F451996

General Info

Members Datasets Scaffolds Average Seq Length
479 259 958 139

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100073781|Ga0070661_1000737812
Length 156
Sequence MAARARPDTAYNSVMAGLDPRAAIPTEIKLHQSSRLLELTFADGSSYRLPYEFLRVYSPSADVRGHGPGQETLQVGKREVTINEIEAVGHYAIRPKFSDGHDTGIYSWDYLHELGERQESMWQQYLERMRAAGASREPDANPAPPAAAAHSCGHKH

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
254 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
255 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
257 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
258 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
259 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 4.38
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100073781 3300005344 Bacteria 2512
2 Ga0070683_100024289 3300005329 Bacteria 5427
3 Ga0070690_100065714 3300005330 Bacteria 2345
4 Ga0070690_100088451 3300005330 Bacteria 2036
5 Ga0070670_100110824 3300005331 Bacteria 2365
6 Ga0070677_10166945 3300005333 Bacteria 1037
7 Ga0068869_100002911 3300005334 Bacteria 10393
8 Ga0070666_10166144 3300005335 Bacteria 1544
9 Ga0070666_10249061 3300005335 Bacteria 1257
10 Ga0070682_100047121 3300005337 Bacteria 2678
11 Ga0068868_100031446 3300005338 Bacteria 4077
12 Ga0068868_100038081 3300005338 Bacteria 3732
13 Ga0068868_100079971 3300005338 Bacteria 2619
14 Ga0070689_100010115 3300005340 Bacteria 6715
15 Ga0070689_100216586 3300005340 Bacteria 1569
16 Ga0070691_10391106 3300005341 Bacteria 781
17 Ga0070687_100127309 3300005343 Bacteria 1466
18 Ga0070687_100747628 3300005343 Bacteria 688
19 Ga0070668_100021699 3300005347 Bacteria 4851
20 Ga0070668_101191235 3300005347 Bacteria 690
21 Ga0070669_100438484 3300005353 Bacteria 1075
22 Ga0070675_100067948 3300005354 Bacteria 2950
23 Ga0070671_100013893 3300005355 Bacteria 6495
24 Ga0070671_100364711 3300005355 Bacteria 1233
25 Ga0070674_100022082 3300005356 Bacteria 4099
26 Ga0070674_100468993 3300005356 Bacteria 1043
27 Ga0070673_100049314 3300005364 Bacteria 3287
28 Ga0070688_100000866 3300005365 Bacteria 15034
29 Ga0070667_100090389 3300005367 Bacteria 2631
30 Ga0070667_100280243 3300005367 Bacteria 1497
31 Ga0070709_10034791 3300005434 Bacteria 3057
32 Ga0070709_10092021 3300005434 Bacteria 2002
33 Ga0070714_100285184 3300005435 Bacteria 1535
34 Ga0070714_100821975 3300005435 Bacteria 900
35 Ga0070713_100000031 3300005436 Bacteria 88727
36 Ga0070713_100053170 3300005436 Bacteria 3355
37 Ga0070713_100162694 3300005436 Bacteria 1993
38 Ga0070713_100759181 3300005436 Bacteria 928
39 Ga0070701_10038512 3300005438 Bacteria 2420
40 Ga0070711_100015970 3300005439 Bacteria 4759
41 Ga0070711_101327379 3300005439 Bacteria 625
42 Ga0070705_100015715 3300005440 Bacteria 3918
43 Ga0070694_100379764 3300005444 Bacteria 1102
44 Ga0070708_100044684 3300005445 Bacteria 3897
45 Ga0070708_101031929 3300005445 Bacteria 771
46 Ga0070663_100084197 3300005455 Bacteria 2343
47 Ga0070663_101139387 3300005455 Bacteria 683
48 Ga0070678_100034986 3300005456 Bacteria 3502
49 Ga0070678_101345478 3300005456 Bacteria 665
50 Ga0070662_100039703 3300005457 Bacteria 3348
51 Ga0070662_100134285 3300005457 Bacteria 1912
52 Ga0070681_10177737 3300005458 Bacteria 2050
53 Ga0070681_10278526 3300005458 Bacteria 1583
54 Ga0068867_100046296 3300005459 Bacteria 3194
55 Ga0068867_100163787 3300005459 Bacteria 1755
56 Ga0068867_100723415 3300005459 Bacteria 880
57 Ga0070685_10001494 3300005466 Bacteria 12315
58 Ga0070707_100383356 3300005468 Bacteria 1365
59 Ga0070707_100502076 3300005468 Bacteria 1175
60 Ga0070698_100041031 3300005471 Bacteria 4754
61 Ga0070698_100262676 3300005471 Bacteria 1659
62 Ga0070698_100365522 3300005471 Bacteria 1375
63 Ga0070699_100208404 3300005518 Bacteria 1739
64 Ga0070679_100136429 3300005530 Bacteria 2434
65 Ga0070679_101155853 3300005530 Bacteria 719
66 Ga0070684_100216084 3300005535 Bacteria 1748
67 Ga0070684_101248076 3300005535 Bacteria 699
68 Ga0070697_100016106 3300005536 Bacteria 5878
69 Ga0068853_100084675 3300005539 Bacteria 2778
70 Ga0068853_100230337 3300005539 Bacteria 1695
71 Ga0070672_100202665 3300005543 Bacteria 1660
72 Ga0070686_100094859 3300005544 Bacteria 2003
73 Ga0070686_100096136 3300005544 Bacteria 1992
74 Ga0070695_100555638 3300005545 Bacteria 895
75 Ga0070696_100025279 3300005546 Bacteria 4036
76 Ga0070693_100022716 3300005547 Bacteria 3340
77 Ga0070693_100093737 3300005547 Bacteria 1815
78 Ga0070665_100046717 3300005548 Bacteria 4347
79 Ga0070665_101220876 3300005548 Bacteria 762
80 Ga0070665_101748850 3300005548 Bacteria 629
