga0209233_1000121 3300025261 Bacteria 233309
180 Ga0209233_1014060 3300025261 Bacteria 2267
181 Ga0209455_1000010 3300025272 Bacteria 959482
182 Ga0209455_1000034 3300025272 Bacteria 483129
183 Ga0209455_1000060 3300025272 Bacteria 339298
184 Ga0209455_1000120 3300025272 Bacteria 173966
185 Ga0209455_1010962 3300025272 Bacteria 2264
186 Ga0209758_1001152 3300025297 Bacteria 33838
187 Ga0209758_1014740 3300025297 Bacteria 4124
188 Ga0209256_1022342 3300025299 Bacteria 1917
189 Ga0207655_1000021 3300025728 Bacteria 518596
190 Ga0207713_1000175 3300025735 Bacteria 92467
191 Ga0207713_1003462 3300025735 Bacteria 10747
192 Ga0207680_10000005 3300025903 Bacteria 660983
193 Ga0207647_10000342 3300025904 Bacteria 37701
194 Ga0207647_10000504 3300025904 Bacteria 31238
195 Ga0207695_10001058 3300025913 Bacteria 48255
196 Ga0207695_10001605 3300025913 Bacteria 36692
197 Ga0207695_10002167 3300025913 Bacteria 29675
198 Ga0207695_10037705 3300025913 Bacteria 5213
199 Ga0207695_10066645 3300025913 Bacteria 3696
200 Ga0207671_10000021 3300025914 Bacteria 300409
201 Ga0207694_10044992 3300025924 Bacteria 3409
202 Ga0207650_10001154 3300025925 Bacteria 19376
203 Ga0207700_10003288 3300025928 Bacteria 9357
204 Ga0207709_10000250 3300025935 Bacteria 65488
205 Ga0207709_10000993 3300025935 Bacteria 21128
206 Ga0207709_10074843 3300025935 Bacteria 2162
207 Ga0207670_10005647 3300025936 Bacteria 6882
208 Ga0207667_10000142 3300025949 Bacteria 109610
209 Ga0207667_10000198 3300025949 Bacteria 87446
210 Ga0207640_10000014 3300025981 Bacteria 219683
211 Ga0207640_10000016 3300025981 Bacteria 208390
212 Ga0207640_10003593 3300025981 Bacteria 8360
213 Ga0207703_10092752 3300026035 Bacteria 2542
214 Ga0207702_10011516 3300026078 Bacteria 7369
215 Ga0207674_10000623 3300026116 Bacteria 46466
216 Ga0209371_1000209 3300027312 Bacteria 81879
217 Ga0268264_10083996 3300028381 Bacteria 2729
218 Ga0265319_1005829 3300028563 Bacteria 5815
219 Ga0265318_10000878 3300028577 Bacteria 19643
220 Ga0265338_10008934 3300028800 Bacteria 12058
221 Ga0265338_10054170 3300028800 Bacteria 3580
222 Ga0268256_1000167 3300030500 Bacteria 81875
223 Ga0265330_10002606 3300031235 Bacteria 9801
224 Ga0265332_10002933 3300031238 Bacteria 8391
225 Ga0265328_10000254 3300031239 Bacteria 24536
226 Ga0265328_10000321 3300031239 Bacteria 22427
227 Ga0265320_10002076 3300031240 Bacteria 14103
228 Ga0265320_10062639 3300031240 Bacteria 1770
229 Ga0265329_10005103 3300031242 Bacteria 5355
230 Ga0265339_10003964 3300031249 Bacteria 10230
231 Ga0265339_10051066 3300031249 Bacteria 2258
232 Ga0265331_10000762 3300031250 Bacteria 26873
233 Ga0265316_10003383 3300031344 Bacteria 16155
234 Ga0265313_10011614 3300031595 Bacteria 5460
235 Ga0265314_10006313 3300031711 Bacteria 10513
236 Ga0265314_10017420 3300031711 Bacteria 5640
237 Ga0265342_10003566 3300031712 Bacteria 12730
238 Ga0265342_10004501 3300031712 Bacteria 10937
239 Ga0307510_10002640 3300033180 Bacteria 20467
240 Ga0395899_0000369 3300037312 Bacteria 54244
241 Ga0395900_0002478 3300037418 Bacteria 20291
242 Ga0395900_0007174 3300037418 Bacteria 11550
243 Ga0395900_0016319 3300037418 Bacteria 7569
244 Ga0395900_0071455 3300037418 Bacteria 3567
245 Ga0395898_0000144 3300037466 Bacteria 187889
246 Ga0395898_0000305 3300037466 Bacteria 116565
