F452004

General Info

Members Datasets Scaffolds Average Seq Length
479 246 479 328

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100098209|Ga0070708_1000982091
Length 359
Sequence MRRRAEGQAATPRADGFRMPAEWEPHQCCFMAWPTRKSLWGDMFARAKLDYAEAARAIAGFEPVVMICRPGDAADVVDLCGSSVQVTEIEIDDSWTRDSGPVFVVNDRGHLAAVDFGFNSWGGKYLPYNRDAALGAALADVLGVKRYQAPFVLEGGAFYTDGEGTVLTTEGPVLDPARNRAASRPLFEQIAREYLGADQVLWLVAFPDRDTDGHVDGIAQFAGPAQLLLLVPAAPGHANYAFARENIARLAAATDARGRPVDVIPFEVTASARIGGEAFDVPYLNCYLANGGVVAPLAGSPSDEAALARLGEAFGDREVVGVPGAALSYGGGGPHCITQQMPLGRAVPGSTGTARPQRP

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
89 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 10.44
Rhizosphere 87.89
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10025111 3300003659 Bacteria 1283
2 Ga0070658_10054763 3300005327 Bacteria 3239
3 Ga0070691_10010784 3300005341 Bacteria 4168
4 Ga0070692_10066243 3300005345 Bacteria 1914
5 Ga0070668_100111762 3300005347 Bacteria 2175
6 Ga0070671_100128448 3300005355 Unclassified 2134
7 Ga0070673_100247245 3300005364 Unclassified 1553
8 Ga0070709_10030103 3300005434 Bacteria 3254
9 Ga0070709_10034704 3300005434 Bacteria 3060
10 Ga0070714_100037632 3300005435 Bacteria 4066
11 Ga0070713_100050180 3300005436 Bacteria 3445
12 Ga0070713_100245711 3300005436 Bacteria 1631
13 Ga0070711_100145725 3300005439 Bacteria 1781
14 Ga0070700_100298384 3300005441 Bacteria 1175
15 Ga0070694_100001556 3300005444 Bacteria 13488
16 Ga0070708_100030136 3300005445 Bacteria 4688
17 Ga0070708_100098209 3300005445 Unclassified 2678
18 Ga0070708_100215665 3300005445 Bacteria 1799
19 Ga0070663_100067829 3300005455 Bacteria 2589
20 Ga0070678_100090747 3300005456 Bacteria 2343
21 Ga0068867_100095699 3300005459 Bacteria 2259
22 Ga0070706_100010517 3300005467 Bacteria 8589
23 Ga0070706_100081479 3300005467 Bacteria 2997
24 Ga0070706_100117508 3300005467 Bacteria 2477
25 Ga0070707_100000368 3300005468 Bacteria 44585
26 Ga0070707_100012169 3300005468 Bacteria 8032
27 Ga0070707_100023285 3300005468 Bacteria 5859
28 Ga0070707_100105181 3300005468 Bacteria 2737
29 Ga0070698_100003283 3300005471 Bacteria 17779
30 Ga0070698_100055857 3300005471 Bacteria 4001
31 Ga0070698_100063451 3300005471 Bacteria 3725
32 Ga0070698_100176048 3300005471 Bacteria 2079
33 Ga0070699_100035762 3300005518 Bacteria 4294
34 Ga0070697_100004169 3300005536 Bacteria 11076
35 Ga0070697_100174010 3300005536 Bacteria 1823
36 Ga0070686_100014919 3300005544 Bacteria 4488
37 Ga0070665_100002426 3300005548 Bacteria 20546
38 Ga0070704_100016969 3300005549 Bacteria 4617
39 Ga0068854_100090154 3300005578 Bacteria 2280
40 Ga0068854_100100962 3300005578 Bacteria 2163
41 Ga0068856_100025439 3300005614 Bacteria 5773
42 Ga0068861_100213470 3300005719 Bacteria 1627
43 Ga0068863_100309110 3300005841 Unclassified 1534
44 Ga0068860_100356233 3300005843 Bacteria 1441
45 Ga0081455_10001816 3300005937 Bacteria 25720
46 Ga0081455_10007587 3300005937 Bacteria 11401
47 Ga0081455_10009285 3300005937 Bacteria 10127
48 Ga0081455_10013287 3300005937 Bacteria 8154
49 Ga0081455_10145358 3300005937 Bacteria 1835
50 Ga0081540_1000409 3300005983 Bacteria 42353
51 Ga0081540_1000773 3300005983 Bacteria 29354
52 Ga0081539_10003206 3300005985 Bacteria 20667
53 Ga0081539_10003573 3300005985 Bacteria 18875
54 Ga0081539_10005020 3300005985 Bacteria 13951
55 Ga0081539_10122124 3300005985 Bacteria 1292
56 Ga0070717_10006903 3300006028 Bacteria 8384
57 Ga0070717_10051464 3300006028 Bacteria 3390
58 Ga0070717_10329608 3300006028 Bacteria 1361
59 Ga0070717_10400671 3300006028 Bacteria 1233
60 Ga0075364_10036114 3300006051 Bacteria 3195
61 Ga0075432_10001926 3300006058 Bacteria 6882
62 Ga0070715_10045168 3300006163 Unclassified 1867
63 Ga0070712_100000001 3300006175 Bacteria 343916
64 Ga0070712_100004217 3300006175 Bacteria 8846
65 Ga0070712_100013540 3300006175 Bacteria 5214
66 Ga0075428_100002893 3300006844 Bacteria 18688
67 Ga0075428_100097307 3300006844 Bacteria 3209
68 Ga0075428_100158013 3300006844 Bacteria 2461
69 Ga0075430_100017320 3300006846 Bacteria 6136
70 Ga0075430_100022229 3300006846 Bacteria 5394
71 Ga0075431_100001317 3300006847 Bacteria 22711
72 Ga0075431_100011600 3300006847 Bacteria 8886
73 Ga0075431_100423331 3300006847 Bacteria 1331
74 Ga0075433_10099873 3300006852 Unclassified 2569
75 Ga0075434_100011060 3300006871 Bacteria 8490
76 Ga0075434_100025189 3300006871 Bacteria 5821
77 Ga0075429_100005884 3300006880 Bacteria 10584
78 Ga0068865_100094808 3300006881 Unclassified 2173
79 Ga0075435_100023122 3300007076 Unclassified 4801
80 Ga0111539_10009048 3300009094 Bacteria 12605
81 Ga0111539_10332539 3300009094 Bacteria 1768
82 Ga0105245_10044897 3300009098 Bacteria 3945
83 Ga0105245_10072758 3300009098 Bacteria 3124
84 Ga0105245_10197243 3300009098 Unclassified 1932
85 Ga0114129_10007692 3300009147 Bacteria 15336
86 Ga0114129_10255063 3300009147 Unclassified 2353
87 Ga0105243_10021380 3300009148 Bacteria 4910
88 Ga0105243_10137687 3300009148 Bacteria 2079
89 Ga0105241_10049822 3300009174 Bacteria 3191
90 Ga0105242_10041777 3300009176 Bacteria 3700
91 Ga0105249_10129819 3300009553 Bacteria 2404
92 Ga0105249_10156656 3300009553 Bacteria 2197
93 Ga0105249_10410245 3300009553 Bacteria 1386
94 Ga0157378_10089381 3300013297 Unclassified 2797
95 Ga0157375_10008758 3300013308 Bacteria 8865
96 Ga0163163_10030953 3300014325 Bacteria 5160
97 Ga0163163_10212978 3300014325 Bacteria 1981
98 Ga0157379_10015745 3300014968 Bacteria 6646
99 Ga0207647_10171467 3300025904 Bacteria 1263
100 Ga0207685_10002601 3300025905 Bacteria 4181
101 Ga0207685_10007330 3300025905 Unclassified 3069
102 Ga0207699_10012054 3300025906 Bacteria 4387
103 Ga0207705_10042096 3300025909 Bacteria 3279
104 Ga0207684_10052735 3300025910 Bacteria 3452
105 Ga0207684_10076155 3300025910 Bacteria 2851
106 Ga0207693_10000002 3300025915 Bacteria 304011
107 Ga0207693_10005796 3300025915 Bacteria 10247
108 Ga0207693_10011016 3300025915 Bacteria 7329
109 Ga0207693_10050514 3300025915 Unclassified 3266
110 Ga0207663_10008769 3300025916 Bacteria 5312
111 Ga0207646_10013649 3300025922 Bacteria 7758
112 Ga0207646_10189073 3300025922 Bacteria 1860
113 Ga0207646_10227499 3300025922 Unclassified 1685
114 Ga0207681_10065000 3300025923 Bacteria 2521
115 Ga0207687_10142688 3300025927 Unclassified 1819
116 Ga0207700_10005829 3300025928 Bacteria 7401
117 Ga0207700_10165610 3300025928 Bacteria 1839
118 Ga0207664_10070326 3300025929 Bacteria 2816
119 Ga0207664_10239978 3300025929 Bacteria 1578
120 Ga0207664_10532396 3300025929 Bacteria 1053
121 Ga0207686_10053582 3300025934 Bacteria 2523
122 Ga0207709_10023684 3300025935 Bacteria 3497
123 Ga0207665_10029647 3300025939 Unclassified 3616
124 Ga0207689_10039093 3300025942 Bacteria 3928
125 Ga0207689_10346607 3300025942 Bacteria 1234
126 Ga0207640_10138475 3300025981 Bacteria 1770
127 Ga0207677_10410886 3300026023 Unclassified 1150
128 Ga0207703_10353375 3300026035 Bacteria 1354
129 Ga0207708_10007086 3300026075 Bacteria 8282