81 Ga0070704_100034063 3300005549 Bacteria 3450
82 Ga0070664_100587041 3300005564 Bacteria 1033
83 Ga0070664_101010047 3300005564 Bacteria 782
84 Ga0068857_101436053 3300005577 Bacteria 671
85 Ga0068854_100025805 3300005578 Bacteria 4033
86 Ga0068856_100333788 3300005614 Bacteria 1534
87 Ga0068856_100416090 3300005614 Bacteria 1364
88 Ga0068856_100529606 3300005614 Bacteria 1199
89 Ga0068856_102403711 3300005614 Unclassified 534
90 Ga0070702_100018906 3300005615 Bacteria 3581
91 Ga0070702_100962720 3300005615 Bacteria 673
92 Ga0068852_100162639 3300005616 Bacteria 2085
93 Ga0068859_100010198 3300005617 Bacteria 9457
94 Ga0068859_100091493 3300005617 Bacteria 3093
95 Ga0068859_100091855 3300005617 Bacteria 3087
96 Ga0068859_100119219 3300005617 Bacteria 2705
97 Ga0068864_101048626 3300005618 Bacteria 810
98 Ga0068866_10283244 3300005718 Bacteria 1028
99 Ga0068861_100113514 3300005719 Bacteria 2174
100 Ga0068861_100603151 3300005719 Bacteria 1008
101 Ga0068861_101595911 3300005719 Bacteria 643
102 Ga0068861_101955741 3300005719 Bacteria 584
103 Ga0068851_10027483 3300005834 Bacteria 2805
104 Ga0068863_100030434 3300005841 Bacteria 5154
105 Ga0068863_100100400 3300005841 Bacteria 2751
106 Ga0068863_100248799 3300005841 Bacteria 1717
107 Ga0068863_100253860 3300005841 Bacteria 1699
108 Ga0068863_100363095 3300005841 Bacteria 1412
109 Ga0068863_100726935 3300005841 Bacteria 988
110 Ga0068858_100011086 3300005842 Bacteria 8524
111 Ga0068858_100030738 3300005842 Bacteria 4988
112 Ga0068858_100093216 3300005842 Bacteria 2804
113 Ga0068858_100161338 3300005842 Bacteria 2111
114 Ga0068860_100020059 3300005843 Bacteria 6476
115 Ga0068860_100180904 3300005843 Bacteria 2037
116 Ga0068860_100692142 3300005843 Bacteria 1029
117 Ga0068862_100197937 3300005844 Bacteria 1811
118 Ga0068862_100206607 3300005844 Bacteria 1773
119 Ga0070717_10651607 3300006028 Bacteria 956
120 Ga0070715_10100617 3300006163 Bacteria 1348
121 Ga0070715_10377977 3300006163 Bacteria 781
122 Ga0070716_100008216 3300006173 Bacteria 5171
123 Ga0070716_100024302 3300006173 Bacteria 3224
124 Ga0070712_100013494 3300006175 Bacteria 5223
125 Ga0075427_10113167 3300006194 Bacteria 512
126 Ga0097621_100136561 3300006237 Bacteria 2092
127 Ga0097621_100152147 3300006237 Bacteria 1984
128 Ga0097621_100257573 3300006237 Bacteria 1530
129 Ga0068871_100009830 3300006358 Bacteria 6943
130 Ga0068871_100025411 3300006358 Bacteria 4608
131 Ga0068871_100700256 3300006358 Bacteria 928
132 Ga0068871_101273066 3300006358 Bacteria 691
133 Ga0075428_100001136 3300006844 Bacteria 28448
134 Ga0075428_100924541 3300006844 Bacteria 925
135 Ga0075429_100000889 3300006880 Bacteria 23630
136 Ga0075429_100003291 3300006880 Bacteria 13752
137 Ga0068865_100326743 3300006881 Bacteria 1236
138 Ga0068865_100686563 3300006881 Bacteria 873
139 Ga0068865_101319119 3300006881 Bacteria 642
140 Ga0075436_100503830 3300006914 Bacteria 886
141 Ga0097620_100010198 3300006931 Bacteria 9457
142 Ga0097620_100091491 3300006931 Bacteria 3093
143 Ga0097620_100091853 3300006931 Bacteria 3087
144 Ga0097620_100119228 3300006931 Bacteria 2705
145 Ga0075435_100940393 3300007076 Bacteria 754
146 Ga0105240_11081372 3300009093 Bacteria 854
147 Ga0111539_10092043 3300009094 Bacteria 3563
148 Ga0111539_10334504 3300009094 Bacteria 1763
149 Ga0111539_10377026 3300009094 Bacteria 1651
150 Ga0111539_10915801 3300009094 Unclassified 1019
151 Ga0111539_12744211 3300009094 Bacteria 571
152 Ga0105245_10048386 3300009098 Bacteria 3804
153 Ga0105245_10050130 3300009098 Bacteria 3740
154 Ga0105247_10005062 3300009101 Bacteria 8360
155 Ga0105247_10090325 3300009101 Bacteria 1943
156 Ga0114129_10000210 3300009147 Bacteria 65476
157 Ga0105243_10269854 3300009148 Bacteria 1527
158 Ga0105243_10490625 3300009148 Bacteria 1161
159 Ga0105243_10543681 3300009148 Bacteria 1109
160 Ga0105241_10114600 3300009174 Bacteria 2162
161 Ga0105241_10128246 3300009174 Bacteria 2051
162 Ga0105241_11876672 3300009174 Bacteria 587
163 Ga0105242_10139869 3300009176 Bacteria 2099
164 Ga0105242_10176922 3300009176 Bacteria 1879
165 Ga0105242_10515283 3300009176 Bacteria 1140
166 Ga0105248_10002698 3300009177 Bacteria 19716
167 Ga0105248_10088995 3300009177 Bacteria 3475
168 Ga0105248_10538391 3300009177 Bacteria 1317
169 Ga0105248_13041783 3300009177 Unclassified 534
170 Ga0105237_10158007 3300009545 Bacteria 2264
171 Ga0105238_10123699 3300009551 Bacteria 2566
172 Ga0105249_10499327 3300009553 Bacteria 1262
173 Ga0105249_10642940 3300009553 Bacteria 1118
