F451986

General Info

Members Datasets Scaffolds Average Seq Length
479 223 958 208

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1000262|Ga0055536_100026221
Length 234
Sequence MRICHTLALQMTFAEVSPAEDRGASNFRGHAMKLYFAPMTCSLSPHIVLRELGLPFELIRVNNQTKRTADGRDLREINPKGYVAALQLDNGEVLTEGPAILQFLADQVPGNTLAPAVGTWERIRLQEHLNFIGSEIHGTSAPLFSAEIPETVKAIFRQKLFKRLDYLERILADRNYLMASFGVADAYLFTVLTWLPTFDIDIAEWPALATYMQRIGARPCVHAAIAAEAATQPV

Samples

Sample ID Description Type Environment
1 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
62 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
68 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
91 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
92 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
93 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
94 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
95 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
96 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
97 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
98 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
99 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
100 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
101 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
102 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
182 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
183 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
184 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
185 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 2511231023 Pseudomonas sp. GM80 Isolate Nodule
187 2511231031 Pseudomonas sp. GM16 Isolate Nodule
188 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
189 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
190 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
191 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
192 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
193 2738541297 Duganella sp. GV083 Isolate Unclassified
194 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
195 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
196 2738541357 Duganella sp. GV053 Isolate Unclassified
197 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
198 2738543003 Duganella sp. GV066 Isolate Unclassified
199 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
200 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
201 2738543026 Duganella sp. GV089 Isolate Unclassified
202 2738543029 Duganella sp. GV039 Isolate Unclassified
203 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
204 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
205 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
206 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
207 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
208 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
209 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
210 2865014394 Pantoea sp. R-71966 Isolate Unclassified
211 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
212 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
213 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
214 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
215 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
216 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
217 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
218 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
219 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
220 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
221 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
222 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
223 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.65
Metatranscriptomes 0.42
Isolates 7.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.01
Nodule 2.09
Rhizoplane 1.88
Rhizosphere 78.71
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000262 3300003781 Bacteria 41063
2 JGI24739J22299_10008082 3300001989 Bacteria 3929
3 JGI24737J22298_10018767 3300001990 Bacteria 2216
4 JGI24735J21928_10001219 3300002067 Bacteria 9146
5 JGI24738J21930_10000392 3300002075 Bacteria 12227
6 rootH1_10175983 3300003323 Bacteria 1878
7 rootH1_10280171 3300003323 Unclassified 1761
8 Ga0055536_1042198 3300003781 Bacteria 1069
9 Ga0055530_10000122 3300003791 Bacteria 67358
10 Ga0055530_10002989 3300003791 Bacteria 10158
11 Ga0055540_1000008 3300003792 Bacteria 309635
12 Ga0055540_1000155 3300003792 Bacteria 67358
13 Ga0055531_10000182 3300003794 Bacteria 70786
14 Ga0070658_10296948 3300005327 Bacteria 1377
15 Ga0070670_100045243 3300005331 Bacteria 3783
16 Ga0070660_100285754 3300005339 Bacteria 1350
17 Ga0070668_100072022 3300005347 Bacteria 2692
18 Ga0070667_100856454 3300005367 Bacteria 845
19 Ga0070709_10279555 3300005434 Bacteria 1212
20 Ga0070713_100185948 3300005436 Bacteria 1870
21 Ga0070708_100030079 3300005445 Bacteria 4691
22 Ga0070662_100074577 3300005457 Bacteria 2510
23 Ga0070706_100087032 3300005467 Bacteria 2896
24 Ga0070665_100005513 3300005548 Bacteria 13025
25 Ga0070665_100080588 3300005548 Bacteria 3261
26 Ga0070665_101421019 3300005548 Bacteria 703
27 Ga0068862_100678787 3300005844 Unclassified 996
28 Ga0075432_10093334 3300006058 Bacteria 1104