247 Ga0395898_0044148 3300037466 Bacteria 4390
248 Ga0436364_0347636 3300037853 Bacteria 1484
249 Ga0395901_0009614 3300038443 Bacteria 9807
250 Ga0436365_0983980 3300039437 Bacteria 10324
251 Ga0439436_0000011 3300041404 Bacteria 100668
252 Ga0439465_0009587 3300041413 Bacteria 3050
253 Ga0451793_0005684 3300041452 Bacteria 3305
254 Ga0451800_0259382 3300041459 Bacteria 6248
255 Ga0451806_066390 3300041462 Bacteria 6259
256 Ga0451806_089397 3300041462 Bacteria 3130
257 Ga0451804_1082700 3300041463 Bacteria 3927
258 Ga0451807_0200971 3300041486 Bacteria 4447
259 Ga0451807_1908561 3300041486 Bacteria 6354
260 Ga0450908_000110 3300042184 Bacteria 16756
261 Ga0466969_0003624 3300044656 Bacteria 8219
262 Ga0466969_0019629 3300044656 Bacteria 3510
263 Ga0466969_0028914 3300044656 Bacteria 2832
264 Ga0466969_0033496 3300044656 Bacteria 2608
265 Ga0466982_0000004 3300044672 Bacteria 386724
266 Ga0466966_0011778 3300044684 Bacteria 5794
267 Ga0466966_0065192 3300044684 Bacteria 2291
268 Ga0466961_0000942 3300044693 Bacteria 18007
269 Ga0466961_0000946 3300044693 Bacteria 17985
270 Ga0466961_0006538 3300044693 Bacteria 7411
271 Ga0466961_0016996 3300044693 Bacteria 4673
272 Ga0466961_0058218 3300044693 Bacteria 2458
273 Ga0466971_0004845 3300044719 Bacteria 5822
274 Ga0466968_0033802 3300044735 Bacteria 2131
275 Ga0466970_0011075 3300044765 Bacteria 4591
276 Ga0466970_0031396 3300044765 Bacteria 2805
277 Ga0466970_0042233 3300044765 Bacteria 2424
278 Ga0466957_0000516 3300044842 Bacteria 19357
279 Ga0466959_0020483 3300045049 Bacteria 4873
280 Ga0466959_0027787 3300045049 Bacteria 4195
281 Ga0466959_0051227 3300045049 Bacteria 3029
282 Ga0466959_0096970 3300045049 Bacteria 2113
283 Ga0466958_0008344 3300045836 Bacteria 5740
284 Ga0466958_0063415 3300045836 Bacteria 2254
285 Ga0466958_0078491 3300045836 Bacteria 2029
286 Ga0495617_000427 3300046452 Bacteria 22691
287 Ga0495617_001466 3300046452 Bacteria 10334
288 Ga0495627_015023 3300046453 Bacteria 2682
289 Ga0495638_0000065 3300046460 Bacteria 170849
290 Ga0495638_0000094 3300046460 Bacteria 142168
291 Ga0495638_0000383 3300046460 Bacteria 54789
292 Ga0495650_0000078 3300046471 Bacteria 245487
293 Ga0495650_0000889 3300046471 Bacteria 35236
294 Ga0495584_0000634 3300046491 Bacteria 23450
295 Ga0495585_0000474 3300046492 Bacteria 38414
296 Ga0495607_0000211 3300046501 Bacteria 62291
297 Ga0495607_0001322 3300046501 Bacteria 22095
298 Ga0495607_0004681 3300046501 Bacteria 10013
299 Ga0495583_0082444 3300046506 Bacteria 1395
300 Ga0495606_0000227 3300046507 Bacteria 99782
301 Ga0495606_0001012 3300046507 Bacteria 40883
302 Ga0495606_0001507 3300046507 Bacteria 30968
303 Ga0495606_0004567 3300046507 Bacteria 13751
304 Ga0495610_0002369 3300046512 Bacteria 15921
305 Ga0495616_0000036 3300046513 Bacteria 128264
306 Ga0495616_0016081 3300046513 Bacteria 4145
307 Ga0495620_0000867 3300046515 Bacteria 18724
308 Ga0495620_0008023 3300046515 Bacteria 5687
309 Ga0495631_0000017 3300046518 Bacteria 98047
310 Ga0495631_0000302 3300046518 Bacteria 34239
311 Ga0495632_0000004 3300046519 Bacteria 381372
312 Ga0495632_0002854 3300046519 Bacteria 12750
313 Ga0495637_0007141 3300046520 Bacteria 5561
314 Ga0495648_0000596 3300046524 Bacteria 38657
315 Ga0495648_0010463 3300046524 Bacteria 7063