174 Ga0105249_11184768 3300009553 Bacteria 835
175 Ga0105239_10224697 3300010375 Bacteria 2106
176 Ga0105239_10567284 3300010375 Bacteria 1293
177 Ga0105239_12024802 3300010375 Bacteria 669
178 Ga0105246_10069155 3300011119 Bacteria 2479
179 Ga0157328_1026257 3300012478 Bacteria 525
180 Ga0157371_10064768 3300013102 Bacteria 2589
181 Ga0157371_10237675 3300013102 Bacteria 1310
182 Ga0157370_10015284 3300013104 Bacteria 7808
183 Ga0157370_10027099 3300013104 Bacteria 5651
184 Ga0157374_10000508 3300013296 Bacteria 35025
185 Ga0157378_10057263 3300013297 Bacteria 3473
186 Ga0157378_10091572 3300013297 Bacteria 2765
187 Ga0157378_10093783 3300013297 Bacteria 2733
188 Ga0157378_10116835 3300013297 Bacteria 2454
189 Ga0157378_10674431 3300013297 Bacteria 1051
190 Ga0157378_10729740 3300013297 Bacteria 1012
191 Ga0163162_10180994 3300013306 Bacteria 2234
192 Ga0163162_10246283 3300013306 Bacteria 1919
193 Ga0163162_10321458 3300013306 Bacteria 1680
194 Ga0157375_10108505 3300013308 Bacteria 2871
195 Ga0157375_10415529 3300013308 Bacteria 1511
196 Ga0157375_11213119 3300013308 Bacteria 885
197 Ga0163163_10397418 3300014325 Bacteria 1436
198 Ga0163163_10904081 3300014325 Bacteria 946
199 Ga0157380_12648222 3300014326 Unclassified 568
200 Ga0157379_10029549 3300014968 Bacteria 4873
201 Ga0157379_10044178 3300014968 Bacteria 3977
202 Ga0157379_10051704 3300014968 Bacteria 3669
203 Ga0157376_10040994 3300014969 Bacteria 3788
204 Ga0157376_10108931 3300014969 Bacteria 2434
205 Ga0157376_10268722 3300014969 Bacteria 1601
206 Ga0157376_10932577 3300014969 Bacteria 888
207 Ga0157376_12350588 3300014969 Bacteria 572
208 Ga0157376_12796964 3300014969 Bacteria 528
209 Ga0163161_10144611 3300017792 Bacteria 1803
210 Ga0207656_10152790 3300025321 Bacteria 1094
211 Ga0207642_10006176 3300025899 Bacteria 3968
212 Ga0207680_10038459 3300025903 Bacteria 2769
213 Ga0207680_10245136 3300025903 Bacteria 1236
214 Ga0207680_10810687 3300025903 Bacteria 671
215 Ga0207685_10032210 3300025905 Bacteria 1885
216 Ga0207685_10231336 3300025905 Bacteria 884
217 Ga0207645_10065096 3300025907 Bacteria 2329
218 Ga0207645_10298856 3300025907 Bacteria 1072
219 Ga0207684_10235264 3300025910 Bacteria 1580
220 Ga0207684_10250482 3300025910 Bacteria 1528
221 Ga0207654_10013168 3300025911 Bacteria 4250
222 Ga0207707_10158603 3300025912 Bacteria 1978
223 Ga0207707_10217787 3300025912 Bacteria 1662
224 Ga0207695_10288167 3300025913 Bacteria 1535
225 Ga0207693_10003348 3300025915 Bacteria 13714
226 Ga0207693_10051620 3300025915 Bacteria 3227
227 Ga0207693_10179298 3300025915 Bacteria 1667
228 Ga0207663_10012995 3300025916 Bacteria 4515
229 Ga0207662_10284993 3300025918 Bacteria 1094
230 Ga0207657_10038623 3300025919 Bacteria 4248
231 Ga0207657_10472109 3300025919 Bacteria 984
232 Ga0207657_10505912 3300025919 Bacteria 946
233 Ga0207652_10879054 3300025921 Bacteria 793
234 Ga0207646_10446231 3300025922 Bacteria 1167
235 Ga0207646_10489805 3300025922 Bacteria 1108
236 Ga0207650_10824007 3300025925 Bacteria 787
237 Ga0207659_10364731 3300025926 Bacteria 1201
238 Ga0207687_10002138 3300025927 Bacteria 13458
239 Ga0207687_10057806 3300025927 Bacteria 2726
240 Ga0207687_11000975 3300025927 Bacteria 717
241 Ga0207700_10000535 3300025928 Bacteria 22245
242 Ga0207700_10217394 3300025928 Bacteria 1618
243 Ga0207664_11008728 3300025929 Unclassified 746
244 Ga0207644_10074905 3300025931 Bacteria 2486
245 Ga0207644_10298985 3300025931 Bacteria 1296
246 Ga0207706_10003500 3300025933 Bacteria 14990
247 Ga0207706_10052927 3300025933 Bacteria 3584
248 Ga0207686_10003542 3300025934 Bacteria 8375
249 Ga0207686_10142204 3300025934 Bacteria 1660
250 Ga0207670_10001184 3300025936 Bacteria 13778
251 Ga0207670_10634597 3300025936 Bacteria 880
252 Ga0207669_10009001 3300025937 Bacteria 4724
253 Ga0207669_10035156 3300025937 Bacteria 2848
254 Ga0207704_10009522 3300025938 Bacteria 4691
255 Ga0207704_10063640 3300025938 Bacteria 2300
256 Ga0207704_10586601 3300025938 Bacteria 911
257 Ga0207665_10018633 3300025939 Bacteria 4560
258 Ga0207665_10030153 3300025939 Bacteria 3585
259 Ga0207691_10163510 3300025940 Bacteria 1951
260 Ga0207691_10218365 3300025940 Bacteria 1654
261 Ga0207691_10303486 3300025940 Bacteria 1371
262 Ga0207711_10029193 3300025941 Bacteria 4648
263 Ga0207711_10064090 3300025941 Bacteria 3173
264 Ga0207711_10080376 3300025941 Bacteria 2847
265 Ga0207711_10160375 3300025941 Bacteria 2035
266 Ga0207711_10251934 3300025941 Bacteria 1621
267 Ga0207689_10008154 3300025942 Bacteria 9135
268 Ga0207689_10035534 3300025942 Bacteria 4139