29 Ga0070716_100089396 3300006173 Bacteria 1860
30 Ga0075436_100124620 3300006914 Bacteria 1805
31 Ga0079104_1000054 3300006946 Bacteria 168000
32 Ga0079104_1019721 3300006946 Bacteria 1876
33 Ga0079104_1025452 3300006946 Bacteria 1544
34 Ga0099826_10027056 3300006948 Bacteria 4219
35 Ga0105251_10021557 3300009011 Bacteria 3361
36 Ga0105251_10032333 3300009011 Bacteria 2609
37 Ga0105244_10001727 3300009036 Bacteria 17208
38 Ga0105244_10004944 3300009036 Bacteria 9009
39 Ga0105244_10064960 3300009036 Bacteria 1829
40 Ga0105250_10003534 3300009092 Bacteria 7363
41 Ga0105250_10007262 3300009092 Bacteria 4769
42 Ga0105250_10015755 3300009092 Bacteria 3093
43 Ga0105250_10160381 3300009092 Bacteria 939
44 Ga0111539_10027086 3300009094 Bacteria 7001
45 Ga0105243_10000060 3300009148 Bacteria 128124
46 Ga0099796_10002760 3300010159 Bacteria 3937
47 Ga0105246_10013600 3300011119 Bacteria 5105
48 Ga0105246_10179115 3300011119 Bacteria 1630
49 Ga0105246_10427469 3300011119 Unclassified 1107
50 Ga0157345_1000122 3300012498 Bacteria 15294
51 Ga0157373_10007864 3300013100 Bacteria 7931
52 Ga0157373_10101635 3300013100 Bacteria 2023
53 Ga0157371_10003129 3300013102 Bacteria 15287
54 Ga0157370_10007840 3300013104 Bacteria 11570
55 Ga0157369_10001093 3300013105 Bacteria 33888
56 Ga0157369_10019300 3300013105 Bacteria 7628
57 Ga0157369_10382021 3300013105 Bacteria 1462
58 Ga0163162_10000137 3300013306 Bacteria 66670
59 Ga0163162_10043563 3300013306 Bacteria 4494
60 Ga0157372_11078682 3300013307 Bacteria 929
61 Ga0157375_10021236 3300013308 Bacteria 5949
62 Ga0182008_10158561 3300014497 Bacteria 1138
63 Ga0182008_10236641 3300014497 Bacteria 938
64 Ga0157379_10056373 3300014968 Bacteria 3511
65 Ga0182006_1000029 3300015261 Bacteria 247579
66 Ga0182006_1000396 3300015261 Bacteria 35562
67 Ga0182006_1004569 3300015261 Bacteria 6804
68 Ga0182006_1005798 3300015261 Bacteria 5821
69 Ga0182006_1050724 3300015261 Bacteria 1598
70 Ga0182006_1067318 3300015261 Bacteria 1337
71 Ga0182007_10002142 3300015262 Bacteria 10067
72 Ga0182007_10015072 3300015262 Bacteria 2896
73 Ga0182007_10048829 3300015262 Bacteria 1398
74 Ga0182005_1000037 3300015265 Bacteria 166102
75 Ga0182005_1043407 3300015265 Bacteria 1222
76 Ga0163161_10000054 3300017792 Bacteria 117153
77 Ga0163161_10269418 3300017792 Bacteria 1332
78 Ga0163161_10280735 3300017792 Bacteria 1306
79 Ga0163161_10481333 3300017792 Bacteria 1008
80 Ga0209233_1000702 3300025261 Bacteria 15734
81 Ga0209676_1000002 3300025292 Bacteria 1732948
82 Ga0209676_1000050 3300025292 Bacteria 398350
83 Ga0209676_1001129 3300025292 Bacteria 29347
84 Ga0209050_1000006 3300025298 Bacteria 1359702
85 Ga0209050_1000013 3300025298 Bacteria 811408
86 Ga0209050_1012851 3300025298 Bacteria 3790
87 Ga0209050_1049188 3300025298 Bacteria 1082
88 Ga0207426_1001598 3300025302 Bacteria 18056
89 Ga0209051_1000001 3300025303 Bacteria 1732974
90 Ga0209051_1000007 3300025303 Bacteria 811408
91 Ga0209051_1045636 3300025303 Bacteria 1515
92 Ga0209257_1000029 3300025304 Bacteria 695617
93 Ga0207696_1004652 3300025711 Bacteria 5872
94 Ga0207696_1005196 3300025711 Bacteria 5448
95 Ga0207696_1054604 3300025711 Bacteria 1135
96 Ga0207696_1074734 3300025711 Bacteria 939
97 Ga0207655_1000076 3300025728 Bacteria 226359
98 Ga0207655_1003284 3300025728 Bacteria 12138
99 Ga0207713_1000924 3300025735 Bacteria 26352
100 Ga0207713_1037509 3300025735 Bacteria 2066
101 Ga0207713_1115304 3300025735 Bacteria 908
102 Ga0207647_10011230 3300025904 Bacteria 6289
103 Ga0207706_10208913 3300025933 Bacteria 1711
104 Ga0207709_10000004 3300025935 Bacteria 825156
105 Ga0207668_10121110 3300025972 Bacteria 1981
106 Ga0209281_1000040 3300027111 Bacteria 353441
107 Ga0209281_1007557 3300027111 Bacteria 2718
108 Ga0209281_1009648 3300027111 Bacteria 2252
109 Ga0209179_1006043 3300027512 Bacteria 1929
110 Ga0209282_1042259 3300027666 Bacteria 2691
111 Ga0207428_10410059 3300027907 Unclassified 991
112 Ga0268266_10291097 3300028379 Bacteria 1521
113 Ga0268266_10453385 3300028379 Bacteria 1219
114 Ga0265338_10222643 3300028800 Bacteria 1408
115 Ga0265338_10422661 3300028800 Bacteria 947
116 Ga0316178_1159482 3300030735 Bacteria 22902
117 Ga0265760_10114109 3300031090 Bacteria 863
118 Ga0265331_10000326 3300031250 Bacteria 51446
119 Ga0265316_10348688 3300031344 Bacteria 1072
120 Ga0307408_100000066 3300031548 Bacteria 121679
121 Ga0307408_100000681 3300031548 Bacteria 28053
122 Ga0307408_100012945 3300031548 Bacteria 5531
123 Ga0307408_100022405 3300031548 Bacteria 4291
124 Ga0307408_100050507 3300031548 Bacteria 2991
125 Ga0307408_100054283 3300031548 Bacteria 2897
126 Ga0307408_100674159 3300031548 Bacteria 927
127 Ga0265313_10000931 3300031595 Bacteria 29168
128 Ga0265314_10145388 3300031711 Bacteria 1461
129 Ga0265342_10014556 3300031712 Bacteria 5218
130 Ga0307405_10010785 3300031731 Bacteria 4753
131 Ga0307413_10023169 3300031824 Bacteria 3361
132 Ga0307413_10037078 3300031824 Bacteria 2813
133 Ga0307410_10013324 3300031852 Bacteria 4792
134 Ga0307406_10010798 3300031901 Bacteria 5160
135 Ga0307406_10086777 3300031901 Bacteria 2096
136 Ga0307406_10116259 3300031901 Bacteria 1850
137 Ga0307407_10138595 3300031903 Bacteria 1566
138 Ga0307412_10004921 3300031911 Bacteria 7462
139 Ga0307412_10040334 3300031911 Bacteria 3020