316 Ga0495609_0001641 3300046538 Bacteria 14575
317 Ga0495597_0060340 3300046542 Bacteria 1655
318 Ga0495611_0000001 3300046648 Bacteria 2628469
319 Ga0495611_0000022 3300046648 Bacteria 122452
320 Ga0495625_0000022 3300046660 Bacteria 278823
321 Ga0495625_0005584 3300046660 Bacteria 11409
322 Ga0495625_0010667 3300046660 Bacteria 7573
323 Ga0495625_0014112 3300046660 Bacteria 6393
324 Ga0495625_0026251 3300046660 Bacteria 4404
325 Ga0495661_0002334 3300046665 Bacteria 14638
326 Ga0495670_0000730 3300046691 Bacteria 15694
327 Ga0495670_0013748 3300046691 Bacteria 3979
328 Ga0495671_0001871 3300046692 Bacteria 13526
329 Ga0495649_0015687 3300046694 Bacteria 4307
330 Ga0495589_0000059 3300046794 Bacteria 107171
331 Ga0495660_0000732 3300046810 Bacteria 24961
332 Ga0495679_000004 3300047446 Bacteria 748056
333 Ga0495673_0000004 3300047469 Bacteria 1354526
334 Ga0495673_0000048 3300047469 Bacteria 265950
335 Ga0495673_0008009 3300047469 Bacteria 5987
336 Ga0495681_0002612 3300047470 Bacteria 12795
337 Ga0495686_0000017 3300047472 Bacteria 435554
338 Ga0495686_0001175 3300047472 Bacteria 30567
339 Ga0495686_0011496 3300047472 Bacteria 6234
340 Ga0495686_0035573 3300047472 Bacteria 3200
341 Ga0495686_0104577 3300047472 Bacteria 1704
342 Ga0496100_0001485 3300048903 Bacteria 11468
343 Ga0496100_0171960 3300048903 Bacteria 1561
344 Ga0496101_0001076 3300048904 Bacteria 16152
345 Ga0496102_0105218 3300048905 Bacteria 2625
346 Ga0496104_0065909 3300048907 Bacteria 3438
347 Ga0496104_0164587 3300048907 Bacteria 2127
348 Ga0496105_0005421 3300048908 Bacteria 9678
349 Ga0496106_0005074 3300048909 Bacteria 9746
350 Ga0496106_0141206 3300048909 Bacteria 1894
351 Ga0496113_0090038 3300048916 Bacteria 2363
352 Ga0496115_0005442 3300048918 Bacteria 9261
353 Ga0496115_0020292 3300048918 Bacteria 5125
354 Ga0496116_0000126 3300048919 Bacteria 160425
355 Ga0496117_0000623 3300048920 Bacteria 57364
356 Ga0496117_0010696 3300048920 Bacteria 8302
357 Ga0496117_0022723 3300048920 Bacteria 5023
358 Ga0496117_0045311 3300048920 Bacteria 3178
359 Ga0496118_0000859 3300048921 Bacteria 48226
360 Ga0496118_0000880 3300048921 Bacteria 47321
361 Ga0496118_0000955 3300048921 Bacteria 45248
362 Ga0496118_0001685 3300048921 Bacteria 32286
363 Ga0496118_0003125 3300048921 Bacteria 21217
364 Ga0496118_0029221 3300048921 Bacteria 4627
365 Ga0496119_0000131 3300048922 Bacteria 105813
366 Ga0496119_0000681 3300048922 Bacteria 45369
367 Ga0496119_0004641 3300048922 Bacteria 13558
368 Ga0496119_0014277 3300048922 Bacteria 6235
369 Ga0496120_0000674 3300048923 Bacteria 50098
370 Ga0496120_0008466 3300048923 Bacteria 7464
371 Ga0496120_0013980 3300048923 Bacteria 5371
372 Ga0496121_0000142 3300048924 Bacteria 160072
373 Ga0496121_0000372 3300048924 Bacteria 92348
374 Ga0496121_0000813 3300048924 Bacteria 56914
375 Ga0496121_0002559 3300048924 Bacteria 27533
376 Ga0496121_0005455 3300048924 Bacteria 16291
377 Ga0496121_0012908 3300048924 Bacteria 9032
378 Ga0496121_0073867 3300048924 Bacteria 2730
379 Ga0496122_0002347 3300048925 Bacteria 27272
380 Ga0496122_0005499 3300048925 Bacteria 15069
381 Ga0496122_0020315 3300048925 Bacteria 6009
382 Ga0496122_0023921 3300048925 Bacteria 5364
383 Ga0496123_0000434 3300048926 Bacteria 75349
384 Ga0496123_0004325 3300048926 Bacteria 15072