130 Ga0207702_10049655 3300026078 Bacteria 3541
131 Ga0207702_10338677 3300026078 Bacteria 1436
132 Ga0207641_10147605 3300026088 Bacteria 2128
133 Ga0207648_10028177 3300026089 Bacteria 4981
134 Ga0207675_100005380 3300026118 Bacteria 12282
135 Ga0207683_10032281 3300026121 Bacteria 4549
136 Ga0207428_10009960 3300027907 Bacteria 8509
137 Ga0207428_10288473 3300027907 Bacteria 1217
138 Ga0268266_10006725 3300028379 Bacteria 10484
139 Ga0265327_10000504 3300031251 Bacteria 67749
140 Ga0307409_100374186 3300031995 Bacteria 1352
141 Ga0307415_100156434 3300032126 Bacteria 1761
142 Ga0373950_0002413 3300034818 Unclassified 2570
143 Ga0373938_0003735 3300034957 Unclassified 2508
144 Ga0373926_0000872 3300035083 Bacteria 8631
145 Ga0373926_0051840 3300035083 Bacteria 1481
146 Ga0373934_0011839 3300035086 Unclassified 3287
147 Ga0373944_0017199 3300035089 Bacteria 2049
148 Ga0373923_0027115 3300035111 Unclassified 2283
149 Ga0373936_0002777 3300035113 Bacteria 6525
150 Ga0373936_0004230 3300035113 Bacteria 5418
151 Ga0373945_0000112 3300035116 Bacteria 19634
152 Ga0373945_0016523 3300035116 Bacteria 2490
153 Ga0373953_0007127 3300035117 Unclassified 3728
154 Ga0373954_0009654 3300035118 Unclassified 4249
155 Ga0373956_0021939 3300035119 Bacteria 2728
156 Ga0373960_0004958 3300035121 Bacteria 3069
157 Ga0373943_0001270 3300035170 Bacteria 11289
158 Ga0373946_0002641 3300035171 Bacteria 6334
159 Ga0373946_0028207 3300035171 Bacteria 2226
160 Ga0373955_0009911 3300035172 Unclassified 4484
161 Ga0373955_0035028 3300035172 Bacteria 2656
162 Ga0373955_0048017 3300035172 Bacteria 2313
163 Ga0316574_0106969 3300035398 Bacteria 1792
164 Ga0373924_0014676 3300035410 Bacteria 2963
165 Ga0373931_0004015 3300035691 Bacteria 6664
166 Ga0373931_0057813 3300035691 Bacteria 2081
167 Ga0373935_0024275 3300035692 Bacteria 3731
168 Ga0373935_0051979 3300035692 Unclassified 2603
169 Ga0373935_0142835 3300035692 Bacteria 1618
170 Ga0373927_0014748 3300035695 Bacteria 5167
171 Ga0373927_0038521 3300035695 Unclassified 3103
172 Ga0373933_0004410 3300035724 Bacteria 7729
173 Ga0373933_0105308 3300035724 Bacteria 1754
174 Ga0373947_0002373 3300035725 Bacteria 11383
175 Ga0373947_0016010 3300035725 Bacteria 4309
176 Ga0373947_0021610 3300035725 Unclassified 3725
177 Ga0373947_0036314 3300035725 Bacteria 2922
178 Ga0373947_0225233 3300035725 Bacteria 1234
179 Ga0373937_0049864 3300036401 Unclassified 3833
180 Ga0373925_0012127 3300037068 Bacteria 6238
181 Ga0373925_0034251 3300037068 Unclassified 3742
182 Ga0373925_0046375 3300037068 Bacteria 3231
183 Ga0373925_0312575 3300037068 Bacteria 1270
184 Ga0395899_0002642 3300037312 Bacteria 14450
185 Ga0395899_0068354 3300037312 Bacteria 2605
186 Ga0395900_0002968 3300037418 Bacteria 18463
187 Ga0395900_0008772 3300037418 Bacteria 10389
188 Ga0395900_0066744 3300037418 Bacteria 3697
189 Ga0395898_0000458 3300037466 Bacteria 81883
190 Ga0395898_0004605 3300037466 Bacteria 15056
191 Ga0395898_0030518 3300037466 Bacteria 5394
192 Ga0395898_0097041 3300037466 Bacteria 2831
193 Ga0395898_0143420 3300037466 Bacteria 2286
194 Ga0395898_0215132 3300037466 Bacteria 1833
195 Ga0395905_0007184 3300037471 Bacteria 11121
196 Ga0395905_0113054 3300037471 Bacteria 2551
197 Ga0395905_0167986 3300037471 Bacteria 2061
198 Ga0395905_0305523 3300037471 Bacteria 1479
199 Ga0436364_1193945 3300037853 Bacteria 96789
200 Ga0395901_0003181 3300038443 Bacteria 16522
201 Ga0395901_0016280 3300038443 Bacteria 7573
202 Ga0395901_0095879 3300038443 Bacteria 3109
203 Ga0395901_0149616 3300038443 Bacteria 2453
204 Ga0395901_0464352 3300038443 Bacteria 1293
205 Ga0436365_0638406 3300039437 Bacteria 21788
206 Ga0436363_0202159 3300039450 Unclassified 924
207 Ga0436363_0975521 3300039450 Bacteria 1377
208 Ga0466969_0044926 3300044656 Bacteria 2194
209 Ga0466969_0063374 3300044656 Bacteria 1792
210 Ga0466969_0069689 3300044656 Bacteria 1693
211 Ga0466966_0083672 3300044684 Bacteria 1985
212 Ga0466961_0006197 3300044693 Bacteria 7593
213 Ga0466961_0008736 3300044693 Bacteria 6459
214 Ga0466963_0024230 3300044694 Bacteria 3863
215 Ga0466963_0105115 3300044694 Bacteria 1935
216 Ga0466963_0228863 3300044694 Bacteria 1303
217 Ga0466971_0029359 3300044719 Bacteria 2459
218 Ga0466971_0052736 3300044719 Bacteria 1832
219 Ga0466971_0129332 3300044719 Bacteria 1171
220 Ga0466970_0042189 3300044765 Bacteria 2426
221 Ga0466957_0275659 3300044842 Bacteria 1124
222 Ga0466960_0000063 3300044901 Bacteria 35457
223 Ga0466960_0035410 3300044901 Bacteria 2333
224 Ga0466959_0005250 3300045049 Bacteria 8845
225 Ga0466959_0011027 3300045049 Bacteria 6487
226 Ga0466959_0096463 3300045049 Bacteria 2120
227 Ga0466959_0200512 3300045049 Bacteria 1389
228 Ga0466958_0004145 3300045836 Bacteria 7608
229 Ga0466958_0007278 3300045836 Bacteria 6075
230 Ga0466958_0031618 3300045836 Bacteria 3147
231 Ga0466958_0196973 3300045836 Bacteria 1281
232 Ga0466958_0400218 3300045836 Bacteria 886
233 Ga0466967_0044098 3300045976 Bacteria 3866
234 Ga0466967_0172689 3300045976 Bacteria 2035
235 Ga0466967_0678058 3300045976 Bacteria 1020
236 Ga0495603_0004827 3300046455 Bacteria 8060
237 Ga0495603_0009104 3300046455 Bacteria 6003
238 Ga0495603_0015776 3300046455 Bacteria 4568
239 Ga0495603_0031056 3300046455 Bacteria 3216
240 Ga0495603_0158350 3300046455 Bacteria 1314
241 Ga0495603_0165626 3300046455 Bacteria 1281
242 Ga0495629_0011469 3300046459 Bacteria 6437
243 Ga0495629_0019250 3300046459 Bacteria 4879
244 Ga0495629_0043101 3300046459 Bacteria 3169
245 Ga0495629_0046484 3300046459 Unclassified 3044
246 Ga0495629_0051335 3300046459 Unclassified 2886
247 Ga0495641_0009721 3300046461 Bacteria 5680
248 Ga0495641_0016040 3300046461 Unclassified 3962
249 Ga0495641_0021059 3300046461 Unclassified 3289
250 Ga0495641_0036279 3300046461 Bacteria 2318
251 Ga0495641_0036369 3300046461 Bacteria 2314
252 Ga0495651_0100958 3300046462 Bacteria 2148
253 Ga0495651_0177351 3300046462 Bacteria 1511
254 Ga0495653_0004066 3300046463 Bacteria 11823
255 Ga0495653_0022005 3300046463 Bacteria 5159
256 Ga0495653_0030900 3300046463 Unclassified 4261
257 Ga0495650_0000063 3300046471 Bacteria 277841
258 Ga0495580_0016833 3300046472 Bacteria 5484
259 Ga0495580_0100846 3300046472 Unclassified 2008
260 Ga0495582_0000768 3300046473 Bacteria 17767
261 Ga0495582_0001103 3300046473 Bacteria 15148
262 Ga0495582_0002265 3300046473 Bacteria 10760
263 Ga0495582_0011332 3300046473 Unclassified 4912
264 Ga0495639_0000242 3300046475 Bacteria 27138
265 Ga0495639_0001095 3300046475 Bacteria 12209
266 Ga0495639_0036467 3300046475 Bacteria 2203
267 Ga0495639_0064012 3300046475 Bacteria 1689
268 Ga0495639_0103638 3300046475 Bacteria 1345
269 Ga0495662_0000818 3300046476 Bacteria 15111
270 Ga0495662_0002462 3300046476 Bacteria 9320
271 Ga0495662_0026153 3300046476 Unclassified 2818
272 Ga0495664_0005843 3300046477 Bacteria 6772
273 Ga0495584_0045852 3300046491 Bacteria 2205
274 Ga0495594_0017111 3300046499 Bacteria 3826
275 Ga0495596_0083422 3300046500 Bacteria 1241