140 Ga0307412_10185821 3300031911 Bacteria 1567
141 Ga0307409_100027067 3300031995 Bacteria 4057
142 Ga0307409_100053549 3300031995 Bacteria 3101
143 Ga0307409_102243543 3300031995 Bacteria 575
144 Ga0307416_100085671 3300032002 Bacteria 2682
145 Ga0307414_10009759 3300032004 Bacteria 5529
146 Ga0307414_10126239 3300032004 Bacteria 1977
147 Ga0307414_10147592 3300032004 Bacteria 1850
148 Ga0307414_10215003 3300032004 Bacteria 1574
149 Ga0307411_10015968 3300032005 Bacteria 4237
150 Ga0307411_10094686 3300032005 Bacteria 2094
151 Ga0307411_10111965 3300032005 Bacteria 1955
152 Ga0307415_100012895 3300032126 Bacteria 4854
153 Ga0307510_10001364 3300033180 Bacteria 26659
154 Ga0307510_10316709 3300033180 Bacteria 1018
155 Ga0307510_10353294 3300033180 Bacteria 920
156 Ga0373935_0378867 3300035692 Bacteria 1013
157 Ga0373927_0256370 3300035695 Bacteria 1150
158 Ga0373925_0325554 3300037068 Bacteria 1244
159 Ga0237819_00713 3300038705 Bacteria 10756
160 Ga0439438_018153 3300041405 Bacteria 2009
161 Ga0439438_024899 3300041405 Bacteria 1635
162 Ga0439438_051019 3300041405 Bacteria 1051
163 Ga0439447_010544 3300041407 Bacteria 2738
164 Ga0439447_012093 3300041407 Bacteria 2494
165 Ga0439447_021062 3300041407 Bacteria 1721
166 Ga0439466_0000094 3300041411 Bacteria 34700
167 Ga0439466_0029526 3300041411 Bacteria 1885
168 Ga0439448_0000686 3300042005 Bacteria 8089
169 Ga0439432_000285 3300042006 Bacteria 18199
170 Ga0439451_003612 3300042009 Bacteria 3131
171 Ga0439452_009039 3300042010 Bacteria 2961
172 Ga0439456_003797 3300042013 Bacteria 3074
173 Ga0439463_000930 3300042016 Bacteria 8031
174 Ga0439463_004221 3300042016 Bacteria 3606
175 Ga0439463_011640 3300042016 Bacteria 2160
176 Ga0439463_042191 3300042016 Bacteria 1160
177 Ga0450906_004214 3300042145 Bacteria 3031
178 Ga0450907_001791 3300042146 Bacteria 4431
179 Ga0439464_0090679 3300042439 Bacteria 921
180 Ga0439460_0076988 3300042461 Bacteria 1041
181 Ga0451577_0012678 3300042876 Bacteria 7910
182 Ga0439440_0004090 3300042993 Bacteria 2851
183 Ga0453684_0834116 3300044712 Bacteria 992
184 Ga0451576_0025469 3300045051 Bacteria 6372
185 Ga0451576_0558076 3300045051 Bacteria 1203
186 Ga0495617_003776 3300046452 Bacteria 5608
187 Ga0495617_007695 3300046452 Bacteria 3727
188 Ga0495617_008843 3300046452 Bacteria 3465
189 Ga0495617_016279 3300046452 Bacteria 2514
190 Ga0495627_001779 3300046453 Bacteria 11547
191 Ga0495627_010894 3300046453 Bacteria 3284
192 Ga0495590_0011664 3300046457 Bacteria 3282
193 Ga0495591_000197 3300046458 Bacteria 61590
194 Ga0495591_000627 3300046458 Bacteria 26292
195 Ga0495591_001144 3300046458 Bacteria 17423
196 Ga0495591_001987 3300046458 Bacteria 11921
197 Ga0495591_005321 3300046458 Bacteria 5992
198 Ga0495591_010690 3300046458 Bacteria 3534
199 Ga0495591_058073 3300046458 Bacteria 1035
200 Ga0495629_0123207 3300046459 Bacteria 1806
201 Ga0495638_0000417 3300046460 Bacteria 51723
202 Ga0495638_0093173 3300046460 Bacteria 1812
203 Ga0495653_0000080 3300046463 Bacteria 80818
204 Ga0495653_0000474 3300046463 Bacteria 31140
205 Ga0495650_0001084 3300046471 Bacteria 29875
206 Ga0495605_0001774 3300046474 Bacteria 13838
207 Ga0495605_0009292 3300046474 Bacteria 5526
208 Ga0495605_0019066 3300046474 Bacteria 3671
209 Ga0495605_0045579 3300046474 Bacteria 2160
210 Ga0495584_0001658 3300046491 Bacteria 13101
211 Ga0495584_0006160 3300046491 Bacteria 6307
212 Ga0495584_0021115 3300046491 Bacteria 3307
213 Ga0495584_0030749 3300046491 Bacteria 2719
214 Ga0495585_0001283 3300046492 Bacteria 20031
215 Ga0495585_0001358 3300046492 Bacteria 19372
216 Ga0495585_0007464 3300046492 Bacteria 6688
217 Ga0495585_0009017 3300046492 Bacteria 6012
218 Ga0495585_0027304 3300046492 Bacteria 3257
219 Ga0495585_0043171 3300046492 Bacteria 2523
220 Ga0495596_0008379 3300046500 Bacteria 4604
221 Ga0495596_0009741 3300046500 Bacteria 4215
222 Ga0495596_0015207 3300046500 Bacteria 3228
223 Ga0495596_0023761 3300046500 Bacteria 2486
224 Ga0495596_0030485 3300046500 Bacteria 2158
225 Ga0495596_0047159 3300046500 Bacteria 1690
226 Ga0495607_0001225 3300046501 Bacteria 23036
227 Ga0495607_0018524 3300046501 Bacteria 4437
228 Ga0495607_0024401 3300046501 Bacteria 3770
229 Ga0495607_0033567 3300046501 Bacteria 3122
230 Ga0495607_0102844 3300046501 Bacteria 1527
231 Ga0495583_0001570 3300046506 Bacteria 22562
232 Ga0495583_0019389 3300046506 Bacteria 3552
233 Ga0495583_0026880 3300046506 Bacteria 2846
234 Ga0495606_0000601 3300046507 Bacteria 57004
235 Ga0495606_0000682 3300046507 Bacteria 53150
236 Ga0495606_0003243 3300046507 Bacteria 17468
237 Ga0495606_0004269 3300046507 Bacteria 14424
238 Ga0495606_0010867 3300046507 Bacteria 7497
239 Ga0495606_0022511 3300046507 Bacteria 4588
240 Ga0495606_0197375 3300046507 Bacteria 1149
241 Ga0495610_0000887 3300046512 Bacteria 27802
242 Ga0495610_0007412 3300046512 Bacteria 7307
243 Ga0495610_0013671 3300046512 Bacteria 4811
244 Ga0495610_0069489 3300046512 Bacteria 1648
245 Ga0495610_0133759 3300046512 Bacteria 1074
246 Ga0495616_0000203 3300046513 Bacteria 49328
247 Ga0495616_0009357 3300046513 Bacteria 5741
248 Ga0495616_0013312 3300046513 Bacteria 4645
249 Ga0495616_0098086 3300046513 Bacteria 1377
250 Ga0495616_0178464 3300046513 Bacteria 945
251 Ga0495620_0001002 3300046515 Bacteria 17486