385 Ga0496123_0004626 3300048926 Bacteria 14292
386 Ga0496124_0000289 3300048927 Bacteria 95056
387 Ga0496124_0001096 3300048927 Bacteria 42580
388 Ga0496124_0002418 3300048927 Bacteria 24496
389 Ga0496124_0116504 3300048927 Bacteria 2142
390 Ga0496125_0000338 3300048928 Bacteria 89749
391 Ga0496125_0044046 3300048928 Bacteria 3780
392 Ga0496125_0196272 3300048928 Bacteria 1327
393 Ga0496126_0007218 3300048929 Bacteria 12222
394 Ga0496126_0025667 3300048929 Bacteria 5663
395 Ga0496126_0059165 3300048929 Bacteria 3451
396 Ga0496126_0101027 3300048929 Bacteria 2523
397 Ga0496126_0204515 3300048929 Bacteria 1665
398 Ga0495678_001184 3300049459 Bacteria 21486
399 Ga0495682_0000134 3300049460 Bacteria 64409
400 Ga0495682_0001128 3300049460 Bacteria 15518
401 Ga0495682_0006477 3300049460 Bacteria 4730
402 Ga0501031_0130398 3300049568 Bacteria 1643
403 Ga0501032_0011286 3300049569 Bacteria 6416
404 Ga0501039_0128685 3300049575 Bacteria 1987
405 Ga0501043_0084938 3300049579 Bacteria 2488
406 Ga0501046_0013243 3300049580 Bacteria 6989
407 Ga0501047_0212634 3300049581 Bacteria 1792
408 Ga0501048_0169200 3300049582 Bacteria 1548
409 Ga0501080_0010465 3300049742 Bacteria 8492
410 Ga0501035_0026033 3300049822 Bacteria 5358
411 Ga0501035_0249592 3300049822 Bacteria 1507
412 Ga0495601_0227837 3300053077 Bacteria 1217
413 Ga0500643_000020 3300053087 Bacteria 290328
414 Ga0500647_0095012 3300053091 Bacteria 1426
415 Ga0500651_0000788 3300053093 Bacteria 15475
416 Ga0500641_0037249 3300053096 Bacteria 1949
417 Ga0500555_000885 3300053103 Bacteria 10655
418 Ga0500655_000021 3300053133 Bacteria 43984
419 Ga0500590_000264 3300053148 Bacteria 16437
420 Ga0500622_0000984 3300053156 Bacteria 24183
421 Ga0500622_0022743 3300053156 Bacteria 3320
422 Ga0500633_0000191 3300053160 Bacteria 8577
423 Ga0500634_0000066 3300053161 Bacteria 43652
424 Ga0500639_021542 3300053163 Bacteria 3406
425 Ga0500570_003532 3300053724 Bacteria 8062
426 Ga0500645_002721 3300053730 Bacteria 7681
427 Ga0466962_0004616 3300061719 Bacteria 6613
428 2538832382 2537561836 Bacteria 3910579
429 2555668400 2554235341 Bacteria 6867980
430 2585260644 2582581305 Bacteria 4895574
431 2587918631 2585428106 Bacteria 5179711
432 2595446171 2593339238 Bacteria 4182970
433 2599355400 2599185160 Bacteria 6844013
434 2599360781 2599185161 Bacteria 6960462
435 2599367103 2599185162 Bacteria 6957254
436 2599373893 2599185163 Bacteria 6995158
437 2599380506 2599185164 Bacteria 6841688
438 2599386953 2599185165 Bacteria 6843250
439 2599392751 2599185166 Bacteria 6959206
440 2599404518 2599185168 Bacteria 6997636
441 2599462234 2599185181 Bacteria 6844519
442 2599466724 2599185182 Bacteria 6883168
443 2599490674 2599185186 Bacteria 6831633
444 2600214856 2599185356 Bacteria 6843884
445 2601774439 2600255313 Bacteria 6842543
446 2643830400 2643221562 Bacteria 4048635
447 2644224804 2643221640 Bacteria 5258820
448 2644234262 2643221642 Bacteria 5357871
449 2671098002 2667528171 Bacteria 6900659
450 2687582304 2687453130 Bacteria 4227172
451 2721026478 2718218334 Bacteria 4765486
452 2735833524 2734482264 Unclassified 5014763
453 2739229658 2738543009 Bacteria 4944499
454 2739730556 2739367700 Bacteria 4747630
455 2748018438 2747842501 Bacteria 5293829
456 2819563999 2818991440 Bacteria 4774720