269 Ga0207689_10135590 3300025942 Bacteria 2027
270 Ga0207661_10750448 3300025944 Bacteria 898
271 Ga0207679_10028884 3300025945 Bacteria 3856
272 Ga0207679_10302405 3300025945 Bacteria 1379
273 Ga0207679_10774822 3300025945 Bacteria 873
274 Ga0207679_11723626 3300025945 Bacteria 573
275 Ga0207651_10161803 3300025960 Bacteria 1755
276 Ga0207651_10228475 3300025960 Bacteria 1509
277 Ga0207651_11184473 3300025960 Bacteria 686
278 Ga0207712_10544638 3300025961 Bacteria 997
279 Ga0207712_10567600 3300025961 Bacteria 978
280 Ga0207640_10003371 3300025981 Bacteria 8605
281 Ga0207640_10719247 3300025981 Bacteria 858
282 Ga0207658_10070376 3300025986 Bacteria 2646
283 Ga0207658_10535921 3300025986 Bacteria 1046
284 Ga0207677_10031958 3300026023 Bacteria 3377
285 Ga0207677_10078563 3300026023 Bacteria 2357
286 Ga0207677_10390922 3300026023 Bacteria 1177
287 Ga0207703_10079707 3300026035 Bacteria 2725
288 Ga0207703_10081877 3300026035 Bacteria 2692
289 Ga0207639_10334188 3300026041 Bacteria 1349
290 Ga0207678_10040691 3300026067 Bacteria 4029
291 Ga0207702_10450113 3300026078 Bacteria 1249
292 Ga0207702_10471559 3300026078 Bacteria 1220
293 Ga0207641_10030196 3300026088 Bacteria 4488
294 Ga0207641_10271292 3300026088 Bacteria 1592
295 Ga0207641_10689339 3300026088 Bacteria 1005
296 Ga0207648_10039223 3300026089 Bacteria 4165
297 Ga0207648_10088232 3300026089 Bacteria 2708
298 Ga0207648_10142275 3300026089 Bacteria 2114
299 Ga0207648_10597435 3300026089 Bacteria 1017
300 Ga0207676_10001046 3300026095 Bacteria 21066
301 Ga0207676_10386834 3300026095 Bacteria 1304
302 Ga0207674_10003580 3300026116 Bacteria 18942
303 Ga0207675_100094743 3300026118 Bacteria 2808
304 Ga0207675_100096877 3300026118 Bacteria 2777
305 Ga0207675_100118944 3300026118 Bacteria 2499
306 Ga0207675_101342690 3300026118 Bacteria 736
307 Ga0207675_101411312 3300026118 Bacteria 717
308 Ga0207683_10000448 3300026121 Bacteria 38154
309 Ga0207683_10038245 3300026121 Bacteria 4181
310 Ga0207683_11885743 3300026121 Bacteria 546
311 Ga0207698_10208990 3300026142 Bacteria 1754
312 Ga0207428_10130171 3300027907 Bacteria 1926
313 Ga0268266_10029384 3300028379 Bacteria 4673
314 Ga0268266_10433893 3300028379 Bacteria 1247
315 Ga0268266_11449057 3300028379 Bacteria 662
316 Ga0268265_10131893 3300028380 Bacteria 2078
317 Ga0268265_10136056 3300028380 Bacteria 2050
318 Ga0268264_10030120 3300028381 Bacteria 4449
319 Ga0268264_10532371 3300028381 Bacteria 1150
320 Ga0307511_10000063 3300030521 Bacteria 91169
321 Ga0265330_10286800 3300031235 Bacteria 693
322 Ga0265332_10004230 3300031238 Bacteria 6793
323 Ga0265328_10051236 3300031239 Bacteria 1515
324 Ga0265325_10010023 3300031241 Bacteria 5506
325 Ga0265325_10055280 3300031241 Bacteria 2030
326 Ga0265329_10004605 3300031242 Bacteria 5702
327 Ga0265340_10138443 3300031247 Bacteria 1114
328 Ga0265339_10042072 3300031249 Bacteria 2531
329 Ga0265331_10000737 3300031250 Bacteria 27498
330 Ga0265331_10032485 3300031250 Bacteria 2586
331 Ga0265331_10039219 3300031250 Bacteria 2311
332 Ga0265327_10001220 3300031251 Bacteria 34600
333 Ga0265316_10005160 3300031344 Bacteria 12787
334 Ga0307509_10826776 3300031507 Bacteria 591
335 Ga0265313_10149916 3300031595 Bacteria 997
336 Ga0265314_10006885 3300031711 Bacteria 9960
337 Ga0265342_10072997 3300031712 Bacteria 1996
338 Ga0307409_100524655 3300031995 Bacteria 1158
339 Ga0373926_0220745 3300035083 Bacteria 732
340 Ga0373934_0027703 3300035086 Bacteria 2203
341 Ga0373934_0219958 3300035086 Bacteria 783
342 Ga0373944_0067403 3300035089 Bacteria 1159
343 Ga0373944_0243916 3300035089 Bacteria 661
344 Ga0373923_0054441 3300035111 Bacteria 1684
345 Ga0373936_0031912 3300035113 Bacteria 2082
346 Ga0373936_0440819 3300035113 Bacteria 601
347 Ga0373945_0126248 3300035116 Bacteria 1021
348 Ga0373953_0123169 3300035117 Bacteria 1102
349 Ga0373954_0041883 3300035118 Bacteria 2135
350 Ga0373956_0038992 3300035119 Bacteria 2104
351 Ga0373956_0631981 3300035119 Bacteria 511
352 Ga0373943_0025786 3300035170 Bacteria 2749
353 Ga0373943_0031655 3300035170 Bacteria 2511
354 Ga0373943_0145196 3300035170 Bacteria 1281
355 Ga0373955_0005929 3300035172 Bacteria 5530
356 Ga0373931_0239550 3300035691 Bacteria 1099
357 Ga0373935_0029677 3300035692 Bacteria 3385
358 Ga0373927_0013084 3300035695 Bacteria 5519
359 Ga0373927_0023145 3300035695 Bacteria 4069
360 Ga0373927_0041164 3300035695 Bacteria 2997
361 Ga0373927_0149585 3300035695 Bacteria 1529
362 Ga0373927_0408997 3300035695 Bacteria 895
363 Ga0373933_0133465 3300035724 Bacteria 1562