252 Ga0495620_0029838 3300046515 Bacteria 2518
253 Ga0495620_0046585 3300046515 Bacteria 1871
254 Ga0495620_0059387 3300046515 Bacteria 1598
255 Ga0495631_0000239 3300046518 Bacteria 37813
256 Ga0495631_0047336 3300046518 Bacteria 1888
257 Ga0495632_0001271 3300046519 Bacteria 21375
258 Ga0495632_0007281 3300046519 Bacteria 6977
259 Ga0495632_0014685 3300046519 Bacteria 4421
260 Ga0495632_0028618 3300046519 Bacteria 2907
261 Ga0495632_0110580 3300046519 Bacteria 1290
262 Ga0495637_0000275 3300046520 Bacteria 40472
263 Ga0495637_0000290 3300046520 Bacteria 39227
264 Ga0495637_0002982 3300046520 Bacteria 9100
265 Ga0495637_0121679 3300046520 Bacteria 1003
266 Ga0495643_0001038 3300046522 Bacteria 28173
267 Ga0495643_0007668 3300046522 Bacteria 6921
268 Ga0495643_0008592 3300046522 Bacteria 6450
269 Ga0495643_0033423 3300046522 Bacteria 2846
270 Ga0495643_0048339 3300046522 Bacteria 2300
271 Ga0495643_0131431 3300046522 Bacteria 1256
272 Ga0495644_0000968 3300046523 Bacteria 11888
273 Ga0495644_0003507 3300046523 Bacteria 6203
274 Ga0495644_0055125 3300046523 Bacteria 1493
275 Ga0495648_0002449 3300046524 Bacteria 17121
276 Ga0495648_0005945 3300046524 Bacteria 10044
277 Ga0495648_0007847 3300046524 Bacteria 8490
278 Ga0495648_0013876 3300046524 Bacteria 5931
279 Ga0495648_0021654 3300046524 Bacteria 4448
280 Ga0495648_0024725 3300046524 Bacteria 4080
281 Ga0495648_0061838 3300046524 Bacteria 2221
282 Ga0495642_0007541 3300046528 Bacteria 4169
283 Ga0495654_0000828 3300046530 Bacteria 23502
284 Ga0495654_0015179 3300046530 Bacteria 4093
285 Ga0495654_0020075 3300046530 Bacteria 3487
286 Ga0495654_0034650 3300046530 Bacteria 2546
287 Ga0495654_0058886 3300046530 Bacteria 1851
288 Ga0495654_0059694 3300046530 Bacteria 1835
289 Ga0495654_0077802 3300046530 Bacteria 1560
290 Ga0495609_0000067 3300046538 Bacteria 130284
291 Ga0495609_0001066 3300046538 Bacteria 19211
292 Ga0495609_0006119 3300046538 Bacteria 6190
293 Ga0495609_0086422 3300046538 Bacteria 1367
294 Ga0495597_0000269 3300046542 Bacteria 47594
295 Ga0495622_0013466 3300046557 Bacteria 3793
296 Ga0495633_0000367 3300046558 Bacteria 48597
297 Ga0495633_0037900 3300046558 Bacteria 2305
298 Ga0495633_0109713 3300046558 Bacteria 1279
299 Ga0495668_0001331 3300046616 Bacteria 24318
300 Ga0495668_0003261 3300046616 Bacteria 12332
301 Ga0495668_0012496 3300046616 Bacteria 5034
302 Ga0495611_0000067 3300046648 Bacteria 72577
303 Ga0495611_0014559 3300046648 Bacteria 3362
304 Ga0495625_0000101 3300046660 Bacteria 139139
305 Ga0495625_0011680 3300046660 Bacteria 7143
306 Ga0495625_0042794 3300046660 Bacteria 3288
307 Ga0495625_0177276 3300046660 Bacteria 1419
308 Ga0495625_0212970 3300046660 Bacteria 1269
309 Ga0495659_0215563 3300046664 Bacteria 791
310 Ga0495661_0000024 3300046665 Bacteria 188844
311 Ga0495661_0011956 3300046665 Bacteria 5874
312 Ga0495661_0013393 3300046665 Bacteria 5508
313 Ga0495661_0013450 3300046665 Bacteria 5493
314 Ga0495661_0026204 3300046665 Bacteria 3756
315 Ga0495661_0160231 3300046665 Bacteria 1208
316 Ga0495624_0053319 3300046690 Bacteria 2554
317 Ga0495670_0000061 3300046691 Bacteria 48947
318 Ga0495671_0007333 3300046692 Bacteria 6295
319 Ga0495671_0009093 3300046692 Bacteria 5566
320 Ga0495671_0031837 3300046692 Bacteria 2694
321 Ga0495671_0082986 3300046692 Bacteria 1570
322 Ga0495671_0194297 3300046692 Bacteria 985
323 Ga0495671_0213658 3300046692 Bacteria 934
324 Ga0495649_0005871 3300046694 Bacteria 7717
325 Ga0495649_0008004 3300046694 Bacteria 6388
326 Ga0495649_0008588 3300046694 Bacteria 6133
327 Ga0495649_0043955 3300046694 Bacteria 2438
328 Ga0495649_0056405 3300046694 Bacteria 2121
329 Ga0495649_0102838 3300046694 Bacteria 1517
330 Ga0495649_0238626 3300046694 Bacteria 936
331 Ga0495589_0027617 3300046794 Bacteria 2869
332 Ga0495589_0027996 3300046794 Bacteria 2847
333 Ga0495589_0040098 3300046794 Bacteria 2339
334 Ga0495589_0063416 3300046794 Bacteria 1813
335 Ga0495660_0000351 3300046810 Bacteria 40836
336 Ga0495660_0000648 3300046810 Bacteria 27008
337 Ga0495660_0003711 3300046810 Bacteria 9375
338 Ga0495660_0010093 3300046810 Bacteria 5491
339 Ga0495660_0051527 3300046810 Bacteria 2239
340 Ga0495660_0077737 3300046810 Bacteria 1745
341 Ga0495660_0089318 3300046810 Bacteria 1604
342 Ga0495660_0229014 3300046810 Bacteria 872
343 Ga0495672_0000037 3300047320 Bacteria 278588
344 Ga0495672_0019168 3300047320 Bacteria 4521
345 Ga0495672_0072757 3300047320 Bacteria 1940
346 Ga0495672_0089451 3300047320 Bacteria 1694
347 Ga0495672_0264119 3300047320 Bacteria 829
348 Ga0495676_0000241 3300047321 Bacteria 44030
349 Ga0495676_0000550 3300047321 Bacteria 30835
350 Ga0495683_0007815 3300047323 Bacteria 5737
351 Ga0495683_0007933 3300047323 Bacteria 5697
352 Ga0495683_0013585 3300047323 Bacteria 4255
353 Ga0495683_0022965 3300047323 Bacteria 3207
354 Ga0495679_000140 3300047446 Bacteria 64998
355 Ga0495679_001020 3300047446 Bacteria 17183
356 Ga0495679_001296 3300047446 Bacteria 14570
357 Ga0495679_009035 3300047446 Bacteria 4014
358 Ga0495679_033169 3300047446 Bacteria 1651
359 Ga0495673_0000003 3300047469 Bacteria 1491337
360 Ga0495673_0001135 3300047469 Bacteria 22852
361 Ga0495673_0007273 3300047469 Bacteria 6391
362 Ga0495673_0038513 3300047469 Bacteria 2174