457 2819661677 2818991457 Bacteria 5323295
458 2819703087 2818991464 Bacteria 6907494
459 2842917550 2842914999 Bacteria 4419378
460 2842919919 2842918807 Bacteria 4289178
461 2844668914 2844665904 Bacteria 6817974
462 2852688268 2852684882 Bacteria 5463342
463 2884341525 2884338543 Bacteria 4610696
464 2884413284 2884411467 Bacteria 5246714
465 2904464635 2904463128 Bacteria 4775606
466 2917072168 2917070673 Bacteria 6868303
467 2919088282 2919085039 Bacteria 4532964
468 2919134103 2919130084 Bacteria 5301837
469 2928533563 2928531327 Bacteria 5101314
470 2928964379 2928963466 Bacteria 5165703
471 2929199684 2929195423 Bacteria 5325372
472 2935354339 2935353572 Unclassified 6955622
473 2941472972 2941471342 Bacteria 5018624
474 2953995217 2953994433 Bacteria 4303959
475 3007425007 3007419365 Bacteria 7026924
476 637318762 637000220 Bacteria 7074893
477 8021626099 8021622325 Bacteria 4844743
478 8021628506 8021626552 Bacteria 4665214
479 8021649345 8021648035 Bacteria 4772378
480 Ga0055535_1001910
481 JGI24736J21556_1001101
482 JGI24740J21852_10008155
483 JGI24739J22299_10000076
484 JGI24737J22298_10000304
485 JGI24737J22298_10045938
486 JGI24738J21930_10000238
487 JGI25156J39149_1007901
488 JGI25156J39149_1017980
489 JGI25162J39368_1000054
490 JGI25162J39368_1000132
491 JGI25162J39368_1000260
492 JGI25162J39368_1000595
493 JGI25162J39368_1000979
494 JGI25162J39368_1002803
495 JGI25162J39368_1003520
496 JGI25157J39369_1000364
497 JGI25157J39369_1000867
498 JGI25157J39369_1002864
499 JGI25157J39369_1004922
500 JGI25163J39215_1000075
501 JGI25163J39215_1000335
502 JGI25163J39215_1002334
503 JGI25164J39214_1000029
504 JGI25164J39214_1000035
505 JGI25164J39214_1000106
506 JGI25164J39214_1000133
507 JGI25164J39214_1000213
508 JGI25164J39214_1000256
509 JGI25165J46597_1000111
510 JGI25165J46597_1000217
511 JGI25165J46597_1000255
512 JGI25165J46597_1000397
513 JGI25165J46597_1000698
514 JGI25165J46597_1004667
515 rootH2_10162478
516 Ga0006562J51391_1062523
517 Ga0006562J51391_1062526
518 Ga0055538_1000340
519 Ga0055533_1001312
520 Ga0055525_1000089
521 Ga0055527_1000084
522 Ga0055527_1000503
523 Ga0055527_1001799
524 Ga0055527_1004950
525 Ga0055535_1000317
526 Ga0055535_1000349
527 Ga0055535_1000579
528 Ga0055535_1000944
529 Ga0055535_1001965
530 Ga0055542_1000082
531 Ga0055542_1000195
532 Ga0055542_1000327
533 Ga0055542_1000375
534 Ga0055542_1000600
535 Ga0055542_1000933
536 Ga0055529_1000228
537 Ga0055529_1000254
538 Ga0055529_1000507
539 Ga0055529_1000800
540 Ga0055529_1001360
541 Ga0058692_1000097
542 Ga0065165_1000566
543 Ga0065165_1004080
544 Ga0070658_10011494
545 Ga0070670_100001128
546 Ga0070689_100004531
547 Ga0070669_100141336
548 Ga0070714_100026675
549 Ga0070714_100187986
550 Ga0070713_100001782
551 Ga0068855_100004050
552 Ga0068857_100000300
553 Ga0068854_100000343
554 Ga0068854_100002114
555 Ga0068856_100057216
556 Ga0068852_100010857
557 Ga0068858_100096487
558 Ga0068860_100024960
559 Ga0105251_10000421
560 Ga0105251_10000771
561 Ga0105244_10025832
562 Ga0105240_10001721
563 Ga0105240_10007869
564 Ga0105240_10009439
565 Ga0105240_10051502
566 Ga0105240_10069743
567 Ga0105240_10289045
568 Ga0105247_10010140
569 Ga0105243_10000144
570 Ga0105243_10002137
571 Ga0105243_10132297
572 Ga0105237_10000063