364 Ga0373933_0234861 3300035724 Bacteria 1178
365 Ga0373933_0385030 3300035724 Bacteria 914
366 Ga0373947_0125031 3300035725 Bacteria 1637
367 Ga0373947_0226273 3300035725 Bacteria 1231
368 Ga0373947_0734685 3300035725 Bacteria 673
369 Ga0373937_0047958 3300036401 Bacteria 3908
370 Ga0373937_0271583 3300036401 Bacteria 1600
371 Ga0373925_0204615 3300037068 Bacteria 1571
372 Ga0373925_0238545 3300037068 Bacteria 1456
373 Ga0373925_0328542 3300037068 Bacteria 1238
374 Ga0373925_0376212 3300037068 Bacteria 1156
375 Ga0373925_1458434 3300037068 Bacteria 560
376 Ga0451802_0092770 3300041460 Bacteria 728
377 Ga0451807_0763059 3300041486 Bacteria 1157
378 Ga0451853_3389454 3300041512 Bacteria 982
379 Ga0450893_0137549 3300042532 Bacteria 519
380 Ga0451577_0001121 3300042876 Bacteria 38000
381 Ga0451577_0025430 3300042876 Bacteria 5371
382 Ga0453683_0009257 3300044673 Bacteria 6580
383 Ga0453683_0134717 3300044673 Bacteria 1557
384 Ga0453683_0521794 3300044673 Bacteria 772
385 Ga0453684_0000014 3300044712 Bacteria 993311
386 Ga0453684_0000158 3300044712 Bacteria 302033
387 Ga0453684_0029770 3300044712 Bacteria 7738
388 Ga0453684_0294987 3300044712 Bacteria 1844
389 Ga0453684_0355326 3300044712 Bacteria 1651
390 Ga0453684_0449013 3300044712 Bacteria 1435
391 Ga0451576_0006384 3300045051 Bacteria 14478
392 Ga0451576_0176538 3300045051 Bacteria 2230
393 Ga0451576_0211066 3300045051 Bacteria 2027
394 Ga0451576_0266791 3300045051 Bacteria 1789
395 Ga0451576_0290599 3300045051 Bacteria 1709
396 Ga0451576_0520176 3300045051 Bacteria 1250
397 Ga0495629_0210067 3300046459 Bacteria 1344
398 Ga0495641_0307172 3300046461 Bacteria 715
399 Ga0495651_0038583 3300046462 Bacteria 3720
400 Ga0495580_0023293 3300046472 Bacteria 4550
401 Ga0495580_0105735 3300046472 Bacteria 1955
402 Ga0495639_0050103 3300046475 Bacteria 1896
403 Ga0495662_0050061 3300046476 Bacteria 2016
404 Ga0495664_0136315 3300046477 Bacteria 1487
405 Ga0495608_0917651 3300046511 Bacteria 512
406 Ga0495630_0426073 3300046517 Bacteria 1017
407 Ga0495666_0135165 3300046526 Bacteria 1151
408 Ga0495652_0291024 3300046529 Bacteria 1192
409 Ga0495586_0326480 3300046535 Bacteria 880
410 Ga0495586_0597095 3300046535 Bacteria 638
411 Ga0495586_0796144 3300046535 Bacteria 545
412 Ga0495645_0064018 3300046543 Bacteria 2661
413 Ga0495667_0077923 3300046559 Bacteria 2155
414 Ga0495635_0135515 3300046663 Bacteria 1678
415 Ga0495588_0056131 3300046674 Bacteria 2033
416 Ga0495588_0239513 3300046674 Bacteria 957
417 Ga0495599_0550638 3300046678 Bacteria 675
418 Ga0495647_0021692 3300046681 Bacteria 2314
419 Ga0495658_0079379 3300046683 Bacteria 1923
420 Ga0495613_0089751 3300046689 Bacteria 2226
421 Ga0495600_0227729 3300046809 Bacteria 1191
422 Ga0495581_0000428 3300047315 Bacteria 21379
423 Ga0495604_0867697 3300047317 Bacteria 565
424 Ga0495674_0418838 3300047319 Bacteria 1079
425 Ga0495674_0949687 3300047319 Bacteria 661
426 Ga0495680_0036734 3300047322 Bacteria 3930
427 Ga0495675_0637513 3300047444 Bacteria 601
428 Ga0495602_0370913 3300048088 Bacteria 1028
429 Ga0495614_0054880 3300048089 Bacteria 1709
430 Ga0496102_0075950 3300048905 Bacteria 3089
431 Ga0496104_0075889 3300048907 Bacteria 3201
432 Ga0496106_0203735 3300048909 Bacteria 1575
433 Ga0496107_0159599 3300048910 Bacteria 1671
434 Ga0496107_0281141 3300048910 Bacteria 1239
435 Ga0496108_0248772 3300048911 Bacteria 1546
436 Ga0496108_0484584 3300048911 Bacteria 1080
437 Ga0496109_0088428 3300048912 Bacteria 2863
438 Ga0496109_0495493 3300048912 Bacteria 1153
439 Ga0496109_0537919 3300048912 Bacteria 1102
440 Ga0496109_2061568 3300048912 Bacteria 502
441 Ga0496110_0685574 3300048913 Bacteria 926
442 Ga0496112_0003968 3300048915 Bacteria 12392
443 Ga0496112_0036230 3300048915 Bacteria 4811
444 Ga0496112_0116516 3300048915 Bacteria 2642
445 Ga0496113_0017705 3300048916 Bacteria 4953
446 Ga0496113_0206824 3300048916 Bacteria 1561
447 Ga0496114_0131463 3300048917 Bacteria 2162
448 Ga0496115_0131495 3300048918 Bacteria 2063
449 Ga0501041_0089180 3300049577 Bacteria 1904
450 Ga0501041_0175596 3300049577 Bacteria 1341
451 Ga0501071_0000992 3300049587 Bacteria 15550
452 Ga0501071_0238830 3300049587 Bacteria 1370
453 Ga0501075_0004058 3300049591 Bacteria 9884
454 Ga0501076_0028375 3300049592 Bacteria 4346
455 Ga0501076_0720815 3300049592 Bacteria 823
456 Ga0501076_0983018 3300049592 Bacteria 695
457 Ga0501080_0409708 3300049742 Bacteria 1219
458 Ga0501080_0927026 3300049742 Bacteria 758
459 Ga0501081_0111039 3300049743 Bacteria 1945
460 Ga0501045_0304513 3300049824 Bacteria 1186