276 Ga0495608_0008690 3300046511 Bacteria 7106
277 Ga0495608_0012701 3300046511 Bacteria 5843
278 Ga0495608_0013436 3300046511 Bacteria 5678
279 Ga0495618_0026006 3300046514 Bacteria 3635
280 Ga0495618_0056026 3300046514 Bacteria 2496
281 Ga0495630_0016519 3300046517 Bacteria 5395
282 Ga0495630_0021380 3300046517 Bacteria 4778
283 Ga0495630_0058183 3300046517 Unclassified 2897
284 Ga0495630_0068642 3300046517 Bacteria 2666
285 Ga0495630_0070879 3300046517 Bacteria 2622
286 Ga0495630_0121237 3300046517 Bacteria 1984
287 Ga0495644_0005301 3300046523 Bacteria 5035
288 Ga0495666_0003236 3300046526 Bacteria 8208
289 Ga0495666_0022177 3300046526 Unclassified 3144
290 Ga0495652_0132714 3300046529 Bacteria 1969
291 Ga0495665_0000298 3300046531 Bacteria 24966
292 Ga0495665_0005817 3300046531 Bacteria 6653
293 Ga0495665_0020923 3300046531 Bacteria 3515
294 Ga0495665_0036389 3300046531 Bacteria 2628
295 Ga0495640_0007841 3300046533 Bacteria 8397
296 Ga0495640_0016507 3300046533 Bacteria 5521
297 Ga0495586_0006254 3300046535 Bacteria 6363
298 Ga0495586_0023815 3300046535 Bacteria 3270
299 Ga0495587_0002212 3300046536 Bacteria 13004
300 Ga0495587_0074431 3300046536 Bacteria 1972
301 Ga0495598_0001916 3300046537 Bacteria 4213
302 Ga0495621_0016844 3300046539 Bacteria 2353
303 Ga0495645_0026157 3300046543 Bacteria 4235
304 Ga0495645_0165156 3300046543 Bacteria 1527
305 Ga0495667_0009370 3300046559 Bacteria 6630
306 Ga0495667_0171643 3300046559 Bacteria 1393
307 Ga0495634_0001272 3300046642 Bacteria 23126
308 Ga0495634_0033104 3300046642 Bacteria 3552
309 Ga0495634_0042953 3300046642 Unclassified 3065
310 Ga0495634_0337925 3300046642 Unclassified 904
311 Ga0495635_0002276 3300046663 Bacteria 13060
312 Ga0495635_0014325 3300046663 Bacteria 5547
313 Ga0495635_0122352 3300046663 Bacteria 1774
314 Ga0495635_0164357 3300046663 Bacteria 1510
315 Ga0495659_0000928 3300046664 Bacteria 10401
316 Ga0495588_0004357 3300046674 Bacteria 6251
317 Ga0495588_0080501 3300046674 Bacteria 1700
318 Ga0495588_0099490 3300046674 Bacteria 1527
319 Ga0495657_0007904 3300046675 Bacteria 8161
320 Ga0495657_0017718 3300046675 Bacteria 5167
321 Ga0495657_0046539 3300046675 Bacteria 2936
322 Ga0495599_0101242 3300046678 Bacteria 1795
323 Ga0495623_0016452 3300046679 Bacteria 4778
324 Ga0495646_0013296 3300046680 Bacteria 5230
325 Ga0495646_0095761 3300046680 Bacteria 1707
326 Ga0495647_0001135 3300046681 Bacteria 8165
327 Ga0495647_0011866 3300046681 Bacteria 2990
328 Ga0495647_0045253 3300046681 Bacteria 1690
329 Ga0495658_0000754 3300046683 Bacteria 17473
330 Ga0495658_0001710 3300046683 Bacteria 11416
331 Ga0495658_0008493 3300046683 Bacteria 5090
332 Ga0495613_0007291 3300046689 Bacteria 8234
333 Ga0495613_0022333 3300046689 Unclassified 4715
334 Ga0495624_0005591 3300046690 Bacteria 9039
335 Ga0495624_0013618 3300046690 Bacteria 5541
336 Ga0495624_0136628 3300046690 Bacteria 1502
337 Ga0495589_0061286 3300046794 Bacteria 1847
338 Ga0495600_0007423 3300046809 Bacteria 6707
339 Ga0495581_0008774 3300047315 Bacteria 5851
340 Ga0495581_0009073 3300047315 Bacteria 5752
341 Ga0495581_0016120 3300047315 Bacteria 4343
342 Ga0495604_0009402 3300047317 Bacteria 7731
343 Ga0495674_0002908 3300047319 Bacteria 16664
344 Ga0495674_0005781 3300047319 Bacteria 11859
345 Ga0495674_0061276 3300047319 Bacteria 3280
346 Ga0495674_0096087 3300047319 Bacteria 2526
347 Ga0495674_0186160 3300047319 Bacteria 1727
348 Ga0495676_0019239 3300047321 Bacteria 6008
349 Ga0495676_0022846 3300047321 Bacteria 5435
350 Ga0495676_0024235 3300047321 Bacteria 5256
351 Ga0495676_0051199 3300047321 Bacteria 3306
352 Ga0495676_0064587 3300047321 Bacteria 2845
353 Ga0495680_0029628 3300047322 Unclassified 4480
354 Ga0495680_0040150 3300047322 Bacteria 3729
355 Ga0495680_0043179 3300047322 Bacteria 3571
356 Ga0495675_0066567 3300047444 Bacteria 2277
357 Ga0495684_0007847 3300047471 Bacteria 8259
358 Ga0495684_0057886 3300047471 Bacteria 2953
359 Ga0495684_0188771 3300047471 Unclassified 1525
360 Ga0495684_0225424 3300047471 Bacteria 1372
361 Ga0495593_0000418 3300047673 Bacteria 23660
362 Ga0495593_0004903 3300047673 Bacteria 7937
363 Ga0495593_0014905 3300047673 Unclassified 4415
364 Ga0495602_0032497 3300048088 Bacteria 4911
365 Ga0495602_0054783 3300048088 Unclassified 3517
366 Ga0495614_0002284 3300048089 Bacteria 8515
367 Ga0495614_0014252 3300048089 Unclassified 3483
368 Ga0495614_0019389 3300048089 Bacteria 2942
369 Ga0496101_0085299 3300048904 Bacteria 2340
370 Ga0496101_0109126 3300048904 Bacteria 2081
371 Ga0496101_0164469 3300048904 Bacteria 1703
372 Ga0496101_0173078 3300048904 Bacteria 1660
373 Ga0496102_0340379 3300048905 Bacteria 1413
374 Ga0496102_0417446 3300048905 Bacteria 1260
375 Ga0496103_0202473 3300048906 Bacteria 1277
376 Ga0496104_0011647 3300048907 Bacteria 7883
377 Ga0496104_0100173 3300048907 Bacteria 2773
378 Ga0496104_0148921 3300048907 Bacteria 2247
379 Ga0496104_0535751 3300048907 Bacteria 1082
380 Ga0496105_0001910 3300048908 Bacteria 14963
381 Ga0496105_0011313 3300048908 Bacteria 7046
382 Ga0496105_0018108 3300048908 Bacteria 5654
383 Ga0496105_0093668 3300048908 Bacteria 2481
384 Ga0496105_0287214 3300048908 Bacteria 1325
385 Ga0496105_0308087 3300048908 Bacteria 1272
386 Ga0496106_0039616 3300048909 Bacteria 3529
387 Ga0496106_0095671 3300048909 Bacteria 2298
388 Ga0496107_0005629 3300048910 Bacteria 8582
389 Ga0496107_0083840 3300048910 Bacteria 2325
390 Ga0496108_0001374 3300048911 Bacteria 19147
391 Ga0496108_0041005 3300048911 Unclassified 3862
392 Ga0496108_0049141 3300048911 Bacteria 3528
393 Ga0496108_0123434 3300048911 Bacteria 2222
394 Ga0496108_0126408 3300048911 Bacteria 2195
395 Ga0496109_0019877 3300048912 Bacteria 5928
396 Ga0496109_0029488 3300048912 Bacteria 4914
397 Ga0496109_0040478 3300048912 Bacteria 4222
398 Ga0496109_0156724 3300048912 Bacteria 2133
399 Ga0496109_0205190 3300048912 Unclassified 1853
400 Ga0496110_0035137 3300048913 Bacteria 4346
401 Ga0496110_0047825 3300048913 Bacteria 3747
402 Ga0496110_0620577 3300048913 Bacteria 980
403 Ga0496111_0012947 3300048914 Bacteria 5661
404 Ga0496112_0001654 3300048915 Bacteria 17322
405 Ga0496112_0008431 3300048915 Bacteria 9230
406 Ga0496112_0010109 3300048915 Bacteria 8544
407 Ga0496112_0021139 3300048915 Bacteria 6183
408 Ga0496112_0035354 3300048915 Bacteria 4867
409 Ga0496112_0058333 3300048915 Bacteria 3801
410 Ga0496112_0185971 3300048915 Bacteria 2041
411 Ga0496112_0289194 3300048915 Unclassified 1585
412 Ga0496113_0010477 3300048916 Bacteria 6128
413 Ga0496113_0011235 3300048916 Bacteria 5963
414 Ga0496113_0064248 3300048916 Bacteria 2775
415 Ga0496114_0047449 3300048917 Bacteria 3573
416 Ga0496114_0073141 3300048917 Bacteria 2884
417 Ga0496115_0070404 3300048918 Unclassified 2835
418 Ga0496115_0231637 3300048918 Bacteria 1523
419 Ga0501031_0002247 3300049568 Bacteria 12225
420 Ga0501032_0001363 3300049569 Bacteria 19386
421 Ga0501033_0010333 3300049570 Bacteria 7166