573 Ga0105238_10020657
574 Ga0105239_10000043
575 Ga0105239_10014668
576 Ga0105239_10132420
577 Ga0157314_1000259
578 Ga0157347_1001500
579 Ga0157371_10000230
580 Ga0157370_10000407
581 Ga0157370_10001634
582 Ga0157370_10013778
583 Ga0157370_10208461
584 Ga0157369_10000080
585 Ga0157369_10014854
586 Ga0163162_10001186
587 Ga0163162_10073551
588 Ga0182008_10000790
589 Ga0182008_10004294
590 Ga0182006_1000430
591 Ga0182006_1000676
592 Ga0182006_1010359
593 Ga0182007_10002476
594 Ga0182005_1000028
595 Ga0182005_1000736
596 Ga0182005_1003663
597 Ga0183369_1009
598 Ga0163161_10021567
599 Ga0224712_10006317
600 Ga0209760_100015
601 Ga0209760_100047
602 Ga0209760_100727
603 Ga0209784_100133
604 Ga0209566_102250
605 Ga0209674_100148
606 Ga0209674_100269
607 Ga0209674_100439
608 Ga0209674_102759
609 Ga0209672_100007
610 Ga0209672_100029
611 Ga0209672_100058
612 Ga0209672_100841
613 Ga0209672_102342
614 Ga0209672_105200
615 Ga0209563_100051
616 Ga0207427_100001
617 Ga0207427_100013
618 Ga0207427_100029
619 Ga0207427_100033
620 Ga0207427_100221
621 Ga0207427_100463
622 Ga0209437_100003
623 Ga0209437_100009
624 Ga0209437_100015
625 Ga0209437_100020
626 Ga0209437_100079
627 Ga0209437_100106
628 Ga0209437_100352
629 Ga0209258_100046
630 Ga0209258_100053
631 Ga0209258_100095
632 Ga0209258_100413
633 Ga0209258_100444
634 Ga0209258_100991
635 Ga0209646_1001493
636 Ga0209646_1002278
637 Ga0209026_1000051
638 Ga0209026_1000074
639 Ga0209026_1000092
640 Ga0209026_1001965
641 Ga0209148_1000002
642 Ga0209148_1000009
643 Ga0209148_1000010
644 Ga0209148_1000039
645 Ga0209148_1000087
646 Ga0209148_1000098
647 Ga0209148_1003324
648 Ga0209759_1000110
649 Ga0209759_1000278
650 Ga0209759_1000353
651 Ga0209759_1003639
652 Ga0209759_1008632
653 Ga0209233_1000007
654 Ga0209233_1000009
655 Ga0209233_1000020
656 Ga0209233_1000032
657 Ga0209233_1000080
658 Ga0209233_1000121
659 Ga0209233_1014060
660 Ga0209455_1000010
661 Ga0209455_1000034
662 Ga0209455_1000060
663 Ga0209455_1000120
664 Ga0209455_1010962
665 Ga0209758_1001152
666 Ga0209758_1014740
667 Ga0209256_1022342
668 Ga0207655_1000021
669 Ga0207713_1000175
670 Ga0207713_1003462
671 Ga0207680_10000005
672 Ga0207647_10000342
673 Ga0207647_10000504
674 Ga0207695_10001058
675 Ga0207695_10001605
676 Ga0207695_10002167
677 Ga0207695_10037705
678 Ga0207695_10066645
679 Ga0207671_10000021
680 Ga0207694_10044992
681 Ga0207650_10001154
682 Ga0207700_10003288
683 Ga0207709_10000250
684 Ga0207709_10000993
685 Ga0207709_10074843
686 Ga0207670_10005647
687 Ga0207667_10000142
688 Ga0207667_10000198
689 Ga0207640_10000014
690 Ga0207640_10000016
691 Ga0207640_10003593
692 Ga0207703_10092752
693 Ga0207702_10011516
694 Ga0207674_10000623
695 Ga0209371_1000209
696 Ga0268264_10083996
697 Ga0265319_1005829
698 Ga0265318_10000878
699 Ga0265338_10008934
700 Ga0265338_10054170
701 Ga0268256_1000167
702 Ga0265330_10002606
703 Ga0265332_10002933
704 Ga0265328_10000254
705 Ga0265328_10000321
706 Ga0265320_10002076
707 Ga0265320_10062639
708 Ga0265329_10005103
709 Ga0265339_10003964
710 Ga0265339_10051066
711 Ga0265331_10000762
712 Ga0265316_10003383
713 Ga0265313_10011614
714 Ga0265314_10006313
715 Ga0265314_10017420
716 Ga0265342_10003566
717 Ga0265342_10004501
718 Ga0307510_10002640
719 Ga0395899_0000369
720 Ga0395900_0002478