461 nmdc:mga0k408_418339_c1 3300050493 Bacteria 797
462 nmdc:mga05p37_451654_c1 3300050507 Bacteria 1487
463 nmdc:mga09592_4718_c1 3300050508 Bacteria 11033
464 nmdc:mga06r32_1772959_c1 3300050510 Bacteria 553
465 nmdc:mga08y16_28220_c1 3300050511 Bacteria 5916
466 nmdc:mga08y16_308681_c1 3300050511 Bacteria 1629
467 nmdc:mga0n895_220739_c1 3300050512 Bacteria 1924
468 nmdc:mga0sz30_71359_c1 3300050516 Bacteria 1495
469 Ga0495601_0080294 3300053077 Bacteria 2093
470 Ga0495612_0029887 3300053078 Bacteria 2195
471 Ga0495619_0069732 3300053085 Bacteria 2350
472 Ga0495619_0283492 3300053085 Bacteria 1148
473 Ga0500646_0000900 3300053090 Bacteria 8208
474 Ga0500583_0389923 3300053092 Bacteria 669
475 Ga0500650_0339618 3300053098 Bacteria 658
476 Ga0500645_020912 3300053730 Bacteria 2023
477 2735816395 2734482258 Unclassified 2930739
478 2891636482 2891633521 Bacteria 4602265
479 2904435247 2904434214 Bacteria 6230908
480 Ga0070661_100073781
481 Ga0070683_100024289
482 Ga0070690_100065714
483 Ga0070690_100088451
484 Ga0070670_100110824
485 Ga0070677_10166945
486 Ga0068869_100002911
487 Ga0070666_10166144
488 Ga0070666_10249061
489 Ga0070682_100047121
490 Ga0068868_100031446
491 Ga0068868_100038081
492 Ga0068868_100079971
493 Ga0070689_100010115
494 Ga0070689_100216586
495 Ga0070691_10391106
496 Ga0070687_100127309
497 Ga0070687_100747628
498 Ga0070668_100021699
499 Ga0070668_101191235
500 Ga0070669_100438484
501 Ga0070675_100067948
502 Ga0070671_100013893
503 Ga0070671_100364711
504 Ga0070674_100022082
505 Ga0070674_100468993
506 Ga0070673_100049314
507 Ga0070688_100000866
508 Ga0070667_100090389
509 Ga0070667_100280243
510 Ga0070709_10034791
511 Ga0070709_10092021
512 Ga0070714_100285184
513 Ga0070714_100821975
514 Ga0070713_100000031
515 Ga0070713_100053170
516 Ga0070713_100162694
517 Ga0070713_100759181
518 Ga0070701_10038512
519 Ga0070711_100015970
520 Ga0070711_101327379
521 Ga0070705_100015715
522 Ga0070694_100379764
523 Ga0070708_100044684
524 Ga0070708_101031929
525 Ga0070663_100084197
526 Ga0070663_101139387
527 Ga0070678_100034986
528 Ga0070678_101345478
529 Ga0070662_100039703
530 Ga0070662_100134285
531 Ga0070681_10177737
532 Ga0070681_10278526
533 Ga0068867_100046296
534 Ga0068867_100163787
535 Ga0068867_100723415
536 Ga0070685_10001494
537 Ga0070707_100383356
538 Ga0070707_100502076
539 Ga0070698_100041031
540 Ga0070698_100262676
541 Ga0070698_100365522
542 Ga0070699_100208404
543 Ga0070679_100136429
544 Ga0070679_101155853
545 Ga0070684_100216084
546 Ga0070684_101248076
547 Ga0070697_100016106
548 Ga0068853_100084675
549 Ga0068853_100230337
550 Ga0070672_100202665
551 Ga0070686_100094859
552 Ga0070686_100096136
553 Ga0070695_100555638
554 Ga0070696_100025279
555 Ga0070693_100022716
556 Ga0070693_100093737
557 Ga0070665_100046717
558 Ga0070665_101220876
559 Ga0070665_101748850
560 Ga0070704_100034063
561 Ga0070664_100587041
562 Ga0070664_101010047
563 Ga0068857_101436053
564 Ga0068854_100025805
565 Ga0068856_100333788
566 Ga0068856_100416090
567 Ga0068856_100529606
568 Ga0068856_102403711
569 Ga0070702_100018906
570 Ga0070702_100962720
571 Ga0068852_100162639
572 Ga0068859_100010198
573 Ga0068859_100091493
574 Ga0068859_100091855
575 Ga0068859_100119219
576 Ga0068864_101048626
577 Ga0068866_10283244
578 Ga0068861_100113514
579 Ga0068861_100603151
580 Ga0068861_101595911
581 Ga0068861_101955741
582 Ga0068851_10027483
583 Ga0068863_100030434
584 Ga0068863_100100400
585 Ga0068863_100248799
586 Ga0068863_100253860
587 Ga0068863_100363095
588 Ga0068863_100726935
589 Ga0068858_100011086
590 Ga0068858_100030738
591 Ga0068858_100093216
592 Ga0068858_100161338
593 Ga0068860_100020059
594 Ga0068860_100180904
595 Ga0068860_100692142
596 Ga0068862_100197937
597 Ga0068862_100206607
598 Ga0070717_10651607
599 Ga0070715_10100617
600 Ga0070715_10377977
601 Ga0070716_100008216
602 Ga0070716_100024302
603 Ga0070712_100013494
604 Ga0075427_10113167
605 Ga0097621_100136561
606 Ga0097621_100152147
607 Ga0097621_100257573
608 Ga0068871_100009830
609 Ga0068871_100025411
610 Ga0068871_100700256
611 Ga0068871_101273066
612 Ga0075428_100001136
613 Ga0075428_100924541
614 Ga0075429_100000889
615 Ga0075429_100003291
616 Ga0068865_100326743
617 Ga0068865_100686563
618 Ga0068865_101319119
619 Ga0075436_100503830
620 Ga0097620_100010198
621 Ga0097620_100091491
622 Ga0097620_100091853
623 Ga0097620_100119228
624 Ga0075435_100940393
625 Ga0105240_11081372
626 Ga0111539_10092043
627 Ga0111539_10334504
628 Ga0111539_10377026
629 Ga0111539_10915801
630 Ga0111539_12744211