363 Ga0495673_0045814 3300047469 Bacteria 1941
364 Ga0495673_0049405 3300047469 Bacteria 1851
365 Ga0495681_0002583 3300047470 Bacteria 12859
366 Ga0495681_0006585 3300047470 Bacteria 7607
367 Ga0495681_0072667 3300047470 Bacteria 1555
368 Ga0495681_0090460 3300047470 Bacteria 1352
369 Ga0495681_0113916 3300047470 Bacteria 1167
370 Ga0495681_0115892 3300047470 Bacteria 1155
371 Ga0495681_0267313 3300047470 Bacteria 670
372 Ga0495686_0000475 3300047472 Bacteria 59699
373 Ga0495686_0025510 3300047472 Bacteria 3873
374 Ga0495686_0239962 3300047472 Bacteria 1022
375 Ga0495626_0000719 3300048091 Bacteria 30949
376 Ga0495626_0002151 3300048091 Bacteria 14225
377 Ga0495626_0007919 3300048091 Bacteria 5881
378 Ga0495626_0009041 3300048091 Bacteria 5403
379 Ga0495626_0013356 3300048091 Bacteria 4267
380 Ga0495626_0058867 3300048091 Bacteria 1754
381 Ga0495626_0061104 3300048091 Bacteria 1715
382 Ga0496100_0380266 3300048903 Bacteria 1072
383 Ga0496102_0278174 3300048905 Bacteria 1578
384 Ga0496104_0153419 3300048907 Bacteria 2211
385 Ga0496105_0009244 3300048908 Bacteria 7699
386 Ga0496105_0027953 3300048908 Bacteria 4612
387 Ga0496116_0001414 3300048919 Bacteria 26960
388 Ga0496116_0005793 3300048919 Bacteria 11353
389 Ga0496116_0123935 3300048919 Bacteria 1489
390 Ga0496116_0241389 3300048919 Bacteria 907
391 Ga0496117_0000153 3300048920 Bacteria 147065
392 Ga0496117_0101870 3300048920 Bacteria 1813
393 Ga0496118_0000269 3300048921 Bacteria 91110
394 Ga0496118_0018587 3300048921 Bacteria 6260
395 Ga0496118_0150989 3300048921 Bacteria 1454
396 Ga0496118_0158982 3300048921 Bacteria 1401
397 Ga0496119_0000005 3300048922 Bacteria 529799
398 Ga0496119_0000187 3300048922 Bacteria 87651
399 Ga0496119_0122962 3300048922 Bacteria 1424
400 Ga0496120_0000005 3300048923 Bacteria 529797
401 Ga0496120_0000010 3300048923 Bacteria 385791
402 Ga0496121_0000055 3300048924 Bacteria 304572
403 Ga0496121_0014647 3300048924 Bacteria 8292
404 Ga0496121_0026161 3300048924 Bacteria 5510
405 Ga0496121_0071083 3300048924 Bacteria 2800
406 Ga0496121_0263807 3300048924 Bacteria 1187
407 Ga0496122_0038335 3300048925 Bacteria 3842
408 Ga0496122_0175237 3300048925 Bacteria 1286
409 Ga0496122_0206625 3300048925 Bacteria 1142
410 Ga0496122_0345996 3300048925 Bacteria 778
411 Ga0496123_0006232 3300048926 Bacteria 11632
412 Ga0496124_0000807 3300048927 Bacteria 50885
413 Ga0496124_0001709 3300048927 Bacteria 30968
414 Ga0496124_0030653 3300048927 Bacteria 4770
415 Ga0496124_0041761 3300048927 Bacteria 3955
416 Ga0496124_0092198 3300048927 Bacteria 2468
417 Ga0496125_0010295 3300048928 Bacteria 9470
418 Ga0496125_0030388 3300048928 Bacteria 4834
419 Ga0496125_0098645 3300048928 Bacteria 2161
420 Ga0496126_0022861 3300048929 Bacteria 6071
421 Ga0496126_0058923 3300048929 Bacteria 3460
422 Ga0495678_011856 3300049459 Bacteria 4156
423 Ga0495678_013272 3300049459 Bacteria 3875
424 Ga0495678_013344 3300049459 Bacteria 3861
425 Ga0495678_016114 3300049459 Bacteria 3426
426 Ga0495678_036132 3300049459 Bacteria 2018
427 Ga0495678_047749 3300049459 Bacteria 1674
428 Ga0495682_0000268 3300049460 Bacteria 41058
429 Ga0495682_0015799 3300049460 Bacteria 2859
430 Ga0501041_0456132 3300049577 Bacteria 812
431 Ga0501042_0550147 3300049578 Bacteria 839
432 Ga0501072_0229331 3300049588 Bacteria 1480
433 Ga0501076_0915709 3300049592 Bacteria 723
434 Ga0501241_000302 3300049758 Bacteria 10855
435 nmdc:mga08y16_92032_c1 3300050511 Unclassified 3160
436 nmdc:mga08x19_140069_c1 3300050514 Bacteria 1633
437 Ga0500643_001127 3300053087 Bacteria 15948
438 Ga0500572_001451 3300053111 Bacteria 6483
439 Ga0500621_041528 3300053126 Bacteria 1855
440 Ga0500586_010025 3300053145 Bacteria 2656
441 Ga0587090_030773 3300059510 Unclassified 896
442 2511368625 2511231023 Bacteria 6808468
443 2511414174 2511231031 Bacteria 6558529
444 2599768887 2599185248 Bacteria 6696816
445 2600023049 2599185316 Bacteria 6320029
446 2600076797 2599185325 Bacteria 6324919
447 2600811746 2600255067 Bacteria 6795583
448 2738819773 2738541296 Bacteria 7285013
449 2738830121 2738541297 Bacteria 6549566
450 2738832253 2738541298 Bacteria 7286732
451 2738873780 2738541306 Bacteria 7284992
452 2739153917 2738541357 Bacteria 6549408
453 2739185410 2738543002 Bacteria 7284546
454 2739195837 2738543003 Bacteria 6549560
455 2739220379 2738543008 Bacteria 7282815
456 2739312050 2738543025 Bacteria 6600348
457 2739322313 2738543026 Bacteria 6549408
458 2739340554 2738543029 Bacteria 6549249
459 2808968749 2808606384 Bacteria 8474373
460 2809003580 2808606390 Bacteria 8476311
461 2809010857 2808606391 Bacteria 8308166
462 2842834945 2842832357 Bacteria 5959113
463 2842857876 2842854478 Bacteria 6143501
464 2844529686 2844528606 Bacteria 4733806
465 2860872012 2860867994 Bacteria 5645326
466 2865014647 2865014394 Bacteria 4764573
467 2912965900 2912963787 Bacteria 5646108
468 2929147810 2929144301 Bacteria 6622272
469 2945935874 2945934425 Bacteria 7444609
470 2945955878 2945951305 Bacteria 4918162
471 2946032593 2946027586 Bacteria 6049274
472 2969307262 2969304461 Bacteria 6601805
473 2974290664 2974289157 Bacteria 6080362
474 2990710220 2990703756 Bacteria 7715990
475 2998143146 2998139840 Bacteria 6073514
476 3007857137 3007855910 Bacteria 5637581
477 642422752 641736151 Bacteria 7477263
