F452017

General Info

Members Datasets Scaffolds Average Seq Length
479 377 958 320

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100186244|Ga0070665_1001862443
Length 343
Sequence MFTILKHPSDMNDVGTREIMMLEWASLRSRPDVREANGLTSSGGASETKSPKKTGISLALGGGCARGWAHIGVLRALDEAGIEVSMIAGTSIGALVGGCYLAGKLDELEEFARSLTKRRIFGLLDLNLRGSGLFGGMKLDARLREHVAGVRFEDLPKPFVSVASEIRTGHEIWLSNGSLITAMRASYALPGVFEPVNCNGRMLVDGALVNPVPVSVCRAYEQPLVVAVNLHYDLFGRAAVIKHSAGELVVEKDAPRAGRVDAEHQSHQTRLGITGVMVEAFNIIQDRISRARLAGDPPDMSLQPKLSHIGLTEFHRADEAIQLGYQATMAQIGELTRLQTVLA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
34 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
57 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
61 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
62 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
63 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
66 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
67 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
68 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
69 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
70 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
71 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
72 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
95 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
96 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
97 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
100 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
101 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
102 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
103 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
104 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
106 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
107 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
108 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
109 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
110 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
111 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
112 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
113 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
114 2512875024
115 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
116 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
117 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
118 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
119 2534681786 Brucella suis 92/29 Isolate Unclassified
120 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
121 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
122 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
123 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
124 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
125 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
126 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
127 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
128 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
129 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
130 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
131 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
132 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
133 2738543024 Aminobacter sp. AP02 Isolate Unclassified
134 2751185800 Brucella pituitosa AA2 Isolate Unclassified
135 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
136 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
137 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
138 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
139 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
140 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
141 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
142 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
143 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
144 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
145 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
146 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
147 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
148 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
149 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
150 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
151 2854911287 Brucella lupini LUP21 Isolate Unclassified
152 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
153 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
154 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
155 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
156 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
157 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
158 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
159 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
160 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
161 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
162 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
163 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
164 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
165 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
166 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
167 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
168 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
169 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
170 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
171 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
172 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
173 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
174 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
175 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
176 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
177 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
178 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
179 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
180 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
181 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
182 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
183 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