422 Ga0501034_0005162 3300049571 Bacteria 14319
423 Ga0501034_0034171 3300049571 Bacteria 5155
424 Ga0501036_0017420 3300049572 Bacteria 6005
425 Ga0501037_0012002 3300049573 Bacteria 6382
426 Ga0501038_0021850 3300049574 Bacteria 5738
427 Ga0501039_0356261 3300049575 Bacteria 1149
428 Ga0501040_0023869 3300049576 Bacteria 4101
429 Ga0501041_0016877 3300049577 Bacteria 4344
430 Ga0501042_0010992 3300049578 Bacteria 6093
431 Ga0501043_0133349 3300049579 Bacteria 1946
432 Ga0501046_0117139 3300049580 Bacteria 2029
433 Ga0501047_0016639 3300049581 Bacteria 7022
434 Ga0501048_0026263 3300049582 Bacteria 4239
435 Ga0501068_0004052 3300049584 Bacteria 7964
436 Ga0501069_0000448 3300049585 Bacteria 18772
437 Ga0501070_0005546 3300049586 Bacteria 10759
438 Ga0501072_0013707 3300049588 Bacteria 6206
439 Ga0501073_0001493 3300049589 Bacteria 17313
440 Ga0501074_0007757 3300049590 Bacteria 7770
441 Ga0501075_0100669 3300049591 Bacteria 2194
442 Ga0501076_0020115 3300049592 Bacteria 5107
443 Ga0501077_0033789 3300049593 Bacteria 3255
444 Ga0501079_0035334 3300049741 Bacteria 3846
445 Ga0501080_0025846 3300049742 Bacteria 5454
446 Ga0501080_0043187 3300049742 Bacteria 4197
447 Ga0501081_0004225 3300049743 Bacteria 9200
448 Ga0501083_0012963 3300049744 Bacteria 5824
449 Ga0501035_0008910 3300049822 Bacteria 9337
450 Ga0501044_0004610 3300049823 Bacteria 15417
451 Ga0501045_0010326 3300049824 Bacteria 6541
452 nmdc:mga05p37_6532_c1 3300050507 Bacteria 13753
453 nmdc:mga05p37_734191_c1 3300050507 Unclassified 1091
454 nmdc:mga09592_473_c1 3300050508 Bacteria 30066
455 nmdc:mga0qj67_4230_c1 3300050509 Bacteria 10402
456 nmdc:mga0qj67_6492_c1 3300050509 Bacteria 8595
457 nmdc:mga06r32_1253_c1 3300050510 Bacteria 22855
458 nmdc:mga06r32_140024_c1 3300050510 Bacteria 2395
459 nmdc:mga06r32_16231_c1 3300050510 Bacteria 6783
460 nmdc:mga06r32_70805_c1 3300050510 Bacteria 3374
461 nmdc:mga08y16_14355_c1 3300050511 Bacteria 8338
462 nmdc:mga0n895_29500_c1 3300050512 Bacteria 5234
463 nmdc:mga0rr50_92247_c1 3300050513 Unclassified 2361
464 nmdc:mga0a205_113045_c1 3300050515 Unclassified 2614
465 Ga0495601_0014987 3300053077 Unclassified 4681
466 Ga0495612_0004984 3300053078 Bacteria 5496
467 Ga0495595_0009688 3300053084 Bacteria 3989
468 Ga0495619_0008692 3300053085 Bacteria 6423
469 Ga0495619_0048289 3300053085 Unclassified 2804
470 Ga0495619_0048712 3300053085 Bacteria 2792
471 Ga0495619_0062468 3300053085 Bacteria 2479
472 Ga0495619_0075249 3300053085 Bacteria 2266
473 Ga0500568_0000032 3300053139 Bacteria 147655
474 Ga0500616_0002462 3300053153 Bacteria 15361
475 Ga0500616_0020042 3300053153 Bacteria 3760
476 Ga0501084_0017985 3300054114 Bacteria 5885
477 Ga0501082_0007617 3300060353 Bacteria 9337
478 Ga0466962_0000467 3300061719 Bacteria 17555
479 Ga0530510_0106054 3300061734 Bacteria 2056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0400218 Ga0466958_0400218_37_870 269
2 3300039450 Ga0436363_0202159 Ga0436363_0202159_17_895 270
3 3300037068 Ga0373925_0312575 Ga0373925_0312575_12_839 272
4 3300025942 Ga0207689_10346607 Ga0207689_103466072 274
5 3300046642 Ga0495634_0337925 Ga0495634_0337925_17_871 281
6 3300025981 Ga0207640_10138475 Ga0207640_101384752 287
7 3300049575 Ga0501039_0356261 Ga0501039_0356261_256_1131 289
8 3300037466 Ga0395898_0215132 Ga0395898_0215132_56_973 292
9 3300045049 Ga0466959_0011027 Ga0466959_0011027_4593_5525 293
10 3300044719 Ga0466971_0052736 Ga0466971_0052736_876_1811 294
11 3300045976 Ga0466967_0044098 Ga0466967_0044098_1723_2670 294
12 3300005983 Ga0081540_1000409 Ga0081540_10004098 297
13 3300005436 Ga0070713_100245711 Ga0070713_1002457112 298
14 3300006028 Ga0070717_10400671 Ga0070717_104006711 298
15 3300009098 Ga0105245_10072758 Ga0105245_100727584 298
16 3300025928 Ga0207700_10165610 Ga0207700_101656102 298
17 3300046543 Ga0495645_0026157 Ga0495645_0026157_537_1481 299
18 3300046680 Ga0495646_0013296 Ga0495646_0013296_2003_3025 299
19 3300035724 Ga0373933_0004410 Ga0373933_0004410_3760_4782 300
20 3300046514 Ga0495618_0026006 Ga0495618_0026006_2298_3320 300
21 3300046543 Ga0495645_0165156 Ga0495645_0165156_133_1155 300
22 3300053077 Ga0495601_0014987 Ga0495601_0014987_1578_2600 300
23 3300046476 Ga0495662_0026153 Ga0495662_0026153_1273_2295 301
24 3300037853 Ga0436364_1193945 Ga0436364_1193945_56809_57744 303
25 3300048913 Ga0496110_0620577 Ga0496110_0620577_15_950 303
26 3300005937 Ga0081455_10007587 Ga0081455_100075875 304
27 3300006847 Ga0075431_100423331 Ga0075431_1004233312 304
28 3300044684 Ga0466966_0083672 Ga0466966_0083672_12_950 304
29 3300045836 Ga0466958_0007278 Ga0466958_0007278_3087_4025 304
30 3300046529 Ga0495652_0132714 Ga0495652_0132714_151_1140 304
31 3300050510 nmdc:mga06r32_140024_c1 nmdc:mga06r32_140024_c1_836_1822 304
32 3300009174 Ga0105241_10049822 Ga0105241_100498224 305
33 3300025905 Ga0207685_10007330 Ga0207685_100073302 305
34 3300025915 Ga0207693_10050514 Ga0207693_100505142 305
35 3300025916 Ga0207663_10008769 Ga0207663_100087693 305
36 3300025923 Ga0207681_10065000 Ga0207681_100650002 305
37 3300025928 Ga0207700_10005829 Ga0207700_100058296 305
38 3300025929 Ga0207664_10532396 Ga0207664_105323961 305
39 3300025939 Ga0207665_10029647 Ga0207665_100296472 305
40 3300026078 Ga0207702_10338677 Ga0207702_103386772 305
41 3300026088 Ga0207641_10147605 Ga0207641_101476052 305
42 3300034818 Ga0373950_0002413 Ga0373950_0002413_699_1721 305
43 3300034957 Ga0373938_0003735 Ga0373938_0003735_796_1818 305
44 3300035121 Ga0373960_0004958 Ga0373960_0004958_1966_2988 305
45 3300035691 Ga0373931_0004015 Ga0373931_0004015_4102_5124 305
46 3300039437 Ga0436365_0638406 Ga0436365_0638406_16250_17215 305
47 3300048911 Ga0496108_0041005 Ga0496108_0041005_1249_2271 305
48 3300048912 Ga0496109_0205190 Ga0496109_0205190_691_1713 305
49 3300048916 Ga0496113_0011235 Ga0496113_0011235_71_1093 305
50 3300048918 Ga0496115_0070404 Ga0496115_0070404_485_1507 305
51 3300005937 Ga0081455_10009285 Ga0081455_100092859 306
52 3300035398 Ga0316574_0106969 Ga0316574_0106969_769_1710 310
53 3300037466 Ga0395898_0000458 Ga0395898_0000458_43085_44059 310
54 3300006844 Ga0075428_100158013 Ga0075428_1001580132 312
55 3300037312 Ga0395899_0002642 Ga0395899_0002642_13187_14215 312
56 3300037418 Ga0395900_0008772 Ga0395900_0008772_8212_9240 312
57 3300037466 Ga0395898_0143420 Ga0395898_0143420_341_1369 312
58 3300037471 Ga0395905_0007184 Ga0395905_0007184_2014_3042 312
59 3300044694 Ga0466963_0105115 Ga0466963_0105115_288_1271 312
60 3300044719 Ga0466971_0129332 Ga0466971_0129332_34_1017 312
61 3300044842 Ga0466957_0275659 Ga0466957_0275659_13_996 312
62 3300045836 Ga0466958_0196973 Ga0466958_0196973_164_1147 312
63 3300046491 Ga0495584_0045852 Ga0495584_0045852_109_1080 312
64 3300046523 Ga0495644_0005301 Ga0495644_0005301_2133_3104 312
65 3300046537 Ga0495598_0001916 Ga0495598_0001916_2466_3437 312
66 3300046664 Ga0495659_0000928 Ga0495659_0000928_4099_5070 312
67 3300046794 Ga0495589_0061286 Ga0495589_0061286_657_1628 312