478 8056146427 8056143049 Bacteria 6307666
479 8056168035 8056166840 Bacteria 5820959
480 Ga0055536_1000262
481 JGI24739J22299_10008082
482 JGI24737J22298_10018767
483 JGI24735J21928_10001219
484 JGI24738J21930_10000392
485 rootH1_10175983
486 rootH1_10280171
487 Ga0055536_1042198
488 Ga0055530_10000122
489 Ga0055530_10002989
490 Ga0055540_1000008
491 Ga0055540_1000155
492 Ga0055531_10000182
493 Ga0070658_10296948
494 Ga0070670_100045243
495 Ga0070660_100285754
496 Ga0070668_100072022
497 Ga0070667_100856454
498 Ga0070709_10279555
499 Ga0070713_100185948
500 Ga0070708_100030079
501 Ga0070662_100074577
502 Ga0070706_100087032
503 Ga0070665_100005513
504 Ga0070665_100080588
505 Ga0070665_101421019
506 Ga0068862_100678787
507 Ga0075432_10093334
508 Ga0070716_100089396
509 Ga0075436_100124620
510 Ga0079104_1000054
511 Ga0079104_1019721
512 Ga0079104_1025452
513 Ga0099826_10027056
514 Ga0105251_10021557
515 Ga0105251_10032333
516 Ga0105244_10001727
517 Ga0105244_10004944
518 Ga0105244_10064960
519 Ga0105250_10003534
520 Ga0105250_10007262
521 Ga0105250_10015755
522 Ga0105250_10160381
523 Ga0111539_10027086
524 Ga0105243_10000060
525 Ga0099796_10002760
526 Ga0105246_10013600
527 Ga0105246_10179115
528 Ga0105246_10427469
529 Ga0157345_1000122
530 Ga0157373_10007864
531 Ga0157373_10101635
532 Ga0157371_10003129
533 Ga0157370_10007840
534 Ga0157369_10001093
535 Ga0157369_10019300
536 Ga0157369_10382021
537 Ga0163162_10000137
538 Ga0163162_10043563
539 Ga0157372_11078682
540 Ga0157375_10021236
541 Ga0182008_10158561
542 Ga0182008_10236641
543 Ga0157379_10056373
544 Ga0182006_1000029
545 Ga0182006_1000396
546 Ga0182006_1004569
547 Ga0182006_1005798
548 Ga0182006_1050724
549 Ga0182006_1067318
550 Ga0182007_10002142
551 Ga0182007_10015072
552 Ga0182007_10048829
553 Ga0182005_1000037
554 Ga0182005_1043407
555 Ga0163161_10000054
556 Ga0163161_10269418
557 Ga0163161_10280735
558 Ga0163161_10481333
559 Ga0209233_1000702
560 Ga0209676_1000002
561 Ga0209676_1000050
562 Ga0209676_1001129
563 Ga0209050_1000006
564 Ga0209050_1000013
565 Ga0209050_1012851
566 Ga0209050_1049188
567 Ga0207426_1001598
568 Ga0209051_1000001
569 Ga0209051_1000007
570 Ga0209051_1045636
571 Ga0209257_1000029
572 Ga0207696_1004652
573 Ga0207696_1005196
574 Ga0207696_1054604
575 Ga0207696_1074734
576 Ga0207655_1000076
577 Ga0207655_1003284
578 Ga0207713_1000924
579 Ga0207713_1037509
580 Ga0207713_1115304
581 Ga0207647_10011230
582 Ga0207706_10208913
583 Ga0207709_10000004
584 Ga0207668_10121110
585 Ga0209281_1000040
586 Ga0209281_1007557
587 Ga0209281_1009648
588 Ga0209179_1006043
589 Ga0209282_1042259
590 Ga0207428_10410059
591 Ga0268266_10291097
592 Ga0268266_10453385
593 Ga0265338_10222643
594 Ga0265338_10422661
595 Ga0316178_1159482
596 Ga0265760_10114109
597 Ga0265331_10000326
598 Ga0265316_10348688
599 Ga0307408_100000066
600 Ga0307408_100000681
601 Ga0307408_100012945
602 Ga0307408_100022405
603 Ga0307408_100050507
604 Ga0307408_100054283
605 Ga0307408_100674159
606 Ga0265313_10000931
607 Ga0265314_10145388
608 Ga0265342_10014556
609 Ga0307405_10010785
610 Ga0307413_10023169
611 Ga0307413_10037078
612 Ga0307410_10013324
613 Ga0307406_10010798
614 Ga0307406_10086777
615 Ga0307406_10116259
616 Ga0307407_10138595
617 Ga0307412_10004921
618 Ga0307412_10040334
619 Ga0307412_10185821
620 Ga0307409_100027067
621 Ga0307409_100053549
622 Ga0307409_102243543
623 Ga0307416_100085671
624 Ga0307414_10009759
625 Ga0307414_10126239
626 Ga0307414_10147592
627 Ga0307414_10215003
628 Ga0307411_10015968
629 Ga0307411_10094686
630 Ga0307411_10111965
631 Ga0307415_100012895
632 Ga0307510_10001364
633 Ga0307510_10316709
634 Ga0307510_10353294
635 Ga0373935_0378867
636 Ga0373927_0256370
637 Ga0373925_0325554
638 Ga0237819_00713
639 Ga0439438_018153
640 Ga0439438_024899
641 Ga0439438_051019
642 Ga0439447_010544
643 Ga0439447_012093
644 Ga0439447_021062
645 Ga0439466_0000094
646 Ga0439466_0029526
647 Ga0439448_0000686
648 Ga0439432_000285
649 Ga0439451_003612
650 Ga0439452_009039
651 Ga0439456_003797
652 Ga0439463_000930
653 Ga0439463_004221
654 Ga0439463_011640
655 Ga0439463_042191
656 Ga0450906_004214
657 Ga0450907_001791
658 Ga0439464_0090679
659 Ga0439460_0076988
660 Ga0451577_0012678
661 Ga0439440_0004090
662 Ga0453684_0834116
663 Ga0451576_0025469
664 Ga0451576_0558076
665 Ga0495617_003776
666 Ga0495617_007695
667 Ga0495617_008843
668 Ga0495617_016279
669 Ga0495627_001779
670 Ga0495627_010894
671 Ga0495590_0011664
672 Ga0495591_000197
673 Ga0495591_000627
674 Ga0495591_001144
675 Ga0495591_001987
676 Ga0495591_005321
677 Ga0495591_010690
678 Ga0495591_058073
679 Ga0495629_0123207
680 Ga0495638_0000417
681 Ga0495638_0093173
682 Ga0495653_0000080
683 Ga0495653_0000474
684 Ga0495650_0001084
685 Ga0495605_0001774
686 Ga0495605_0009292
687 Ga0495605_0019066
688 Ga0495605_0045579
689 Ga0495584_0001658
690 Ga0495584_0006160
691 Ga0495584_0021115
692 Ga0495584_0030749
693 Ga0495585_0001283
694 Ga0495585_0001358
695 Ga0495585_0007464
696 Ga0495585_0009017
697 Ga0495585_0027304
698 Ga0495585_0043171
699 Ga0495596_0008379
700 Ga0495596_0009741
701 Ga0495596_0015207
702 Ga0495596_0023761
703 Ga0495596_0030485
704 Ga0495596_0047159
705 Ga0495607_0001225
706 Ga0495607_0018524
707 Ga0495607_0024401
708 Ga0495607_0033567
709 Ga0495607_0102844