184 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
185 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
186 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
187 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
188 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
189 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
190 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
191 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
192 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
193 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
194 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
195 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
196 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
197 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
198 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
199 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
200 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
201 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
202 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
203 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
204 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
205 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
206 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
207 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
208 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
209 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
210 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
211 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
212 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
213 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
214 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
215 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
216 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
217 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
218 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
219 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
220 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
221 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
222 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
223 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
224 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
225 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
226 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
227 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
228 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
229 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
230 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
231 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
232 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
233 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
234 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
235 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
236 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
237 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
238 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
239 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
240 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
241 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
242 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
243 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
244 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
245 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
246 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
247 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
248 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
249 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
250 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
251 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
252 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
253 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
254 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
255 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
256 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
257 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
258 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
259 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
260 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
261 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
262 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
263 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
264 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
265 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
266 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
267 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
268 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
269 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
270 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
271 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
272 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
273 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
274 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
275 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
276 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
277 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
278 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
279 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
280 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
281 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
282 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
283 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
284 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
285 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
286 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
287 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
288 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
289 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
290 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
291 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
292 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
293 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
294 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
295 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
296 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
297 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
298 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
299 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
300 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
301 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
302 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
303 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
304 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
305 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
306 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
307 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
308 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
309 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
310 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
311 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
312 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
313 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
314 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
315 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
316 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
317 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
318 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
319 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
320 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
321 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
322 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
323 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
324 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
325 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
326 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
327 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
328 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
329 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
330 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
331 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
332 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
333 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
334 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
335 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
336 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
337 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
338 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
339 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
340 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
341 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
342 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
343 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
344 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
345 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
346 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
347 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
348 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
349 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
350 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
351 3004167301 Mesorhizobium loti 582 Isolate Unclassified
352 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
353 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
354 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
355 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
356 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
357 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
358 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
359 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
360 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
361 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
362 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
363 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
364 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
365 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
366 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
367 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
368 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
369 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
370 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
371 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
372 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
373 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
374 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
375 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
376 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
377 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 42.8
Metatranscriptomes 0.21
Isolates 56.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 44.68
Rhizoplane 1.25
Rhizosphere 34.03
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100186244 3300005548 Bacteria 2077
2 JGI25157J39369_1000467 3300002741 Bacteria 25490
3 JGI25165J46597_1000325 3300003214 Bacteria 57094
4 Ga0006562J51391_1007330 3300003578 Bacteria 3284
5 Ga0055542_1000740 3300003762 Bacteria 25274
6 Ga0055529_1005691 3300003763 Bacteria 1781
7 Ga0070658_10153083 3300005327 Bacteria 1931
8 Ga0070660_100188801 3300005339 Bacteria 1669
9 Ga0070659_100073331 3300005366 Bacteria 2725
10 Ga0070659_100216238 3300005366 Bacteria 1581
11 Ga0070711_100405793 3300005439 Unclassified 1107
12 Ga0070663_100004324 3300005455 Bacteria 8327
13 Ga0068867_100313201 3300005459 Bacteria 1298
14 Ga0068853_100111177 3300005539 Bacteria 2434
15 Ga0068853_100157533 3300005539 Bacteria 2047
16 Ga0068853_100512302 3300005539 Bacteria 1133
17 Ga0070665_100042863 3300005548 Bacteria 4549
18 Ga0070665_100236168 3300005548 Bacteria 1829
19 Ga0068852_100269626 3300005616 Bacteria 1637