68 3300005536 Ga0070697_100004169 Ga0070697_1000041694 313
69 3300006175 Ga0070712_100000001 Ga0070712_10000000130 314
70 3300025915 Ga0207693_10000002 Ga0207693_1000000252 314
71 3300037466 Ga0395898_0004605 Ga0395898_0004605_6296_7264 314
72 3300037471 Ga0395905_0305523 Ga0395905_0305523_127_1158 314
73 3300038443 Ga0395901_0003181 Ga0395901_0003181_8678_9646 314
74 3300044901 Ga0466960_0035410 Ga0466960_0035410_456_1424 314
75 3300046674 Ga0495588_0080501 Ga0495588_0080501_550_1515 314
76 3300048907 Ga0496104_0011647 Ga0496104_0011647_6114_7082 314
77 3300048908 Ga0496105_0001910 Ga0496105_0001910_261_1229 314
78 3300048915 Ga0496112_0001654 Ga0496112_0001654_15744_16712 314
79 3300048915 Ga0496112_0185971 Ga0496112_0185971_228_1196 314
80 3300049742 Ga0501080_0043187 Ga0501080_0043187_3181_4149 314
81 3300014325 Ga0163163_10030953 Ga0163163_100309534 315
82 3300032126 Ga0307415_100156434 Ga0307415_1001564343 315
83 3300038443 Ga0395901_0464352 Ga0395901_0464352_52_1029 315
84 3300046517 Ga0495630_0068642 Ga0495630_0068642_949_1920 315
85 3300048912 Ga0496109_0040478 Ga0496109_0040478_349_1320 315
86 3300048915 Ga0496112_0010109 Ga0496112_0010109_7331_8302 315
87 3300053085 Ga0495619_0075249 Ga0495619_0075249_445_1416 315
88 3300005434 Ga0070709_10034704 Ga0070709_100347042 316
89 3300005439 Ga0070711_100145725 Ga0070711_1001457252 316
90 3300005578 Ga0068854_100100962 Ga0068854_1001009623 316
91 3300005614 Ga0068856_100025439 Ga0068856_1000254394 316
92 3300005985 Ga0081539_10003206 Ga0081539_1000320616 316
93 3300006175 Ga0070712_100004217 Ga0070712_1000042172 316
94 3300025906 Ga0207699_10012054 Ga0207699_100120543 316
95 3300025915 Ga0207693_10005796 Ga0207693_100057968 316
96 3300026078 Ga0207702_10049655 Ga0207702_100496553 316
97 3300031995 Ga0307409_100374186 Ga0307409_1003741862 316
98 3300035725 Ga0373947_0016010 Ga0373947_0016010_2657_3631 316
99 3300044656 Ga0466969_0044926 Ga0466969_0044926_843_1817 316
100 3300044656 Ga0466969_0069689 Ga0466969_0069689_485_1459 316
101 3300044693 Ga0466961_0008736 Ga0466961_0008736_1078_2052 316
102 3300044694 Ga0466963_0024230 Ga0466963_0024230_101_1075 316
103 3300044719 Ga0466971_0029359 Ga0466971_0029359_579_1553 316
104 3300044765 Ga0466970_0042189 Ga0466970_0042189_113_1087 316
105 3300045049 Ga0466959_0005250 Ga0466959_0005250_2092_3066 316
106 3300045836 Ga0466958_0004145 Ga0466958_0004145_1888_2862 316
107 3300046455 Ga0495603_0165626 Ga0495603_0165626_273_1247 316
108 3300046461 Ga0495641_0036279 Ga0495641_0036279_701_1675 316
109 3300046675 Ga0495657_0007904 Ga0495657_0007904_4939_5961 316
110 3300047321 Ga0495676_0064587 Ga0495676_0064587_83_1057 316
111 3300048904 Ga0496101_0085299 Ga0496101_0085299_888_1862 316
112 3300048905 Ga0496102_0340379 Ga0496102_0340379_71_1045 316
113 3300048907 Ga0496104_0100173 Ga0496104_0100173_1262_2236 316
114 3300048908 Ga0496105_0018108 Ga0496105_0018108_848_1822 316
115 3300048908 Ga0496105_0093668 Ga0496105_0093668_173_1147 316
116 3300048909 Ga0496106_0039616 Ga0496106_0039616_163_1137 316
117 3300048911 Ga0496108_0001374 Ga0496108_0001374_3311_4285 316
118 3300048911 Ga0496108_0049141 Ga0496108_0049141_870_1844 316
119 3300048912 Ga0496109_0029488 Ga0496109_0029488_2926_3900 316
120 3300048912 Ga0496109_0156724 Ga0496109_0156724_791_1765 316
121 3300048913 Ga0496110_0035137 Ga0496110_0035137_2283_3257 316
122 3300048914 Ga0496111_0012947 Ga0496111_0012947_3125_4099 316
123 3300048915 Ga0496112_0035354 Ga0496112_0035354_1799_2773 316
124 3300048915 Ga0496112_0058333 Ga0496112_0058333_862_1836 316
125 3300048916 Ga0496113_0010477 Ga0496113_0010477_3181_4155 316
126 3300048917 Ga0496114_0047449 Ga0496114_0047449_2224_3198 316
127 3300061719 Ga0466962_0000467 Ga0466962_0000467_9104_10078 316
128 3300005445 Ga0070708_100030136 Ga0070708_1000301363 317
129 3300005455 Ga0070663_100067829 Ga0070663_1000678293 317
130 3300005467 Ga0070706_100081479 Ga0070706_1000814792 317
131 3300005468 Ga0070707_100012169 Ga0070707_1000121693 317
132 3300005471 Ga0070698_100003283 Ga0070698_10000328319 317
133 3300005471 Ga0070698_100063451 Ga0070698_1000634512 317
134 3300005548 Ga0070665_100002426 Ga0070665_10000242610 317
135 3300005985 Ga0081539_10003573 Ga0081539_1000357312 317
136 3300005985 Ga0081539_10005020 Ga0081539_100050204 317
137 3300006028 Ga0070717_10329608 Ga0070717_103296083 317
138 3300009098 Ga0105245_10044897 Ga0105245_100448973 317
139 3300009553 Ga0105249_10129819 Ga0105249_101298193 317
140 3300026035 Ga0207703_10353375 Ga0207703_103533752 317
141 3300028379 Ga0268266_10006725 Ga0268266_1000672510 317
142 3300037418 Ga0395900_0002968 Ga0395900_0002968_183_1187 317
143 3300044694 Ga0466963_0228863 Ga0466963_0228863_147_1124 317
144 3300045976 Ga0466967_0172689 Ga0466967_0172689_237_1226 317
145 3300045976 Ga0466967_0678058 Ga0466967_0678058_16_993 317
146 3300048904 Ga0496101_0164469 Ga0496101_0164469_196_1176 317
147 3300048905 Ga0496102_0417446 Ga0496102_0417446_116_1096 317
148 3300048906 Ga0496103_0202473 Ga0496103_0202473_119_1099 317
149 3300048907 Ga0496104_0535751 Ga0496104_0535751_80_1060 317
150 3300048908 Ga0496105_0308087 Ga0496105_0308087_235_1215 317
151 3300048911 Ga0496108_0126408 Ga0496108_0126408_79_1059 317
152 3300048915 Ga0496112_0021139 Ga0496112_0021139_876_1856 317
153 3300005435 Ga0070714_100037632 Ga0070714_1000376322 318
154 3300005436 Ga0070713_100050180 Ga0070713_1000501803 318
155 3300025929 Ga0207664_10070326 Ga0207664_100703263 318
156 3300035172 Ga0373955_0035028 Ga0373955_0035028_680_1660 318
157 3300046462 Ga0495651_0177351 Ga0495651_0177351_295_1275 318
158 3300046463 Ga0495653_0022005 Ga0495653_0022005_3093_4073 318
159 3300046511 Ga0495608_0013436 Ga0495608_0013436_2253_3233 318
160 3300046517 Ga0495630_0121237 Ga0495630_0121237_243_1223 318
161 3300046539 Ga0495621_0016844 Ga0495621_0016844_466_1437 318
162 3300046559 Ga0495667_0171643 Ga0495667_0171643_257_1237 318
163 3300046675 Ga0495657_0046539 Ga0495657_0046539_46_1026 318
164 3300047319 Ga0495674_0061276 Ga0495674_0061276_1254_2234 318
165 3300047322 Ga0495680_0043179 Ga0495680_0043179_2446_3426 318
166 3300047471 Ga0495684_0057886 Ga0495684_0057886_1731_2711 318
167 3300048088 Ga0495602_0032497 Ga0495602_0032497_3016_3996 318
168 3300048907 Ga0496104_0148921 Ga0496104_0148921_155_1135 318
169 3300048908 Ga0496105_0011313 Ga0496105_0011313_1532_2512 318
170 3300048908 Ga0496105_0287214 Ga0496105_0287214_74_1054 318
171 3300048911 Ga0496108_0123434 Ga0496108_0123434_567_1547 318
172 3300048915 Ga0496112_0008431 Ga0496112_0008431_4849_5829 318
173 3300048916 Ga0496113_0064248 Ga0496113_0064248_1781_2761 318
174 3300048918 Ga0496115_0231637 Ga0496115_0231637_462_1442 318
175 3300053085 Ga0495619_0008692 Ga0495619_0008692_1753_2733 318
176 3300005327 Ga0070658_10054763 Ga0070658_100547634 319
177 3300005345 Ga0070692_10066243 Ga0070692_100662433 319
178 3300005355 Ga0070671_100128448 Ga0070671_1001284483 319
179 3300005364 Ga0070673_100247245 Ga0070673_1002472452 319