721 Ga0395900_0007174
722 Ga0395900_0016319
723 Ga0395900_0071455
724 Ga0395898_0000144
725 Ga0395898_0000305
726 Ga0395898_0044148
727 Ga0436364_0347636
728 Ga0395901_0009614
729 Ga0436365_0983980
730 Ga0439436_0000011
731 Ga0439465_0009587
732 Ga0451793_0005684
733 Ga0451800_0259382
734 Ga0451806_066390
735 Ga0451806_089397
736 Ga0451804_1082700
737 Ga0451807_0200971
738 Ga0451807_1908561
739 Ga0450908_000110
740 Ga0466969_0003624
741 Ga0466969_0019629
742 Ga0466969_0028914
743 Ga0466969_0033496
744 Ga0466982_0000004
745 Ga0466966_0011778
746 Ga0466966_0065192
747 Ga0466961_0000942
748 Ga0466961_0000946
749 Ga0466961_0006538
750 Ga0466961_0016996
751 Ga0466961_0058218
752 Ga0466971_0004845
753 Ga0466968_0033802
754 Ga0466970_0011075
755 Ga0466970_0031396
756 Ga0466970_0042233
757 Ga0466957_0000516
758 Ga0466959_0020483
759 Ga0466959_0027787
760 Ga0466959_0051227
761 Ga0466959_0096970
762 Ga0466958_0008344
763 Ga0466958_0063415
764 Ga0466958_0078491
765 Ga0495617_000427
766 Ga0495617_001466
767 Ga0495627_015023
768 Ga0495638_0000065
769 Ga0495638_0000094
770 Ga0495638_0000383
771 Ga0495650_0000078
772 Ga0495650_0000889
773 Ga0495584_0000634
774 Ga0495585_0000474
775 Ga0495607_0000211
776 Ga0495607_0001322
777 Ga0495607_0004681
778 Ga0495583_0082444
779 Ga0495606_0000227
780 Ga0495606_0001012
781 Ga0495606_0001507
782 Ga0495606_0004567
783 Ga0495610_0002369
784 Ga0495616_0000036
785 Ga0495616_0016081
786 Ga0495620_0000867
787 Ga0495620_0008023
788 Ga0495631_0000017
789 Ga0495631_0000302
790 Ga0495632_0000004
791 Ga0495632_0002854
792 Ga0495637_0007141
793 Ga0495648_0000596
794 Ga0495648_0010463
795 Ga0495609_0001641
796 Ga0495597_0060340
797 Ga0495611_0000001
798 Ga0495611_0000022
799 Ga0495625_0000022
800 Ga0495625_0005584
801 Ga0495625_0010667
802 Ga0495625_0014112
803 Ga0495625_0026251
804 Ga0495661_0002334
805 Ga0495670_0000730
806 Ga0495670_0013748
807 Ga0495671_0001871
808 Ga0495649_0015687
809 Ga0495589_0000059
810 Ga0495660_0000732
811 Ga0495679_000004
812 Ga0495673_0000004
813 Ga0495673_0000048
814 Ga0495673_0008009
815 Ga0495681_0002612
816 Ga0495686_0000017
817 Ga0495686_0001175
818 Ga0495686_0011496
819 Ga0495686_0035573
820 Ga0495686_0104577
821 Ga0496100_0001485
822 Ga0496100_0171960
823 Ga0496101_0001076
824 Ga0496102_0105218
825 Ga0496104_0065909
826 Ga0496104_0164587
827 Ga0496105_0005421
828 Ga0496106_0005074
829 Ga0496106_0141206
830 Ga0496113_0090038
831 Ga0496115_0005442
832 Ga0496115_0020292
833 Ga0496116_0000126
834 Ga0496117_0000623
835 Ga0496117_0010696
836 Ga0496117_0022723
837 Ga0496117_0045311
838 Ga0496118_0000859
839 Ga0496118_0000880
840 Ga0496118_0000955
841 Ga0496118_0001685
842 Ga0496118_0003125
843 Ga0496118_0029221
844 Ga0496119_0000131
845 Ga0496119_0000681
846 Ga0496119_0004641
847 Ga0496119_0014277
848 Ga0496120_0000674
849 Ga0496120_0008466
850 Ga0496120_0013980
851 Ga0496121_0000142
852 Ga0496121_0000372
853 Ga0496121_0000813
854 Ga0496121_0002559
855 Ga0496121_0005455
856 Ga0496121_0012908
857 Ga0496121_0073867
858 Ga0496122_0002347
859 Ga0496122_0005499
860 Ga0496122_0020315
861 Ga0496122_0023921
862 Ga0496123_0000434
863 Ga0496123_0004325
864 Ga0496123_0004626
865 Ga0496124_0000289
866 Ga0496124_0001096
867 Ga0496124_0002418
868 Ga0496124_0116504
869 Ga0496125_0000338