20 Ga0081540_1063095 3300005983 Bacteria 1755
21 Ga0081539_10001955 3300005985 Bacteria 31430
22 Ga0075365_10040802 3300006038 Bacteria 3028
23 Ga0075365_10058604 3300006038 Bacteria 2564
24 Ga0075365_10089074 3300006038 Bacteria 2100
25 Ga0075368_10021177 3300006042 Bacteria 2468
26 Ga0075363_100046556 3300006048 Bacteria 2302
27 Ga0075364_10001433 3300006051 Bacteria 12924
28 Ga0075364_10022733 3300006051 Bacteria 3964
29 Ga0075367_10031840 3300006178 Bacteria 3030
30 Ga0075367_10037567 3300006178 Bacteria 2815
31 Ga0075367_10073304 3300006178 Bacteria 2062
32 Ga0075369_10004047 3300006186 Bacteria 5387
33 Ga0075370_10020196 3300006353 Bacteria 3637
34 Ga0105240_10314807 3300009093 Bacteria 1786
35 Ga0105240_10498515 3300009093 Bacteria 1354
36 Ga0105241_10069374 3300009174 Bacteria 2733
37 Ga0105248_10456255 3300009177 Bacteria 1440
38 Ga0105237_10005898 3300009545 Bacteria 13731
39 Ga0105238_10011247 3300009551 Bacteria 9007
40 Ga0105239_10019303 3300010375 Bacteria 7530
41 Ga0105239_10227880 3300010375 Bacteria 2090
42 Ga0157370_10122186 3300013104 Bacteria 2431
43 Ga0182008_10017730 3300014497 Bacteria 3691
44 Ga0157376_10243304 3300014969 Bacteria 1677
45 Ga0209026_1000024 3300025250 Bacteria 355839
46 Ga0209148_1000050 3300025254 Bacteria 413178
47 Ga0209759_1000302 3300025256 Bacteria 67678
48 Ga0209233_1000027 3300025261 Bacteria 652089
49 Ga0209233_1028451 3300025261 Bacteria 1341
50 Ga0209455_1000575 3300025272 Bacteria 24057
51 Ga0209758_1016424 3300025297 Bacteria 3760
52 Ga0207695_10146183 3300025913 Bacteria 2308
53 Ga0207695_10200015 3300025913 Bacteria 1912
54 Ga0207695_10269320 3300025913 Bacteria 1599
55 Ga0207671_10041284 3300025914 Bacteria 3414
56 Ga0207671_10101850 3300025914 Bacteria 2176
57 Ga0207657_10144178 3300025919 Bacteria 1944
58 Ga0207694_10036216 3300025924 Bacteria 3787
59 Ga0207694_10088767 3300025924 Bacteria 2437
60 Ga0207690_10140003 3300025932 Bacteria 1782
61 Ga0207669_10107169 3300025937 Bacteria 1863
62 Ga0207639_10221118 3300026041 Bacteria 1636
63 Ga0207639_10355115 3300026041 Bacteria 1310
64 Ga0207678_10060246 3300026067 Bacteria 3265
65 Ga0207678_10070286 3300026067 Bacteria 3002
66 Ga0207702_10105942 3300026078 Bacteria 2491
67 Ga0207648_10225092 3300026089 Bacteria 1668
68 Ga0268266_10034602 3300028379 Bacteria 4296
69 Ga0268266_10056709 3300028379 Bacteria 3370
70 Ga0316584_0213408 3300036712 Bacteria 1420
71 Ga0395899_0000144 3300037312 Bacteria 108386
72 Ga0395900_0000027 3300037418 Bacteria 285957
73 Ga0395900_0016450 3300037418 Bacteria 7542
74 Ga0395900_0085171 3300037418 Bacteria 3248
75 Ga0395900_0264909 3300037418 Bacteria 1715
76 Ga0395898_0000043 3300037466 Bacteria 301783
77 Ga0395898_0307936 3300037466 Bacteria 1511
78 Ga0395905_0000032 3300037471 Bacteria 285932
79 Ga0395905_0015694 3300037471 Bacteria 7196
80 Ga0395905_0128216 3300037471 Bacteria 2386
81 Ga0395905_0198843 3300037471 Bacteria 1879
82 Ga0395901_0000056 3300038443 Bacteria 154356
83 Ga0395901_0113269 3300038443 Bacteria 2848
84 Ga0395901_0136115 3300038443 Bacteria 2582
85 Ga0395901_0153567 3300038443 Bacteria 2418
86 Ga0395901_0228782 3300038443 Bacteria 1942
87 Ga0439465_0062130 3300041413 Bacteria 1239
88 Ga0439445_0037113 3300042004 Bacteria 1285
89 Ga0466972_0013088 3300044658 Bacteria 4167
90 Ga0466965_0127879 3300044683 Bacteria 1316
91 Ga0495638_0001366 3300046460 Bacteria 22402
92 Ga0495660_0101231 3300046810 Bacteria 1483
93 Ga0495626_0030384 3300048091 Bacteria 2606
94 Ga0496102_0075265 3300048905 Bacteria 3104
95 Ga0496105_0263369 3300048908 Bacteria 1394
96 Ga0496110_0727468 3300048913 Bacteria 895
97 Ga0496112_0044770 3300048915 Bacteria 4337
98 Ga0496118_0079696 3300048921 Bacteria 2309
99 Ga0496119_0037793 3300048922 Bacteria 3130
100 Ga0496119_0052303 3300048922 Bacteria 2502
101 Ga0496119_0057559 3300048922 Bacteria 2348
102 Ga0496120_0008614 3300048923 Bacteria 7369
103 Ga0496120_0018760 3300048923 Bacteria 4446
104 Ga0496125_0087210 3300048928 Bacteria 2358
105 Ga0496126_0206648 3300048929 Bacteria 1655
106 Ga0496126_0220973 3300048929 Bacteria 1591
107 Ga0501031_0000035 3300049568 Bacteria 73884
108 Ga0501031_0053487 3300049568 Bacteria 2631
109 Ga0501031_0075004 3300049568 Bacteria 2202
110 Ga0501031_0127029 3300049568 Bacteria 1665
111 Ga0501031_0165081 3300049568 Bacteria 1447
112 Ga0501031_0322370 3300049568 Bacteria 1001
113 Ga0501032_0000022 3300049569 Bacteria 146790
114 Ga0501032_0000192 3300049569 Bacteria 50676
115 Ga0501032_0136875 3300049569 Bacteria 1614
116 Ga0501032_0191883 3300049569 Bacteria 1335
117 Ga0501033_0000037 3300049570 Bacteria 146582
118 Ga0501033_0000623 3300049570 Bacteria 32807
119 Ga0501033_0015165 3300049570 Bacteria 5848
120 Ga0501033_0129983 3300049570 Bacteria 1825
121 Ga0501034_0000556 3300049571 Bacteria 59195
122 Ga0501034_0000634 3300049571 Bacteria 54577
123 Ga0501034_0007557 3300049571 Bacteria 11565
124 Ga0501034_0008817 3300049571 Bacteria 10611
125 Ga0501034_0019825 3300049571 Bacteria 6873
126 Ga0501034_0283458 3300049571 Bacteria 1596
127 Ga0501036_0000013 3300049572 Bacteria 155326
128 Ga0501036_0016114 3300049572 Bacteria 6245
129 Ga0501036_0331061 3300049572 Bacteria 1272
130 Ga0501037_0000016 3300049573 Bacteria 161027
131 Ga0501037_0000084 3300049573 Bacteria 85767
132 Ga0501037_0000296 3300049573 Bacteria 42150
133 Ga0501037_0171240 3300049573 Bacteria 1543
134 Ga0501038_0000015 3300049574 Bacteria 161983
135 Ga0501038_0000106 3300049574 Bacteria 70708
136 Ga0501038_0075044 3300049574 Bacteria 2859
137 Ga0501038_0149478 3300049574 Bacteria 1905
138 Ga0501038_0272136 3300049574 Bacteria 1335
139 Ga0501039_0000003 3300049575 Bacteria 357424
140 Ga0501039_0000013 3300049575 Bacteria 234418
141 Ga0501039_0031734 3300049575 Bacteria 4074
142 Ga0501040_0037667 3300049576 Bacteria 3286
143 Ga0501042_0059030 3300049578 Bacteria 2739
144 Ga0501043_0000029 3300049579 Bacteria 143328
145 Ga0501043_0000068 3300049579 Bacteria 93023
146 Ga0501043_0000299 3300049579 Bacteria 44816
147 Ga0501043_0025119 3300049579 Bacteria 4674
148 Ga0501043_0027001 3300049579 Bacteria 4506
149 Ga0501046_0020621 3300049580 Bacteria 5449
150 Ga0501046_0036800 3300049580 Bacteria 3936
151 Ga0501047_0013575 3300049581 Bacteria 7724