631 Ga0105245_10048386
632 Ga0105245_10050130
633 Ga0105247_10005062
634 Ga0105247_10090325
635 Ga0114129_10000210
636 Ga0105243_10269854
637 Ga0105243_10490625
638 Ga0105243_10543681
639 Ga0105241_10114600
640 Ga0105241_10128246
641 Ga0105241_11876672
642 Ga0105242_10139869
643 Ga0105242_10176922
644 Ga0105242_10515283
645 Ga0105248_10002698
646 Ga0105248_10088995
647 Ga0105248_10538391
648 Ga0105248_13041783
649 Ga0105237_10158007
650 Ga0105238_10123699
651 Ga0105249_10499327
652 Ga0105249_10642940
653 Ga0105249_11184768
654 Ga0105239_10224697
655 Ga0105239_10567284
656 Ga0105239_12024802
657 Ga0105246_10069155
658 Ga0157328_1026257
659 Ga0157371_10064768
660 Ga0157371_10237675
661 Ga0157370_10015284
662 Ga0157370_10027099
663 Ga0157374_10000508
664 Ga0157378_10057263
665 Ga0157378_10091572
666 Ga0157378_10093783
667 Ga0157378_10116835
668 Ga0157378_10674431
669 Ga0157378_10729740
670 Ga0163162_10180994
671 Ga0163162_10246283
672 Ga0163162_10321458
673 Ga0157375_10108505
674 Ga0157375_10415529
675 Ga0157375_11213119
676 Ga0163163_10397418
677 Ga0163163_10904081
678 Ga0157380_12648222
679 Ga0157379_10029549
680 Ga0157379_10044178
681 Ga0157379_10051704
682 Ga0157376_10040994
683 Ga0157376_10108931
684 Ga0157376_10268722
685 Ga0157376_10932577
686 Ga0157376_12350588
687 Ga0157376_12796964
688 Ga0163161_10144611
689 Ga0207656_10152790
690 Ga0207642_10006176
691 Ga0207680_10038459
692 Ga0207680_10245136
693 Ga0207680_10810687
694 Ga0207685_10032210
695 Ga0207685_10231336
696 Ga0207645_10065096
697 Ga0207645_10298856
698 Ga0207684_10235264
699 Ga0207684_10250482
700 Ga0207654_10013168
701 Ga0207707_10158603
702 Ga0207707_10217787
703 Ga0207695_10288167
704 Ga0207693_10003348
705 Ga0207693_10051620
706 Ga0207693_10179298
707 Ga0207663_10012995
708 Ga0207662_10284993
709 Ga0207657_10038623
710 Ga0207657_10472109
711 Ga0207657_10505912
712 Ga0207652_10879054
713 Ga0207646_10446231
714 Ga0207646_10489805
715 Ga0207650_10824007
716 Ga0207659_10364731
717 Ga0207687_10002138
718 Ga0207687_10057806
719 Ga0207687_11000975
720 Ga0207700_10000535
721 Ga0207700_10217394
722 Ga0207664_11008728
723 Ga0207644_10074905
724 Ga0207644_10298985
725 Ga0207706_10003500
726 Ga0207706_10052927
727 Ga0207686_10003542
728 Ga0207686_10142204
729 Ga0207670_10001184
730 Ga0207670_10634597
731 Ga0207669_10009001
732 Ga0207669_10035156
733 Ga0207704_10009522
734 Ga0207704_10063640
735 Ga0207704_10586601
736 Ga0207665_10018633
737 Ga0207665_10030153
738 Ga0207691_10163510
739 Ga0207691_10218365
740 Ga0207691_10303486
741 Ga0207711_10029193
742 Ga0207711_10064090
743 Ga0207711_10080376
744 Ga0207711_10160375
745 Ga0207711_10251934
746 Ga0207689_10008154
747 Ga0207689_10035534
748 Ga0207689_10135590
749 Ga0207661_10750448
750 Ga0207679_10028884
751 Ga0207679_10302405
752 Ga0207679_10774822
753 Ga0207679_11723626
754 Ga0207651_10161803
755 Ga0207651_10228475
756 Ga0207651_11184473
757 Ga0207712_10544638
758 Ga0207712_10567600
759 Ga0207640_10003371
760 Ga0207640_10719247
761 Ga0207658_10070376
762 Ga0207658_10535921
763 Ga0207677_10031958
764 Ga0207677_10078563
765 Ga0207677_10390922
766 Ga0207703_10079707
767 Ga0207703_10081877
768 Ga0207639_10334188
769 Ga0207678_10040691
770 Ga0207702_10450113
771 Ga0207702_10471559
772 Ga0207641_10030196
773 Ga0207641_10271292
774 Ga0207641_10689339
775 Ga0207648_10039223
776 Ga0207648_10088232
777 Ga0207648_10142275
778 Ga0207648_10597435
779 Ga0207676_10001046
780 Ga0207676_10386834
781 Ga0207674_10003580
782 Ga0207675_100094743
783 Ga0207675_100096877
784 Ga0207675_100118944
785 Ga0207675_101342690
786 Ga0207675_101411312
787 Ga0207683_10000448
788 Ga0207683_10038245
789 Ga0207683_11885743
790 Ga0207698_10208990
791 Ga0207428_10130171
792 Ga0268266_10029384
793 Ga0268266_10433893
794 Ga0268266_11449057
795 Ga0268265_10131893
796 Ga0268265_10136056
797 Ga0268264_10030120
798 Ga0268264_10532371
799 Ga0307511_10000063
800 Ga0265330_10286800
801 Ga0265332_10004230
802 Ga0265328_10051236
803 Ga0265325_10010023
804 Ga0265325_10055280
805 Ga0265329_10004605
806 Ga0265340_10138443
807 Ga0265339_10042072
808 Ga0265331_10000737
809 Ga0265331_10032485
810 Ga0265331_10039219
811 Ga0265327_10001220
812 Ga0265316_10005160
813 Ga0307509_10826776
814 Ga0265313_10149916
815 Ga0265314_10006885
816 Ga0265342_10072997
817 Ga0307409_100524655
818 Ga0373926_0220745
819 Ga0373934_0027703
820 Ga0373934_0219958
821 Ga0373944_0067403
822 Ga0373944_0243916
823 Ga0373923_0054441
824 Ga0373936_0031912
825 Ga0373936_0440819
826 Ga0373945_0126248
827 Ga0373953_0123169