180 3300005456 Ga0070678_100090747 Ga0070678_1000907472 319
181 3300005459 Ga0068867_100095699 Ga0068867_1000956992 319
182 3300005544 Ga0070686_100014919 Ga0070686_1000149192 319
183 3300005841 Ga0068863_100309110 Ga0068863_1003091102 319
184 3300006028 Ga0070717_10006903 Ga0070717_100069033 319
185 3300006051 Ga0075364_10036114 Ga0075364_100361143 319
186 3300006881 Ga0068865_100094808 Ga0068865_1000948083 319
187 3300009148 Ga0105243_10137687 Ga0105243_101376873 319
188 3300009176 Ga0105242_10041777 Ga0105242_100417772 319
189 3300013297 Ga0157378_10089381 Ga0157378_100893813 319
190 3300013308 Ga0157375_10008758 Ga0157375_100087582 319
191 3300025909 Ga0207705_10042096 Ga0207705_100420963 319
192 3300025929 Ga0207664_10239978 Ga0207664_102399782 319
193 3300025934 Ga0207686_10053582 Ga0207686_100535823 319
194 3300025935 Ga0207709_10023684 Ga0207709_100236844 319
195 3300026023 Ga0207677_10410886 Ga0207677_104108862 319
196 3300026089 Ga0207648_10028177 Ga0207648_100281772 319
197 3300026121 Ga0207683_10032281 Ga0207683_100322813 319
198 3300035083 Ga0373926_0051840 Ga0373926_0051840_63_1100 319
199 3300035089 Ga0373944_0017199 Ga0373944_0017199_763_1800 319
200 3300035113 Ga0373936_0004230 Ga0373936_0004230_1097_2134 319
201 3300035116 Ga0373945_0016523 Ga0373945_0016523_669_1706 319
202 3300035170 Ga0373943_0001270 Ga0373943_0001270_6238_7275 319
203 3300035171 Ga0373946_0028207 Ga0373946_0028207_737_1774 319
204 3300035172 Ga0373955_0048017 Ga0373955_0048017_1039_2076 319
205 3300035410 Ga0373924_0014676 Ga0373924_0014676_950_1987 319
206 3300035692 Ga0373935_0024275 Ga0373935_0024275_1375_2412 319
207 3300035695 Ga0373927_0014748 Ga0373927_0014748_1373_2410 319
208 3300035725 Ga0373947_0002373 Ga0373947_0002373_7841_8878 319
209 3300037068 Ga0373925_0012127 Ga0373925_0012127_1076_2113 319
210 3300044901 Ga0466960_0000063 Ga0466960_0000063_370_1437 319
211 3300045049 Ga0466959_0096463 Ga0466959_0096463_323_1312 319
212 3300045836 Ga0466958_0031618 Ga0466958_0031618_239_1222 319
213 3300046455 Ga0495603_0015776 Ga0495603_0015776_1408_2445 319
214 3300046459 Ga0495629_0011469 Ga0495629_0011469_3471_4508 319
215 3300046461 Ga0495641_0009721 Ga0495641_0009721_1779_2816 319
216 3300046462 Ga0495651_0100958 Ga0495651_0100958_638_1675 319
217 3300046463 Ga0495653_0004066 Ga0495653_0004066_7870_8907 319
218 3300046472 Ga0495580_0016833 Ga0495580_0016833_1978_3015 319
219 3300046473 Ga0495582_0001103 Ga0495582_0001103_3038_4075 319
220 3300046475 Ga0495639_0001095 Ga0495639_0001095_8152_9189 319
221 3300046476 Ga0495662_0002462 Ga0495662_0002462_2878_3915 319
222 3300046499 Ga0495594_0017111 Ga0495594_0017111_1916_2953 319
223 3300046500 Ga0495596_0083422 Ga0495596_0083422_87_1067 319
224 3300046511 Ga0495608_0012701 Ga0495608_0012701_1950_2987 319
225 3300046514 Ga0495618_0056026 Ga0495618_0056026_550_1587 319
226 3300046517 Ga0495630_0016519 Ga0495630_0016519_1146_2183 319
227 3300046526 Ga0495666_0003236 Ga0495666_0003236_4941_5978 319
228 3300046531 Ga0495665_0005817 Ga0495665_0005817_1499_2536 319
229 3300046533 Ga0495640_0016507 Ga0495640_0016507_1438_2475 319
230 3300046535 Ga0495586_0023815 Ga0495586_0023815_1073_2110 319
231 3300046536 Ga0495587_0074431 Ga0495587_0074431_576_1613 319
232 3300046559 Ga0495667_0009370 Ga0495667_0009370_2152_3189 319
233 3300046642 Ga0495634_0033104 Ga0495634_0033104_1372_2409 319
234 3300046663 Ga0495635_0014325 Ga0495635_0014325_2478_3515 319
235 3300046674 Ga0495588_0099490 Ga0495588_0099490_15_1052 319
236 3300046675 Ga0495657_0017718 Ga0495657_0017718_946_1983 319
237 3300046681 Ga0495647_0011866 Ga0495647_0011866_827_1864 319
238 3300046683 Ga0495658_0008493 Ga0495658_0008493_3425_4462 319
239 3300046689 Ga0495613_0007291 Ga0495613_0007291_4025_5062 319
240 3300046690 Ga0495624_0005591 Ga0495624_0005591_6224_7261 319
241 3300046809 Ga0495600_0007423 Ga0495600_0007423_2482_3519 319
242 3300047315 Ga0495581_0016120 Ga0495581_0016120_3212_4249 319
243 3300047319 Ga0495674_0002908 Ga0495674_0002908_4825_5862 319
244 3300047321 Ga0495676_0019239 Ga0495676_0019239_1380_2417 319
245 3300047322 Ga0495680_0040150 Ga0495680_0040150_475_1512 319
246 3300047444 Ga0495675_0066567 Ga0495675_0066567_837_1874 319
247 3300047471 Ga0495684_0007847 Ga0495684_0007847_4825_5862 319
248 3300047673 Ga0495593_0004903 Ga0495593_0004903_3470_4507 319
249 3300048089 Ga0495614_0002284 Ga0495614_0002284_5332_6369 319
250 3300048910 Ga0496107_0005629 Ga0496107_0005629_7325_8293 319
251 3300048913 Ga0496110_0047825 Ga0496110_0047825_1027_1995 319
252 3300048915 Ga0496112_0289194 Ga0496112_0289194_432_1400 319
253 3300048917 Ga0496114_0073141 Ga0496114_0073141_486_1454 319
254 3300053084 Ga0495595_0009688 Ga0495595_0009688_1003_2040 319
255 3300005937 Ga0081455_10001816 Ga0081455_1000181614 320
256 3300039450 Ga0436363_0975521 Ga0436363_0975521_37_1053 320
257 3300044656 Ga0466969_0063374 Ga0466969_0063374_175_1170 320
258 3300044693 Ga0466961_0006197 Ga0466961_0006197_5089_6084 320
259 3300045049 Ga0466959_0200512 Ga0466959_0200512_163_1158 320
260 3300048912 Ga0496109_0019877 Ga0496109_0019877_1553_2629 320
261 3300006844 Ga0075428_100097307 Ga0075428_1000973072 321
262 3300006846 Ga0075430_100017320 Ga0075430_1000173206 321
263 3300035119 Ga0373956_0021939 Ga0373956_0021939_1713_2717 321
264 3300005468 Ga0070707_100000368 Ga0070707_10000036812 322
265 3300005468 Ga0070707_100023285 Ga0070707_1000232856 322
266 3300006028 Ga0070717_10051464 Ga0070717_100514642 322
267 3300025910 Ga0207684_10052735 Ga0207684_100527352 322
268 3300025910 Ga0207684_10076155 Ga0207684_100761552 322
269 3300025922 Ga0207646_10013649 Ga0207646_100136492 322
270 3300025922 Ga0207646_10227499 Ga0207646_102274992 322
271 3300037312 Ga0395899_0068354 Ga0395899_0068354_1143_2213 322
272 3300037466 Ga0395898_0030518 Ga0395898_0030518_3623_4693 322
273 3300037471 Ga0395905_0167986 Ga0395905_0167986_615_1685 322
274 3300038443 Ga0395901_0016280 Ga0395901_0016280_5864_6934 322
275 3300053153 Ga0500616_0002462 Ga0500616_0002462_6918_7907 322
276 3300005518 Ga0070699_100035762 Ga0070699_1000357624 323
277 3300005985 Ga0081539_10122124 Ga0081539_101221241 323
278 3300014968 Ga0157379_10015745 Ga0157379_100157453 323
279 3300037466 Ga0395898_0097041 Ga0395898_0097041_690_1703 323
280 3300037418 Ga0395900_0066744 Ga0395900_0066744_1732_2733 324
281 3300038443 Ga0395901_0149616 Ga0395901_0149616_911_1939 324
282 3300046471 Ga0495650_0000063 Ga0495650_0000063_160128_161183 324
283 3300049571 Ga0501034_0005162 Ga0501034_0005162_6473_7501 324
284 3300050507 nmdc:mga05p37_734191_c1 nmdc:mga05p37_734191_c1_66_1070 324
285 3300053153 Ga0500616_0020042 Ga0500616_0020042_2471_3490 324
286 3300038443 Ga0395901_0095879 Ga0395901_0095879_880_1908 325
287 3300046459 Ga0495629_0043101 Ga0495629_0043101_316_1344 325
288 3300046461 Ga0495641_0016040 Ga0495641_0016040_2039_3061 325
289 3300046473 Ga0495582_0011332 Ga0495582_0011332_2343_3371 325