152 Ga0501047_0156406 3300049581 Bacteria 2153
153 Ga0501067_0004819 3300049583 Bacteria 7483
154 Ga0501067_0086030 3300049583 Bacteria 1745
155 Ga0501067_0114008 3300049583 Bacteria 1503
156 Ga0501068_0038255 3300049584 Bacteria 2873
157 Ga0501069_0000031 3300049585 Bacteria 97968
158 Ga0501069_0019697 3300049585 Bacteria 3651
159 Ga0501070_0000045 3300049586 Bacteria 107880
160 Ga0501070_0033482 3300049586 Bacteria 4300
161 Ga0501070_0039970 3300049586 Bacteria 3912
162 Ga0501070_0100617 3300049586 Bacteria 2391
163 Ga0501071_0002735 3300049587 Bacteria 10812
164 Ga0501074_0000012 3300049590 Bacteria 83803
165 Ga0501074_0021563 3300049590 Bacteria 4677
166 Ga0501074_0038084 3300049590 Bacteria 3485
167 Ga0501080_0001260 3300049742 Bacteria 21075
168 Ga0501080_0010046 3300049742 Bacteria 8652
169 Ga0501080_0067414 3300049742 Bacteria 3328
170 Ga0501080_0350893 3300049742 Bacteria 1332
171 Ga0501035_0000032 3300049822 Bacteria 175435
172 Ga0501035_0000046 3300049822 Bacteria 146599
173 Ga0501035_0001379 3300049822 Bacteria 24969
174 Ga0501035_0002234 3300049822 Bacteria 19184
175 Ga0501035_0012840 3300049822 Bacteria 7736
176 Ga0501035_0016958 3300049822 Bacteria 6713
177 Ga0501035_0028744 3300049822 Bacteria 5072
178 Ga0501035_0141565 3300049822 Bacteria 2091
179 Ga0501035_0166145 3300049822 Bacteria 1908
180 Ga0501035_0186441 3300049822 Bacteria 1785
181 Ga0501044_0000038 3300049823 Bacteria 161027
182 Ga0501044_0000113 3300049823 Bacteria 97940
183 Ga0501044_0013498 3300049823 Bacteria 8835
184 Ga0501044_0022484 3300049823 Bacteria 6718
185 Ga0501044_0035711 3300049823 Bacteria 5203
186 Ga0501044_0069186 3300049823 Bacteria 3594
187 Ga0501044_0074766 3300049823 Bacteria 3441
188 nmdc:mga03n38_27781_c1 3300050490 Bacteria 2351
189 nmdc:mga03n38_63594_c1 3300050490 Bacteria 1687
190 nmdc:mga03n38_65311_c1 3300050490 Bacteria 1668
191 nmdc:mga03n38_81744_c1 3300050490 Bacteria 1519
192 nmdc:mga00v17_27665_c1 3300050491 Bacteria 3313
193 nmdc:mga0yw44_247906_c1 3300050492 Bacteria 1185
194 nmdc:mga0yw44_4883_c1 3300050492 Bacteria 5489
195 nmdc:mga0yw44_67748_c1 3300050492 Bacteria 2207
196 nmdc:mga0yw44_91232_c1 3300050492 Bacteria 1926
197 nmdc:mga04h51_35233_c1 3300050495 Bacteria 1603
198 nmdc:mga07m45_68272_c1 3300050496 Bacteria 2021
199 nmdc:mga0sz30_4962_c1 3300050516 Bacteria 4534
200 Ga0500610_0105825 3300053079 Bacteria 1451
201 Ga0500595_016834 3300053119 Bacteria 2715
202 Ga0500568_0000056 3300053139 Bacteria 109531
203 Ga0500616_0066134 3300053153 Bacteria 1857
204 Ga0500620_000116 3300053155 Bacteria 15810
205 Ga0500620_042040 3300053155 Bacteria 1504
206 Ga0501082_0197566 3300060353 Bacteria 1750
207 2503202084 2503198000 Bacteria 6884444
208 2509115625 2508501123 Bacteria 6283661
209 2509141812 2508501127 Bacteria 7037543
210 2509373417 2509276018 Bacteria 6910194
211 2509396733 2509276022 Bacteria 6200534
212 2510317635 2510065059 Bacteria 6847884
213 2511389422 2511231027 Bacteria 5013807
214 2512931019 2512875016 Bacteria 6529530
215 2512958749 2512875024 Bacteria 7195110
216 2513611038 2513237090 Bacteria 7096802
217 2514034837 2513237164 Bacteria 7563725
218 2514418538 2513237305 Bacteria 7293571
219 2514590274 2513237351 Bacteria 6968952
220 2535484801 2534681786 Bacteria 3308809
221 2588516775 2588253730 Bacteria 6881675
222 2599940477 2599185301 Bacteria 6161860
223 2643771847 2643221550 Bacteria 4619371
224 2643775765 2643221551 Bacteria 3750538
225 2643794212 2643221555 Bacteria 3749717
226 2643840527 2643221564 Bacteria 4193379
227 2643989255 2643221595 Bacteria 6565519
228 2644129934 2643221623 Bacteria 5239945
229 2644152827 2643221627 Bacteria 6761570
230 2688599565 2687453392 Bacteria 6880454
231 2694629769 2693429783 Bacteria 7019804
232 2694636358 2693429784 Bacteria 7241525
233 2723575843 2721755686 Bacteria 7343952
234 2739310505 2738543024 Bacteria 5603683
235 2753359414 2751185800 Bacteria 5467370
236 2756677282 2756170246 Bacteria 7451806
237 2757570840 2757320392 Bacteria 3737298
238 2758641675 2758568016 Bacteria 5645291
239 2770197650 2767802442 Bacteria 5747986
240 2776271678 2775506902 Bacteria 6208009
241 2776279810 2775506904 Bacteria 5954060
242 2792749838 2791355123 Bacteria 8049106
243 2837653019 2837651117 Bacteria 3772164
244 2839995242 2839993093 Bacteria 5512535
245 2840770000 2840764183 Bacteria 6358399
246 2841739893 2841734538 Bacteria 6784580
247 2842872766 2842871566 Bacteria 4827117
248 2844006295 2844002411 Bacteria 7168230
249 2844014842 2844009547 Bacteria 6728125
250 2847676039 2847670302 Bacteria 6165597
251 2847692681 2847686936 Bacteria 6278406
252 2854911959 2854911287 Bacteria 5582813
253 2856315826 2856314179 Bacteria 6477897
254 2856325716 2856320880 Bacteria 7263508
255 2856334085 2856328259 Bacteria 6528202
256 2856341195 2856334872 Bacteria 7037011
257 2856342734 2856342000 Bacteria 7176905
258 2856354428 2856349417 Bacteria 6230045
259 2856362671 2856356410 Bacteria 6297484
260 2856370593 2856364286 Bacteria 6939991
261 2857350574 2857349434 Bacteria 7926032
262 2857370151 2857367948 Bacteria 6965560
263 2869164341 2869162929 Bacteria 6399702
264 2869244305 2869242130 Bacteria 6609239
265 2869263659 2869256925 Bacteria 6981691
266 2869266140 2869264136 Bacteria 6880765
267 2869274337 2869271264 Bacteria 6908218
268 2869279334 2869278585 Bacteria 7077053
269 2869291679 2869285874 Bacteria 6901219
270 2871434889 2871429161 Bacteria 6547891
271 2871444216 2871444079 Bacteria 6423508
272 2871452805 2871451962 Bacteria 7336357
273 2871468056 2871466892 Bacteria 6923287
274 2871481340 2871474448 Bacteria 6806570
275 2871495510 2871488783 Bacteria 6929816
276 2871502783 2871495908 Bacteria 6935695
277 2874106090 2874102143 Bacteria 6342645
278 2874112010 2874109183 Bacteria 6517025
279 2874119080 2874116593 Bacteria 6674494
280 2874130955 2874123672 Bacteria 7238285
281 2874136905 2874131515 Bacteria 6820270
282 2874145081 2874139085 Bacteria 7021506
283 2874149279 2874146452 Bacteria 7533118
284 2874157543 2874155637 Bacteria 6724144
285 2874165563 2874162495 Bacteria 6174670
286 2874176070 2874168670 Bacteria 8062617
287 2876365829 2876363079 Bacteria 6544991
288 2876374592 2876369609 Bacteria 6807521