828 Ga0373954_0041883
829 Ga0373956_0038992
830 Ga0373956_0631981
831 Ga0373943_0025786
832 Ga0373943_0031655
833 Ga0373943_0145196
834 Ga0373955_0005929
835 Ga0373931_0239550
836 Ga0373935_0029677
837 Ga0373927_0013084
838 Ga0373927_0023145
839 Ga0373927_0041164
840 Ga0373927_0149585
841 Ga0373927_0408997
842 Ga0373933_0133465
843 Ga0373933_0234861
844 Ga0373933_0385030
845 Ga0373947_0125031
846 Ga0373947_0226273
847 Ga0373947_0734685
848 Ga0373937_0047958
849 Ga0373937_0271583
850 Ga0373925_0204615
851 Ga0373925_0238545
852 Ga0373925_0328542
853 Ga0373925_0376212
854 Ga0373925_1458434
855 Ga0451802_0092770
856 Ga0451807_0763059
857 Ga0451853_3389454
858 Ga0450893_0137549
859 Ga0451577_0001121
860 Ga0451577_0025430
861 Ga0453683_0009257
862 Ga0453683_0134717
863 Ga0453683_0521794
864 Ga0453684_0000014
865 Ga0453684_0000158
866 Ga0453684_0029770
867 Ga0453684_0294987
868 Ga0453684_0355326
869 Ga0453684_0449013
870 Ga0451576_0006384
871 Ga0451576_0176538
872 Ga0451576_0211066
873 Ga0451576_0266791
874 Ga0451576_0290599
875 Ga0451576_0520176
876 Ga0495629_0210067
877 Ga0495641_0307172
878 Ga0495651_0038583
879 Ga0495580_0023293
880 Ga0495580_0105735
881 Ga0495639_0050103
882 Ga0495662_0050061
883 Ga0495664_0136315
884 Ga0495608_0917651
885 Ga0495630_0426073
886 Ga0495666_0135165
887 Ga0495652_0291024
888 Ga0495586_0326480
889 Ga0495586_0597095
890 Ga0495586_0796144
891 Ga0495645_0064018
892 Ga0495667_0077923
893 Ga0495635_0135515
894 Ga0495588_0056131
895 Ga0495588_0239513
896 Ga0495599_0550638
897 Ga0495647_0021692
898 Ga0495658_0079379
899 Ga0495613_0089751
900 Ga0495600_0227729
901 Ga0495581_0000428
902 Ga0495604_0867697
903 Ga0495674_0418838
904 Ga0495674_0949687
905 Ga0495680_0036734
906 Ga0495675_0637513
907 Ga0495602_0370913
908 Ga0495614_0054880
909 Ga0496102_0075950
910 Ga0496104_0075889
911 Ga0496106_0203735
912 Ga0496107_0159599
913 Ga0496107_0281141
914 Ga0496108_0248772
915 Ga0496108_0484584
916 Ga0496109_0088428
917 Ga0496109_0495493
918 Ga0496109_0537919
919 Ga0496109_2061568
920 Ga0496110_0685574
921 Ga0496112_0003968
922 Ga0496112_0036230
923 Ga0496112_0116516
924 Ga0496113_0017705
925 Ga0496113_0206824
926 Ga0496114_0131463
927 Ga0496115_0131495
928 Ga0501041_0089180
929 Ga0501041_0175596
930 Ga0501071_0000992
931 Ga0501071_0238830
932 Ga0501075_0004058
933 Ga0501076_0028375
934 Ga0501076_0720815
935 Ga0501076_0983018
936 Ga0501080_0409708
937 Ga0501080_0927026
938 Ga0501081_0111039
939 Ga0501045_0304513
940 nmdc:mga0k408_418339_c1
941 nmdc:mga05p37_451654_c1
942 nmdc:mga09592_4718_c1
943 nmdc:mga06r32_1772959_c1
944 nmdc:mga08y16_28220_c1
945 nmdc:mga08y16_308681_c1
946 nmdc:mga0n895_220739_c1
947 nmdc:mga0sz30_71359_c1
948 Ga0495601_0080294
949 Ga0495612_0029887
950 Ga0495619_0069732
951 Ga0495619_0283492
952 Ga0500646_0000900
953 Ga0500583_0389923
954 Ga0500650_0339618
955 Ga0500645_020912
956 2735816395
957 2891636482
958 2904435247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

28

112

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3luu-assembly1.cif.gz_A crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution 0.9011 18 115
5tul-assembly1.cif.gz_A crystal structure of tetracycline destructase tet(55) 0.8874 25 48
6zqc-assembly1.cif.gz_UD cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state pre-a1 0.88 25 50
3luu-assembly1.cif.gz_A crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution 0.8715 18 115
4bl0-assembly2.cif.gz_A crystal structure of yeast bub3-bub1 bound to phospho-spc105 0.8688 25 48
ID Description Score Start End Superfamily
af_A0A096QNN6_205_497_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9562 25 50 2.130.10.10
af_P53276_35_383_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9533 25 51 2.130.10.10
af_Q21526_18_114_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.9511 28 51 3.30.2020.30
af_A0A0P0WS15_683_864_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9509 28 50 2.130.10.10
af_Q18263_349_612_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9365 24 52 2.130.10.10
ID Description Score Start End GO Terms
AF-G7EIC3-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9958 73 133 GO:0046872
AF-A0A3B9TVQ7-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9867 72 136 GO:0046872
AF-A0A7J7PTC3-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9767 74 141 GO:0046872
AF-A0A1F4F118-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9702 25 128 GO:0016853
GO:0046872
AF-A0A3L8BFT8-F1-model_v4 DUF971 domain-containing protein 0.9695 24 139 GO:0046872

Map