290 3300046517 Ga0495630_0070879 Ga0495630_0070879_315_1343 325
291 3300046642 Ga0495634_0042953 Ga0495634_0042953_237_1265 325
292 3300046663 Ga0495635_0122352 Ga0495635_0122352_440_1462 325
293 3300046689 Ga0495613_0022333 Ga0495613_0022333_2077_3105 325
294 3300046690 Ga0495624_0136628 Ga0495624_0136628_355_1383 325
295 3300047319 Ga0495674_0186160 Ga0495674_0186160_239_1267 325
296 3300047321 Ga0495676_0051199 Ga0495676_0051199_1901_2929 325
297 3300047322 Ga0495680_0029628 Ga0495680_0029628_587_1615 325
298 3300047673 Ga0495593_0014905 Ga0495593_0014905_1614_2642 325
299 3300005441 Ga0070700_100298384 Ga0070700_1002983841 326
300 3300005471 Ga0070698_100055857 Ga0070698_1000558575 326
301 3300005471 Ga0070698_100176048 Ga0070698_1001760484 326
302 3300005536 Ga0070697_100174010 Ga0070697_1001740103 326
303 3300046455 Ga0495603_0004827 Ga0495603_0004827_594_1592 326
304 3300046455 Ga0495603_0158350 Ga0495603_0158350_86_1114 326
305 3300046463 Ga0495653_0030900 Ga0495653_0030900_1602_2630 326
306 3300049568 Ga0501031_0002247 Ga0501031_0002247_8234_9220 326
307 3300049569 Ga0501032_0001363 Ga0501032_0001363_7774_8760 326
308 3300049570 Ga0501033_0010333 Ga0501033_0010333_3934_4920 326
309 3300049571 Ga0501034_0034171 Ga0501034_0034171_3021_4007 326
310 3300049572 Ga0501036_0017420 Ga0501036_0017420_2014_3000 326
311 3300049573 Ga0501037_0012002 Ga0501037_0012002_3598_4584 326
312 3300049574 Ga0501038_0021850 Ga0501038_0021850_2378_3364 326
313 3300049576 Ga0501040_0023869 Ga0501040_0023869_804_1790 326
314 3300049577 Ga0501041_0016877 Ga0501041_0016877_2440_3426 326
315 3300049578 Ga0501042_0010992 Ga0501042_0010992_815_1801 326
316 3300049579 Ga0501043_0133349 Ga0501043_0133349_540_1526 326
317 3300049580 Ga0501046_0117139 Ga0501046_0117139_384_1370 326
318 3300049581 Ga0501047_0016639 Ga0501047_0016639_3026_4012 326
319 3300049582 Ga0501048_0026263 Ga0501048_0026263_3006_3992 326
320 3300049584 Ga0501068_0004052 Ga0501068_0004052_1593_2579 326
321 3300049585 Ga0501069_0000448 Ga0501069_0000448_9391_10377 326
322 3300049586 Ga0501070_0005546 Ga0501070_0005546_9391_10377 326
323 3300049588 Ga0501072_0013707 Ga0501072_0013707_4965_5951 326
324 3300049589 Ga0501073_0001493 Ga0501073_0001493_8850_9836 326
325 3300049590 Ga0501074_0007757 Ga0501074_0007757_6236_7222 326
326 3300049591 Ga0501075_0100669 Ga0501075_0100669_549_1535 326
327 3300049592 Ga0501076_0020115 Ga0501076_0020115_3123_4109 326
328 3300049593 Ga0501077_0033789 Ga0501077_0033789_2014_3000 326
329 3300049741 Ga0501079_0035334 Ga0501079_0035334_2312_3298 326
330 3300049742 Ga0501080_0025846 Ga0501080_0025846_3470_4456 326
331 3300049743 Ga0501081_0004225 Ga0501081_0004225_3123_4109 326
332 3300049744 Ga0501083_0012963 Ga0501083_0012963_3899_4885 326
333 3300049822 Ga0501035_0008910 Ga0501035_0008910_3006_3992 326
334 3300049823 Ga0501044_0004610 Ga0501044_0004610_11274_12260 326
335 3300049824 Ga0501045_0010326 Ga0501045_0010326_256_1242 326
336 3300050509 nmdc:mga0qj67_6492_c1 nmdc:mga0qj67_6492_c1_511_1497 326
337 3300054114 Ga0501084_0017985 Ga0501084_0017985_4484_5470 326
338 3300060353 Ga0501082_0007617 Ga0501082_0007617_3006_3992 326
339 3300061734 Ga0530510_0106054 Ga0530510_0106054_256_1242 326
340 3300031251 Ga0265327_10000504 Ga0265327_1000050454 327
341 3300053139 Ga0500568_0000032 Ga0500568_0000032_1457_2494 327
342 3300005341 Ga0070691_10010784 Ga0070691_100107846 328
343 3300005578 Ga0068854_100090154 Ga0068854_1000901543 328
344 3300005719 Ga0068861_100213470 Ga0068861_1002134702 328
345 3300006163 Ga0070715_10045168 Ga0070715_100451683 328
346 3300006175 Ga0070712_100013540 Ga0070712_1000135404 328
347 3300009098 Ga0105245_10197243 Ga0105245_101972432 328
348 3300025905 Ga0207685_10002601 Ga0207685_100026012 328
349 3300025915 Ga0207693_10011016 Ga0207693_100110163 328
350 3300025927 Ga0207687_10142688 Ga0207687_101426882 328
351 3300025942 Ga0207689_10039093 Ga0207689_100390932 328
352 3300026075 Ga0207708_10007086 Ga0207708_100070869 328
353 3300035083 Ga0373926_0000872 Ga0373926_0000872_1009_2016 328
354 3300035111 Ga0373923_0027115 Ga0373923_0027115_167_1174 328
355 3300035113 Ga0373936_0002777 Ga0373936_0002777_751_1758 328
356 3300035116 Ga0373945_0000112 Ga0373945_0000112_14331_15338 328
357 3300035171 Ga0373946_0002641 Ga0373946_0002641_1742_2749 328
358 3300035691 Ga0373931_0057813 Ga0373931_0057813_444_1451 328
359 3300035692 Ga0373935_0051979 Ga0373935_0051979_1172_2179 328
360 3300035695 Ga0373927_0038521 Ga0373927_0038521_1503_2510 328
361 3300035725 Ga0373947_0021610 Ga0373947_0021610_653_1660 328
362 3300035725 Ga0373947_0225233 Ga0373947_0225233_173_1180 328
363 3300037068 Ga0373925_0034251 Ga0373925_0034251_1172_2179 328
364 3300046455 Ga0495603_0009104 Ga0495603_0009104_4005_5012 328
365 3300046459 Ga0495629_0046484 Ga0495629_0046484_866_1873 328
366 3300046461 Ga0495641_0021059 Ga0495641_0021059_1172_2179 328
367 3300046472 Ga0495580_0100846 Ga0495580_0100846_40_1047 328
368 3300046473 Ga0495582_0002265 Ga0495582_0002265_7807_8814 328
369 3300046475 Ga0495639_0000242 Ga0495639_0000242_3845_4852 328
370 3300046476 Ga0495662_0000818 Ga0495662_0000818_13234_14241 328
371 3300046517 Ga0495630_0021380 Ga0495630_0021380_1718_2725 328
372 3300046526 Ga0495666_0022177 Ga0495666_0022177_998_2005 328
373 3300046531 Ga0495665_0000298 Ga0495665_0000298_19202_20209 328
374 3300046533 Ga0495640_0007841 Ga0495640_0007841_1875_2882 328
375 3300046535 Ga0495586_0006254 Ga0495586_0006254_4309_5316 328
376 3300046642 Ga0495634_0001272 Ga0495634_0001272_4953_5960 328
377 3300046663 Ga0495635_0002276 Ga0495635_0002276_877_1884 328
378 3300046674 Ga0495588_0004357 Ga0495588_0004357_2193_3200 328
379 3300046681 Ga0495647_0001135 Ga0495647_0001135_6293_7300 328
380 3300046683 Ga0495658_0001710 Ga0495658_0001710_1771_2778 328
381 3300046690 Ga0495624_0013618 Ga0495624_0013618_1172_2179 328
382 3300047315 Ga0495581_0009073 Ga0495581_0009073_3575_4582 328
383 3300047319 Ga0495674_0005781 Ga0495674_0005781_1707_2714 328
384 3300047321 Ga0495676_0024235 Ga0495676_0024235_2056_3063 328
385 3300047471 Ga0495684_0188771 Ga0495684_0188771_504_1511 328
386 3300047673 Ga0495593_0000418 Ga0495593_0000418_3726_4733 328
387 3300048089 Ga0495614_0014252 Ga0495614_0014252_776_1783 328
388 3300048904 Ga0496101_0109126 Ga0496101_0109126_1039_2046 328
389 3300048904 Ga0496101_0173078 Ga0496101_0173078_352_1359 328
390 3300053085 Ga0495619_0048289 Ga0495619_0048289_626_1633 328
391 3300009553 Ga0105249_10410245 Ga0105249_104102452 329
392 3300046475 Ga0495639_0103638 Ga0495639_0103638_262_1275 329
393 3300046531 Ga0495665_0036389 Ga0495665_0036389_920_1933 329
394 3300035724 Ga0373933_0105308 Ga0373933_0105308_44_1081 331
395 3300046679 Ga0495623_0016452 Ga0495623_0016452_2452_3489 331
396 3300046680 Ga0495646_0095761 Ga0495646_0095761_234_1271 331
397 3300048909 Ga0496106_0095671 Ga0496106_0095671_342_1418 331
398 3300005434 Ga0070709_10030103 Ga0070709_100301031 332