289 2876391702 2876386047 Bacteria 6698674
290 2876394683 2876392853 Bacteria 6660880
291 2876402177 2876399893 Bacteria 6927900
292 2876412565 2876406927 Bacteria 6191900
293 2876415745 2876413966 Bacteria 6831344
294 2876423500 2876420981 Bacteria 6687741
295 2878040094 2878035449 Bacteria 6555736
296 2878743280 2878738818 Bacteria 7136951
297 2878752023 2878745973 Bacteria 6867388
298 2878757866 2878753008 Bacteria 6922523
299 2878766675 2878760144 Bacteria 6823465
300 2878773872 2878767105 Bacteria 6898628
301 2878776419 2878774303 Bacteria 6108671
302 2881152034 2881147464 Bacteria 7779814
303 2881155758 2881155292 Bacteria 6461656
304 2881168012 2881161766 Bacteria 7127907
305 2881848590 2881845957 Bacteria 6611900
306 2881854248 2881853255 Bacteria 6698367
307 2881864759 2881861095 Bacteria 7128710
308 2882637120 2882632389 Bacteria 8154593
309 2885309896 2885305155 Bacteria 7348390
310 2885316993 2885312484 Bacteria 6415165
311 2885323838 2885318864 Bacteria 6729568
312 2885341512 2885334103 Bacteria 7216818
313 2885344531 2885342637 Bacteria 7011821
314 2885353642 2885350715 Bacteria 6787678
315 2888340008 2888337043 Bacteria 6629336
316 2888347348 2888343758 Bacteria 6611049
317 2888356259 2888350351 Bacteria 7372807
318 2889011185 2889010040 Bacteria 6749192
319 2889017090 2889016732 Bacteria 6700763
320 2889794063 2889790730 Bacteria 5689708
321 2889917984 2889914905 Bacteria 5702301
322 2894819911 2894817345 Bacteria 4892941
323 2903455518 2903448605 Bacteria 7357801
324 2903493418 2903492973 Bacteria 13473544
325 2903506612 2903492973 Bacteria 13473544
326 2903523846 2903521522 Bacteria 6525694
327 2903534292 2903528002 Bacteria 6586099
328 2903547922 2903540706 Bacteria 7062119
329 2904583332 2904578770 Bacteria 5302906
330 2904661316 2904659560 Bacteria 6685615
331 2906314417 2906308376 Bacteria 6841989
332 2906327586 2906321335 Bacteria 6579571
333 2906329384 2906328253 Bacteria 6585166
334 2906362817 2906354277 Bacteria 6991324
335 2906363747 2906363423 Bacteria 6856682
336 2906374731 2906370794 Bacteria 6881062
337 2906381130 2906378014 Bacteria 6911440
338 2906397311 2906393657 Bacteria 6790866
339 2906407102 2906401398 Bacteria 6693206
340 2906410692 2906408224 Bacteria 6162342
341 2906415963 2906414383 Bacteria 6580790
342 2915653901 2915650412 Bacteria 4288180
343 2919121048 2919119836 Bacteria 5208557
344 2922138525 2922130491 Bacteria 7173936
345 2922158387 2922151315 Bacteria 6902399
346 2922162163 2922158528 Bacteria 6573167
347 2922175992 2922172374 Bacteria 6167644
348 2922183428 2922178524 Bacteria 6025201
349 2924727135 2924726620 Bacteria 6271473
350 2924739162 2924733363 Bacteria 7574837
351 2924747534 2924741084 Bacteria 6661321
352 2924751260 2924748358 Bacteria 6154725
353 2924766895 2924762789 Bacteria 6561353
354 2924781091 2924776078 Bacteria 7492003
355 2924784580 2924784321 Bacteria 7416538
356 2928523225 2928521798 Bacteria 4960112
357 2937816279 2937813078 Bacteria 7783518
358 2937825107 2937822353 Bacteria 7290551
359 2937837912 2937836603 Bacteria 6811263
360 2937847473 2937843397 Bacteria 5256375
361 2937855004 2937848649 Bacteria 6983481
362 2937862076 2937861824 Bacteria 6660327
363 2937871106 2937868953 Bacteria 6639878
364 2937877515 2937877337 Bacteria 7246526
365 2937896994 2937891427 Bacteria 6357007
366 2937975402 2937972304 Bacteria 7532020
367 2938001799 2937994558 Bacteria 7036190
368 2954015495 2954011201 Bacteria 4762601
369 2958035474 2958034702 Bacteria 6989922
370 2958043661 2958041894 Bacteria 13082850
371 2958067874 2958064165 Bacteria 7158582
372 2958074096 2958071322 Bacteria 6815895
373 2958084622 2958084443 Bacteria 7312792
374 2958101602 2958100919 Bacteria 6800575
375 2958114905 2958108152 Bacteria 6681128
376 2958118875 2958115193 Bacteria 6923548
377 2958129283 2958122699 Bacteria 7280457
378 2958136079 2958130278 Bacteria 6897202
379 2958151803 2958144490 Bacteria 6677056
380 2958162060 2958158011 Bacteria 6058449
381 2958171854 2958165035 Bacteria 6906348
382 2958175966 2958172287 Bacteria 6716688
383 2958185546 2958179912 Bacteria 6874908
384 2961083924 2961077736 Bacteria 7079850
385 2961116469 2961114664 Bacteria 6680456
386 2961128175 2961127735 Bacteria 7196641
387 2961139947 2961136820 Bacteria 6775228
388 2961170300 2961163497 Bacteria 6901077
389 2961174410 2961170736 Bacteria 7072258
390 2961184908 2961183825 Bacteria 6688536
391 2963648204 2963644680 Bacteria 6530403
392 2965025046 2965018300 Bacteria 6883036
393 2965027804 2965025482 Bacteria 6532201
394 2965044263 2965040258 Bacteria 6855979
395 2965049113 2965047637 Bacteria 6623551
396 2965068254 2965062239 Bacteria 7412989
397 2965089618 2965089291 Bacteria 6866420
398 2965111957 2965110997 Bacteria 6693150
399 2965126980 2965119406 Bacteria 6956431
400 2968000401 2967996073 Bacteria 6787468
401 2968003688 2968003550 Bacteria 6929263
402 2968017979 2968016561 Bacteria 7022047
403 2968091028 2968083720 Bacteria 7351627
404 2968095798 2968091066 Bacteria 6052692
405 2968100778 2968097103 Bacteria 6107094
406 2968112375 2968110612 Bacteria 6814636
407 2968121170 2968117919 Bacteria 6536078
408 2968132746 2968128360 Bacteria 6270294
409 2968178687 2968171901 Bacteria 6894245
410 2970471846 2970469710 Bacteria 6969209
411 2970490252 2970489779 Bacteria 6517260
412 2970506997 2970503327 Bacteria 7099517
413 2970513003 2970510686 Bacteria 7006402
414 2970531600 2970524798 Bacteria 6840927
415 2970532516 2970532167 Bacteria 6553173
416 2970549456 2970547951 Bacteria 6931819
417 2970561532 2970554993 Bacteria 6814252
418 2970593930 2970593180 Bacteria 7073582
419 2970627739 2970627176 Bacteria 6680862
420 2977822399 2977821940 Bacteria 6906439
421 2977834509 2977828996 Bacteria 7007971
422 2977846513 2977843712 Bacteria 6753583
423 2977855495 2977851361 Bacteria 6694324
424 2977859435 2977858184 Bacteria 6215359
425 2977865779 2977864932 Bacteria 7534097
426 2977874071 2977872689 Bacteria 7270173
427 2977901260 2977898635 Bacteria 6675551
428 2977911927 2977907340 Bacteria 6577984
429 2977929325 2977922695 Bacteria 6956781
430 2977936907 2977935797 Bacteria 6252826
431 2977947712 2977942078 Bacteria 7570577