710 Ga0495583_0001570
711 Ga0495583_0019389
712 Ga0495583_0026880
713 Ga0495606_0000601
714 Ga0495606_0000682
715 Ga0495606_0003243
716 Ga0495606_0004269
717 Ga0495606_0010867
718 Ga0495606_0022511
719 Ga0495606_0197375
720 Ga0495610_0000887
721 Ga0495610_0007412
722 Ga0495610_0013671
723 Ga0495610_0069489
724 Ga0495610_0133759
725 Ga0495616_0000203
726 Ga0495616_0009357
727 Ga0495616_0013312
728 Ga0495616_0098086
729 Ga0495616_0178464
730 Ga0495620_0001002
731 Ga0495620_0029838
732 Ga0495620_0046585
733 Ga0495620_0059387
734 Ga0495631_0000239
735 Ga0495631_0047336
736 Ga0495632_0001271
737 Ga0495632_0007281
738 Ga0495632_0014685
739 Ga0495632_0028618
740 Ga0495632_0110580
741 Ga0495637_0000275
742 Ga0495637_0000290
743 Ga0495637_0002982
744 Ga0495637_0121679
745 Ga0495643_0001038
746 Ga0495643_0007668
747 Ga0495643_0008592
748 Ga0495643_0033423
749 Ga0495643_0048339
750 Ga0495643_0131431
751 Ga0495644_0000968
752 Ga0495644_0003507
753 Ga0495644_0055125
754 Ga0495648_0002449
755 Ga0495648_0005945
756 Ga0495648_0007847
757 Ga0495648_0013876
758 Ga0495648_0021654
759 Ga0495648_0024725
760 Ga0495648_0061838
761 Ga0495642_0007541
762 Ga0495654_0000828
763 Ga0495654_0015179
764 Ga0495654_0020075
765 Ga0495654_0034650
766 Ga0495654_0058886
767 Ga0495654_0059694
768 Ga0495654_0077802
769 Ga0495609_0000067
770 Ga0495609_0001066
771 Ga0495609_0006119
772 Ga0495609_0086422
773 Ga0495597_0000269
774 Ga0495622_0013466
775 Ga0495633_0000367
776 Ga0495633_0037900
777 Ga0495633_0109713
778 Ga0495668_0001331
779 Ga0495668_0003261
780 Ga0495668_0012496
781 Ga0495611_0000067
782 Ga0495611_0014559
783 Ga0495625_0000101
784 Ga0495625_0011680
785 Ga0495625_0042794
786 Ga0495625_0177276
787 Ga0495625_0212970
788 Ga0495659_0215563
789 Ga0495661_0000024
790 Ga0495661_0011956
791 Ga0495661_0013393
792 Ga0495661_0013450
793 Ga0495661_0026204
794 Ga0495661_0160231
795 Ga0495624_0053319
796 Ga0495670_0000061
797 Ga0495671_0007333
798 Ga0495671_0009093
799 Ga0495671_0031837
800 Ga0495671_0082986
801 Ga0495671_0194297
802 Ga0495671_0213658
803 Ga0495649_0005871
804 Ga0495649_0008004
805 Ga0495649_0008588
806 Ga0495649_0043955
807 Ga0495649_0056405
808 Ga0495649_0102838
809 Ga0495649_0238626
810 Ga0495589_0027617
811 Ga0495589_0027996
812 Ga0495589_0040098
813 Ga0495589_0063416
814 Ga0495660_0000351
815 Ga0495660_0000648
816 Ga0495660_0003711
817 Ga0495660_0010093
818 Ga0495660_0051527
819 Ga0495660_0077737
820 Ga0495660_0089318
821 Ga0495660_0229014
822 Ga0495672_0000037
823 Ga0495672_0019168
824 Ga0495672_0072757
825 Ga0495672_0089451
826 Ga0495672_0264119
827 Ga0495676_0000241
828 Ga0495676_0000550
829 Ga0495683_0007815
830 Ga0495683_0007933
831 Ga0495683_0013585
832 Ga0495683_0022965
833 Ga0495679_000140
834 Ga0495679_001020
835 Ga0495679_001296
836 Ga0495679_009035
837 Ga0495679_033169
838 Ga0495673_0000003
839 Ga0495673_0001135
840 Ga0495673_0007273
841 Ga0495673_0038513
842 Ga0495673_0045814
843 Ga0495673_0049405
844 Ga0495681_0002583
845 Ga0495681_0006585
846 Ga0495681_0072667
847 Ga0495681_0090460
848 Ga0495681_0113916
849 Ga0495681_0115892
850 Ga0495681_0267313
851 Ga0495686_0000475
852 Ga0495686_0025510
853 Ga0495686_0239962
854 Ga0495626_0000719
855 Ga0495626_0002151
856 Ga0495626_0007919
857 Ga0495626_0009041
858 Ga0495626_0013356
859 Ga0495626_0058867
860 Ga0495626_0061104
861 Ga0496100_0380266
862 Ga0496102_0278174
863 Ga0496104_0153419
864 Ga0496105_0009244
865 Ga0496105_0027953
866 Ga0496116_0001414
867 Ga0496116_0005793
868 Ga0496116_0123935
869 Ga0496116_0241389
870 Ga0496117_0000153
871 Ga0496117_0101870
872 Ga0496118_0000269
873 Ga0496118_0018587
874 Ga0496118_0150989
875 Ga0496118_0158982
876 Ga0496119_0000005
877 Ga0496119_0000187
878 Ga0496119_0122962
879 Ga0496120_0000005
880 Ga0496120_0000010
881 Ga0496121_0000055
882 Ga0496121_0014647
883 Ga0496121_0026161
884 Ga0496121_0071083
885 Ga0496121_0263807
886 Ga0496122_0038335
887 Ga0496122_0175237
888 Ga0496122_0206625
889 Ga0496122_0345996
890 Ga0496123_0006232
891 Ga0496124_0000807
892 Ga0496124_0001709
893 Ga0496124_0030653
894 Ga0496124_0041761
895 Ga0496124_0092198
896 Ga0496125_0010295
897 Ga0496125_0030388
898 Ga0496125_0098645
899 Ga0496126_0022861
900 Ga0496126_0058923
901 Ga0495678_011856
902 Ga0495678_013272
903 Ga0495678_013344
904 Ga0495678_016114
905 Ga0495678_036132
906 Ga0495678_047749
907 Ga0495682_0000268
908 Ga0495682_0015799
909 Ga0501041_0456132
910 Ga0501042_0550147
911 Ga0501072_0229331
912 Ga0501076_0915709
913 Ga0501241_000302
914 nmdc:mga08y16_92032_c1
915 nmdc:mga08x19_140069_c1
916 Ga0500643_001127
917 Ga0500572_001451
918 Ga0500621_041528
919 Ga0500586_010025
920 Ga0587090_030773
921 2511368625
922 2511414174
923 2599768887
924 2600023049
925 2600076797
926 2600811746
927 2738819773
928 2738830121
929 2738832253
930 2738873780
931 2739153917
932 2739185410
933 2739195837
934 2739220379
935 2739312050
936 2739322313
937 2739340554
938 2808968749
939 2809003580
940 2809010857
941 2842834945
942 2842857876
943 2844529686
944 2860872012
945 2865014647
946 2912965900
947 2929147810
948 2945935874
949 2945955878
950 2946032593
951 2969307262
952 2974290664
953 2990710220
954 2998143146
955 3007857137
956 642422752
957 8056146427
958 8056168035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