399 3300005445 Ga0070708_100098209 Ga0070708_1000982091 332
400 3300005467 Ga0070706_100010517 Ga0070706_1000105175 332
401 3300005467 Ga0070706_100117508 Ga0070706_1001175082 332
402 3300005468 Ga0070707_100105181 Ga0070707_1001051812 332
403 3300025922 Ga0207646_10189073 Ga0207646_101890732 332
404 3300005445 Ga0070708_100215665 Ga0070708_1002156653 334
405 3300009094 Ga0111539_10332539 Ga0111539_103325392 334
406 3300035725 Ga0373947_0036314 Ga0373947_0036314_947_1981 334
407 3300037068 Ga0373925_0046375 Ga0373925_0046375_1092_2126 334
408 3300046455 Ga0495603_0031056 Ga0495603_0031056_270_1304 334
409 3300046459 Ga0495629_0019250 Ga0495629_0019250_1201_2235 334
410 3300046473 Ga0495582_0000768 Ga0495582_0000768_13132_14166 334
411 3300046475 Ga0495639_0036467 Ga0495639_0036467_189_1223 334
412 3300046531 Ga0495665_0020923 Ga0495665_0020923_205_1239 334
413 3300046683 Ga0495658_0000754 Ga0495658_0000754_916_1950 334
414 3300047315 Ga0495581_0008774 Ga0495581_0008774_3562_4596 334
415 3300003659 JGI25404J52841_10025111 JGI25404J52841_100251111 336
416 3300005347 Ga0070668_100111762 Ga0070668_1001117622 336
417 3300005444 Ga0070694_100001556 Ga0070694_1000015568 336
418 3300005549 Ga0070704_100016969 Ga0070704_1000169694 336
419 3300005843 Ga0068860_100356233 Ga0068860_1003562332 336
420 3300005937 Ga0081455_10013287 Ga0081455_100132872 336
421 3300005937 Ga0081455_10145358 Ga0081455_101453581 336
422 3300005983 Ga0081540_1000773 Ga0081540_100077320 336
423 3300006058 Ga0075432_10001926 Ga0075432_100019266 336
424 3300006844 Ga0075428_100002893 Ga0075428_10000289316 336
425 3300006846 Ga0075430_100022229 Ga0075430_1000222293 336
426 3300006847 Ga0075431_100001317 Ga0075431_10000131717 336
427 3300006847 Ga0075431_100011600 Ga0075431_1000116003 336
428 3300006852 Ga0075433_10099873 Ga0075433_100998732 336
429 3300006871 Ga0075434_100011060 Ga0075434_1000110606 336
430 3300006871 Ga0075434_100025189 Ga0075434_1000251892 336
431 3300006880 Ga0075429_100005884 Ga0075429_1000058847 336
432 3300007076 Ga0075435_100023122 Ga0075435_1000231224 336
433 3300009094 Ga0111539_10009048 Ga0111539_100090489 336
434 3300009147 Ga0114129_10007692 Ga0114129_100076925 336
435 3300009147 Ga0114129_10255063 Ga0114129_102550632 336
436 3300009148 Ga0105243_10021380 Ga0105243_100213805 336
437 3300009553 Ga0105249_10156656 Ga0105249_101566562 336
438 3300014325 Ga0163163_10212978 Ga0163163_102129782 336
439 3300025904 Ga0207647_10171467 Ga0207647_101714671 336
440 3300026118 Ga0207675_100005380 Ga0207675_1000053805 336
441 3300027907 Ga0207428_10009960 Ga0207428_100099602 336
442 3300027907 Ga0207428_10288473 Ga0207428_102884731 336
443 3300035086 Ga0373934_0011839 Ga0373934_0011839_1065_2087 336
444 3300035117 Ga0373953_0007127 Ga0373953_0007127_776_1798 336
445 3300035118 Ga0373954_0009654 Ga0373954_0009654_900_1922 336
446 3300035172 Ga0373955_0009911 Ga0373955_0009911_1519_2541 336
447 3300035692 Ga0373935_0142835 Ga0373935_0142835_307_1344 336
448 3300036401 Ga0373937_0049864 Ga0373937_0049864_1655_2677 336
449 3300037471 Ga0395905_0113054 Ga0395905_0113054_56_1087 336
450 3300046459 Ga0495629_0051335 Ga0495629_0051335_119_1141 336
451 3300046461 Ga0495641_0036369 Ga0495641_0036369_1014_2051 336
452 3300046475 Ga0495639_0064012 Ga0495639_0064012_24_1046 336
453 3300046477 Ga0495664_0005843 Ga0495664_0005843_3070_4107 336
454 3300046511 Ga0495608_0008690 Ga0495608_0008690_2542_3564 336
455 3300046517 Ga0495630_0058183 Ga0495630_0058183_1362_2384 336
456 3300046536 Ga0495587_0002212 Ga0495587_0002212_8306_9328 336
457 3300046663 Ga0495635_0164357 Ga0495635_0164357_21_1058 336
458 3300046678 Ga0495599_0101242 Ga0495599_0101242_362_1384 336
459 3300046681 Ga0495647_0045253 Ga0495647_0045253_442_1479 336
460 3300047317 Ga0495604_0009402 Ga0495604_0009402_5071_6093 336
461 3300047319 Ga0495674_0096087 Ga0495674_0096087_119_1156 336
462 3300047321 Ga0495676_0022846 Ga0495676_0022846_224_1261 336
463 3300047471 Ga0495684_0225424 Ga0495684_0225424_230_1252 336
464 3300048088 Ga0495602_0054783 Ga0495602_0054783_1686_2708 336
465 3300048089 Ga0495614_0019389 Ga0495614_0019389_190_1218 336
466 3300048910 Ga0496107_0083840 Ga0496107_0083840_140_1168 336
467 3300050507 nmdc:mga05p37_6532_c1 nmdc:mga05p37_6532_c1_4636_5670 336
468 3300050508 nmdc:mga09592_473_c1 nmdc:mga09592_473_c1_7402_8436 336
469 3300050509 nmdc:mga0qj67_4230_c1 nmdc:mga0qj67_4230_c1_3776_4810 336
470 3300050510 nmdc:mga06r32_1253_c1 nmdc:mga06r32_1253_c1_7982_9016 336
471 3300050510 nmdc:mga06r32_16231_c1 nmdc:mga06r32_16231_c1_205_1239 336
472 3300050510 nmdc:mga06r32_70805_c1 nmdc:mga06r32_70805_c1_1279_2307 336
473 3300050511 nmdc:mga08y16_14355_c1 nmdc:mga08y16_14355_c1_1590_2624 336
474 3300050512 nmdc:mga0n895_29500_c1 nmdc:mga0n895_29500_c1_2441_3469 336
475 3300050513 nmdc:mga0rr50_92247_c1 nmdc:mga0rr50_92247_c1_329_1351 336
476 3300050515 nmdc:mga0a205_113045_c1 nmdc:mga0a205_113045_c1_937_1959 336
477 3300053078 Ga0495612_0004984 Ga0495612_0004984_1477_2514 336
478 3300053085 Ga0495619_0048712 Ga0495619_0048712_177_1214 336
479 3300053085 Ga0495619_0062468 Ga0495619_0062468_392_1414 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04371

PAD_porph

Porphyromonas-type peptidyl-arginine deiminase

18

342

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h7k-assembly1.cif.gz_A crystal structure of arabidopsis thaliana agmatine deiminase complexed with a covalently bound reaction intermediate 0.9461 2 336
6nic-assembly2.cif.gz_C crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide 0.946 8 332
2q3u-assembly2.cif.gz_B ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at5g08170, agmatine iminohydrolase 0.9456 3 336
6nic-assembly1.cif.gz_B crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide 0.9448 8 332
2jer-assembly1.cif.gz_F agmatine deiminase of enterococcus faecalis catalyzing its reaction. 0.944 1 336
ID Description Score Start End Superfamily
3h7kA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9271 2 336 3.75.10.10
2ewoA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9233 1 333 3.75.10.10
3h7kA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9217 2 336 3.75.10.10
2ewoA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9125 1 333 3.75.10.10
1xknA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9065 8 332 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A6B3HHS3-F1-model_v4 Agmatine deiminase family protein 0.9883 96 201 GO:0004668
GO:0009446
GO:0047632
AF-A0A7W1K472-F1-model_v4 Agmatine deiminase family protein 0.9868 1 261 GO:0004668
GO:0009446
GO:0047632
AF-A0A7K0LBN4-F1-model_v4 Agmatine deiminase 0.9845 10 212 GO:0004668
GO:0009446
GO:0047632
AF-A0A6P0PL18-F1-model_v4 Agmatine deiminase family protein 0.9844 1 245 GO:0004668
GO:0009446
GO:0047632
AF-A0A1M2Z8W3-F1-model_v4 Agmatine deiminase 0.9834 7 263 GO:0004668
GO:0009446
GO:0047632

Feature Viewer

pLDDT pTM Quality
95.07 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map