432 2977955462 2977950692 Bacteria 6893264
433 2977958359 2977957713 Bacteria 6877875
434 2977978733 2977971508 Bacteria 7472917
435 2977987505 2977986579 Bacteria 6581278
436 2979714808 2979710463 Bacteria 6785254
437 2979784083 2979779861 Bacteria 6219781
438 2979797394 2979793036 Bacteria 6808957
439 2979812192 2979808191 Bacteria 7179355
440 2987637758 2987636660 Bacteria 8088555
441 2987648907 2987645492 Bacteria 6117018
442 2987658572 2987652177 Bacteria 6969023
443 2987666541 2987659509 Bacteria 6966464
444 2987668764 2987666974 Bacteria 6509233
445 2987673559 2987673487 Bacteria 6884027
446 2996311247 2996310559 Bacteria 6357320
447 2996341161 2996336353 Bacteria 5511628
448 2996342604 2996341866 Bacteria 6643098
449 2996350776 2996348954 Bacteria 7239054
450 2996393057 2996386984 Bacteria 6978667
451 3000140106 3000135777 Bacteria 6891109
452 3002144035 3002141150 Bacteria 5254435
453 3004169433 3004167301 Bacteria 8330599
454 3004195543 3004188549 Bacteria 6952365
455 3004196732 3004195979 Bacteria 6776956
456 3004205920 3004203850 Bacteria 7307914
457 3004211817 3004211236 Bacteria 7417683
458 3004219064 3004218560 Bacteria 7421728
459 3004245520 3004239961 Bacteria 6892290
460 3004252805 3004248173 Bacteria 6563236
461 3004274593 3004268573 Bacteria 7043476
462 3004277474 3004275668 Bacteria 7114440
463 3004341172 3004334049 Bacteria 8449246
464 637074060 637000159 Bacteria 7596297
465 649874068 649633066 Bacteria 6690028
466 8002285802 8002285264 Bacteria 6717907
467 8004301677 8004300914 Bacteria 6132239
468 8004320966 8004312739 Bacteria 7444653
469 8004362707 8004361976 Bacteria 6858373
470 8004379378 8004374579 Bacteria 6898112
471 8004394594 8004387939 Bacteria 7049250
472 8004398774 8004395343 Bacteria 6620908
473 8004447675 8004445564 Bacteria 6322258
474 8004636498 8004633249 Bacteria 6723080
475 8004640251 8004640170 Bacteria 6723001
476 8004709777 8004703790 Bacteria 8006957
477 8004720680 8004714634 Bacteria 6776161
478 8045865554 8045864390 Bacteria 5043873
479 8055621399 8055617313 Bacteria 7548464
480 Ga0070665_100186244
481 JGI25157J39369_1000467
482 JGI25165J46597_1000325
483 Ga0006562J51391_1007330
484 Ga0055542_1000740
485 Ga0055529_1005691
486 Ga0070658_10153083
487 Ga0070660_100188801
488 Ga0070659_100073331
489 Ga0070659_100216238
490 Ga0070711_100405793
491 Ga0070663_100004324
492 Ga0068867_100313201
493 Ga0068853_100111177
494 Ga0068853_100157533
495 Ga0068853_100512302
496 Ga0070665_100042863
497 Ga0070665_100236168
498 Ga0068852_100269626
499 Ga0081540_1063095
500 Ga0081539_10001955
501 Ga0075365_10040802
502 Ga0075365_10058604
503 Ga0075365_10089074
504 Ga0075368_10021177
505 Ga0075363_100046556
506 Ga0075364_10001433
507 Ga0075364_10022733
508 Ga0075367_10031840
509 Ga0075367_10037567
510 Ga0075367_10073304
511 Ga0075369_10004047
512 Ga0075370_10020196
513 Ga0105240_10314807
514 Ga0105240_10498515
515 Ga0105241_10069374
516 Ga0105248_10456255
517 Ga0105237_10005898
518 Ga0105238_10011247
519 Ga0105239_10019303
520 Ga0105239_10227880
521 Ga0157370_10122186
522 Ga0182008_10017730
523 Ga0157376_10243304
524 Ga0209026_1000024
525 Ga0209148_1000050
526 Ga0209759_1000302
527 Ga0209233_1000027
528 Ga0209233_1028451
529 Ga0209455_1000575
530 Ga0209758_1016424
531 Ga0207695_10146183
532 Ga0207695_10200015
533 Ga0207695_10269320
534 Ga0207671_10041284
535 Ga0207671_10101850
536 Ga0207657_10144178
537 Ga0207694_10036216
538 Ga0207694_10088767
539 Ga0207690_10140003
540 Ga0207669_10107169
541 Ga0207639_10221118
542 Ga0207639_10355115
543 Ga0207678_10060246
544 Ga0207678_10070286
545 Ga0207702_10105942
546 Ga0207648_10225092
547 Ga0268266_10034602
548 Ga0268266_10056709
549 Ga0316584_0213408
550 Ga0395899_0000144
551 Ga0395900_0000027
552 Ga0395900_0016450
553 Ga0395900_0085171
554 Ga0395900_0264909
555 Ga0395898_0000043
556 Ga0395898_0307936
557 Ga0395905_0000032
558 Ga0395905_0015694
559 Ga0395905_0128216
560 Ga0395905_0198843
561 Ga0395901_0000056
562 Ga0395901_0113269
563 Ga0395901_0136115
564 Ga0395901_0153567
565 Ga0395901_0228782
566 Ga0439465_0062130
567 Ga0439445_0037113
568 Ga0466972_0013088
569 Ga0466965_0127879
570 Ga0495638_0001366
571 Ga0495660_0101231
572 Ga0495626_0030384
573 Ga0496102_0075265
574 Ga0496105_0263369
575 Ga0496110_0727468
576 Ga0496112_0044770
577 Ga0496118_0079696
578 Ga0496119_0037793
579 Ga0496119_0052303
580 Ga0496119_0057559
581 Ga0496120_0008614
582 Ga0496120_0018760
583 Ga0496125_0087210
584 Ga0496126_0206648
585 Ga0496126_0220973
586 Ga0501031_0000035
587 Ga0501031_0053487
588 Ga0501031_0075004
589 Ga0501031_0127029
590 Ga0501031_0165081
591 Ga0501031_0322370
592 Ga0501032_0000022
593 Ga0501032_0000192
594 Ga0501032_0136875
595 Ga0501032_0191883
596 Ga0501033_0000037
597 Ga0501033_0000623
598 Ga0501033_0015165
599 Ga0501033_0129983
600 Ga0501034_0000556
601 Ga0501034_0000634
602 Ga0501034_0007557
603 Ga0501034_0008817
604 Ga0501034_0019825
605 Ga0501034_0283458
606 Ga0501036_0000013
607 Ga0501036_0016114
608 Ga0501036_0331061
609 Ga0501037_0000016
610 Ga0501037_0000084
611 Ga0501037_0000296
612 Ga0501037_0171240
613 Ga0501038_0000015
614 Ga0501038_0000106
615 Ga0501038_0075044
616 Ga0501038_0149478
617 Ga0501038_0272136
618 Ga0501039_0000003
619 Ga0501039_0000013
620 Ga0501039_0031734
621 Ga0501040_0037667
622 Ga0501042_0059030
623 Ga0501043_0000029
624 Ga0501043_0000068
625 Ga0501043_0000299
626 Ga0501043_0025119
627 Ga0501043_0027001
628 Ga0501046_0020621
629 Ga0501046_0036800
630 Ga0501047_0013575
631 Ga0501047_0156406
632 Ga0501067_0004819
633 Ga0501067_0086030
634 Ga0501067_0114008
635 Ga0501068_0038255
636 Ga0501069_0000031
637 Ga0501069_0019697
638 Ga0501070_0000045
639 Ga0501070_0033482
640 Ga0501070_0039970
641 Ga0501070_0100617
642 Ga0501071_0002735
643 Ga0501074_0000012
644 Ga0501074_0021563
645 Ga0501074_0038084
646 Ga0501080_0001260
647 Ga0501080_0010046
648 Ga0501080_0067414
649 Ga0501080_0350893
650 Ga0501035_0000032
651 Ga0501035_0000046
652 Ga0501035_0001379
653 Ga0501035_0002234
654 Ga0501035_0012840
655 Ga0501035_0016958
656 Ga0501035_0028744
657 Ga0501035_0141565
658 Ga0501035_0166145
659 Ga0501035_0186441
660 Ga0501044_0000038
661 Ga0501044_0000113
662 Ga0501044_0013498
663 Ga0501044_0022484
664 Ga0501044_0035711