30

106

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

38

107

0.92

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

124

219

0.9

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

122

214

0.88

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

42

112

0.88

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

137

228

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.9809 1 198
1pmt-assembly1.cif.gz_A glutathione transferase from proteus mirabilis 0.9807 1 197
3uap-assembly1.cif.gz_A crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath 0.9763 2 198
6m1t-assembly1.cif.gz_B bacterial beta class sphingomonas chungbukensis glutathione s-transferase 0.9758 1 197
1f2e-assembly1.cif.gz_A structure of sphingomonad, glutathione s-transferase complexed with glutathione 0.9731 1 200
ID Description Score Start End Superfamily
2dsaC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9885 1 82 3.40.30.10
1n2aB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9738 1 82 3.40.30.10
af_P0A9D2_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9736 1 79 3.40.30.10
2dsaD02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.968 83 187 1.20.1050.10
af_P0A9D2_2_199_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9669 3 197 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2J4XVA0-F1-model_v4 Glutathione transferase GstA 0.9978 1 108 GO:0016740
AF-A0A1I3YP29-F1-model_v4 deleted 0.9938 2 199
AF-A0A1I1I7F4-F1-model_v4 Glutathione S-transferase 0.9893 1 199 GO:0016740
AF-A0A2J4ULR6-F1-model_v4 deleted 0.9884 1 136
AF-A0A011N0X2-F1-model_v4 Glutathione S-transferase GstA (EC 2.5.1.18) 0.9881 2 197 GO:0004364

Map