870 Ga0496125_0044046
871 Ga0496125_0196272
872 Ga0496126_0007218
873 Ga0496126_0025667
874 Ga0496126_0059165
875 Ga0496126_0101027
876 Ga0496126_0204515
877 Ga0495678_001184
878 Ga0495682_0000134
879 Ga0495682_0001128
880 Ga0495682_0006477
881 Ga0501031_0130398
882 Ga0501032_0011286
883 Ga0501039_0128685
884 Ga0501043_0084938
885 Ga0501046_0013243
886 Ga0501047_0212634
887 Ga0501048_0169200
888 Ga0501080_0010465
889 Ga0501035_0026033
890 Ga0501035_0249592
891 Ga0495601_0227837
892 Ga0500643_000020
893 Ga0500647_0095012
894 Ga0500651_0000788
895 Ga0500641_0037249
896 Ga0500555_000885
897 Ga0500655_000021
898 Ga0500590_000264
899 Ga0500622_0000984
900 Ga0500622_0022743
901 Ga0500633_0000191
902 Ga0500634_0000066
903 Ga0500639_021542
904 Ga0500570_003532
905 Ga0500645_002721
906 Ga0466962_0004616
907 2538832382
908 2555668400
909 2585260644
910 2587918631
911 2595446171
912 2599355400
913 2599360781
914 2599367103
915 2599373893
916 2599380506
917 2599386953
918 2599392751
919 2599404518
920 2599462234
921 2599466724
922 2599490674
923 2600214856
924 2601774439
925 2643830400
926 2644224804
927 2644234262
928 2671098002
929 2687582304
930 2721026478
931 2735833524
932 2739229658
933 2739730556
934 2748018438
935 2819563999
936 2819661677
937 2819703087
938 2842917550
939 2842919919
940 2844668914
941 2852688268
942 2884341525
943 2884413284
944 2904464635
945 2917072168
946 2919088282
947 2919134103
948 2928533563
949 2928964379
950 2929199684
951 2935354339
952 2941472972
953 2953995217
954 3007425007
955 637318762
956 8021626099
957 8021628506
958 8021649345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21018

BipA_C

TypA/BipA C-terminal domain

390

454

0.96

PF07394

DUF1501

Protein of unknown function (DUF1501)

33

389

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ely-assembly1.cif.gz_B e. coli alkaline phosphatase mutant (s102c) 0.6385 234 330
4lrb-assembly1.cif.gz_A phosphopentomutase s154g variant soaked with 2,3-dideoxyribose 5-phosphate 0.6081 132 396
3uo0-assembly2.cif.gz_B phosphorylated bacillus cereus phosphopentomutase soaked with glucose 1,6-bisphosphate 0.5944 132 396
4yr1-assembly1.cif.gz_B crystal structure of e. coli alkaline phosphatase d101a/d153a in complex with inorganic phosphate 0.5836 234 330
3un3-assembly3.cif.gz_C phosphopentomutase t85q variant soaked with glucose 1,6-bisphosphate 0.5809 132 377
ID Description Score Start End Superfamily
af_Q60DG6_84_389_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.6766 231 288 3.40.800.20
2zktA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6452 30 332 3.40.720.10
af_Q19963_189_388_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5825 30 329 3.40.720.10
af_Q19963_189_388_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5776 30 329 3.40.720.10
af_P40367_51_359_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.568 31 377 3.40.720.10
ID Description Score Start End GO Terms
AF-E6PMG4-F1-model_v4 Protein containing DUF1501 0.9534 236 396
AF-A0A522M5D3-F1-model_v4 DUF1501 domain-containing protein 0.9496 279 396
AF-A0A522M5D3-F1-model_v4 DUF1501 domain-containing protein 0.9341 279 396
AF-E6PMG4-F1-model_v4 Protein containing DUF1501 0.9308 236 396
AF-A0A5C7A6J0-F1-model_v4 DUF1501 domain-containing protein 0.8946 11 396

Map