665 Ga0501044_0069186
666 Ga0501044_0074766
667 nmdc:mga03n38_27781_c1
668 nmdc:mga03n38_63594_c1
669 nmdc:mga03n38_65311_c1
670 nmdc:mga03n38_81744_c1
671 nmdc:mga00v17_27665_c1
672 nmdc:mga0yw44_247906_c1
673 nmdc:mga0yw44_4883_c1
674 nmdc:mga0yw44_67748_c1
675 nmdc:mga0yw44_91232_c1
676 nmdc:mga04h51_35233_c1
677 nmdc:mga07m45_68272_c1
678 nmdc:mga0sz30_4962_c1
679 Ga0500610_0105825
680 Ga0500595_016834
681 Ga0500568_0000056
682 Ga0500616_0066134
683 Ga0500620_000116
684 Ga0500620_042040
685 Ga0501082_0197566
686 2503202084
687 2509115625
688 2509141812
689 2509373417
690 2509396733
691 2510317635
692 2511389422
693 2512931019
694 2512958749
695 2513611038
696 2514034837
697 2514418538
698 2514590274
699 2535484801
700 2588516775
701 2599940477
702 2643771847
703 2643775765
704 2643794212
705 2643840527
706 2643989255
707 2644129934
708 2644152827
709 2688599565
710 2694629769
711 2694636358
712 2723575843
713 2739310505
714 2753359414
715 2756677282
716 2757570840
717 2758641675
718 2770197650
719 2776271678
720 2776279810
721 2792749838
722 2837653019
723 2839995242
724 2840770000
725 2841739893
726 2842872766
727 2844006295
728 2844014842
729 2847676039
730 2847692681
731 2854911959
732 2856315826
733 2856325716
734 2856334085
735 2856341195
736 2856342734
737 2856354428
738 2856362671
739 2856370593
740 2857350574
741 2857370151
742 2869164341
743 2869244305
744 2869263659
745 2869266140
746 2869274337
747 2869279334
748 2869291679
749 2871434889
750 2871444216
751 2871452805
752 2871468056
753 2871481340
754 2871495510
755 2871502783
756 2874106090
757 2874112010
758 2874119080
759 2874130955
760 2874136905
761 2874145081
762 2874149279
763 2874157543
764 2874165563
765 2874176070
766 2876365829
767 2876374592
768 2876391702
769 2876394683
770 2876402177
771 2876412565
772 2876415745
773 2876423500
774 2878040094
775 2878743280
776 2878752023
777 2878757866
778 2878766675
779 2878773872
780 2878776419
781 2881152034
782 2881155758
783 2881168012
784 2881848590
785 2881854248
786 2881864759
787 2882637120
788 2885309896
789 2885316993
790 2885323838
791 2885341512
792 2885344531
793 2885353642
794 2888340008
795 2888347348
796 2888356259
797 2889011185
798 2889017090
799 2889794063
800 2889917984
801 2894819911
802 2903455518
803 2903493418
804 2903506612
805 2903523846
806 2903534292
807 2903547922
808 2904583332
809 2904661316
810 2906314417
811 2906327586
812 2906329384
813 2906362817
814 2906363747
815 2906374731
816 2906381130
817 2906397311
818 2906407102
819 2906410692
820 2906415963
821 2915653901
822 2919121048
823 2922138525
824 2922158387
825 2922162163
826 2922175992
827 2922183428
828 2924727135
829 2924739162
830 2924747534
831 2924751260
832 2924766895
833 2924781091
834 2924784580
835 2928523225
836 2937816279
837 2937825107
838 2937837912
839 2937847473
840 2937855004
841 2937862076
842 2937871106
843 2937877515
844 2937896994
845 2937975402
846 2938001799
847 2954015495
848 2958035474
849 2958043661
850 2958067874
851 2958074096
852 2958084622
853 2958101602
854 2958114905
855 2958118875
856 2958129283
857 2958136079
858 2958151803
859 2958162060
860 2958171854
861 2958175966
862 2958185546
863 2961083924
864 2961116469
865 2961128175
866 2961139947
867 2961170300
868 2961174410
869 2961184908
870 2963648204
871 2965025046
872 2965027804
873 2965044263
874 2965049113
875 2965068254
876 2965089618
877 2965111957
878 2965126980
879 2968000401
880 2968003688
881 2968017979
882 2968091028
883 2968095798
884 2968100778
885 2968112375
886 2968121170
887 2968132746
888 2968178687
889 2970471846
890 2970490252
891 2970506997
892 2970513003
893 2970531600
894 2970532516
895 2970549456
896 2970561532
897 2970593930
898 2970627739
899 2977822399
900 2977834509
901 2977846513
902 2977855495
903 2977859435
904 2977865779
905 2977874071
906 2977901260
907 2977911927
908 2977929325
909 2977936907
910 2977947712
911 2977955462
912 2977958359
913 2977978733
914 2977987505
915 2979714808
916 2979784083
917 2979797394
918 2979812192
919 2987637758
920 2987648907
921 2987658572
922 2987666541
923 2987668764
924 2987673559
925 2996311247
926 2996341161
927 2996342604
928 2996350776
929 2996393057
930 3000140106
931 3002144035
932 3004169433
933 3004195543
934 3004196732
935 3004205920
936 3004211817
937 3004219064
938 3004245520
939 3004252805
940 3004274593
941 3004277474
942 3004341172
943 637074060
944 649874068
945 8002285802
946 8004301677
947 8004320966
948 8004362707
949 8004379378
950 8004394594
951 8004398774
952 8004447675
953 8004636498
954 8004640251
955 8004709777
956 8004720680
957 8045865554
958 8055621399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01734

Patatin

Patatin-like phospholipase

58

218

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fqu-assembly1.cif.gz_B orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.7434 34 317
5fqu-assembly1.cif.gz_A orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.7407 34 317
5fya-assembly1.cif.gz_B cubic crystal of the native plpd 0.7389 34 318
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.7357 35 317
5fqu-assembly1.cif.gz_B orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.7349 34 317
ID Description Score Start End Superfamily
af_K7LIJ4_222_448_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7525 34 207 3.40.1090.10
af_A2AJ88_944_1192_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.692 32 252 3.40.1090.10
af_A0A0P0XFP9_51_260_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6817 35 188 3.40.1090.10
af_O69695_801_1044_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6782 35 298 3.40.1090.10
af_Q4CYT0_175_370_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6734 38 185 3.40.1090.10
ID Description Score Start End GO Terms
AF-A0A849TJF7-F1-model_v4 NTE family protein rssA 0.8771 32 217 GO:0016042
GO:0016787
AF-A0A136LRH6-F1-model_v4 Patatin 0.8635 35 207 GO:0016042
GO:0016787
AF-A0A447KXM0-F1-model_v4 NTE family protein rssA 0.8579 35 213 GO:0016042
GO:0016787
AF-A0A661G757-F1-model_v4 Serine protease 0.8409 32 210 GO:0006508
GO:0008233
GO:0016042
AF-A0A661VI81-F1-model_v4 PNPLA domain-containing protein 0.8407 27 205 GO:0016042
GO:0016787

Map