F452073

General Info

Members Datasets Scaffolds Average Seq Length
479 296 958 275

Family's Representative Sequence

Representative Sequence 3300035121|Ga0373960_0040508|Ga0373960_0040508_249_1223
Length 324
Sequence MQGFSEAGIEAEIPSDVTNVKFLLQSGAFNRRGSMTRPGPSRVVLITGASTGIGAACAIGCALRGMTVFAGVRNLMAGAALNAEGGAAIIPLQLDVTDRDSITRAADSVKRHVGDSGLYGLVNNAGIAIGSPLELIPLDQLRKQLEVNVIGQIAVTQAVLPLLRRARGRIVNMGSIAGRSTIPMMGPYSASKHALEALTDALRLELYPWGIEVSIIEPGAIATPIWDKSLKTSLDVEAEIQTDGKHLYEDAAKAVREAVGQAAARAIPAEAVVRAVLHALTARRPRTRYLVGRDAKIRAAMMRWLPDRLQDWILKKVLHLPKAT

Samples

Sample ID Description Type Environment
1 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
189 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
190 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
191 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
192 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
248 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
249 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
265 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
266 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
267 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
268 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
289 2506783011 Frankia datiscae Dg1 Isolate Nodule
290 2643221546 Microbacterium sp. Root53 Isolate Unclassified
291 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
292 2773857933 Frankia sp. BMG5.30 Isolate Nodule
293 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
294 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
295 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
296 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0.42
Rhizoplane 9.39
Rhizosphere 86.43
Stem 0
Stem Tuber 0
Unclassified 9.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373960_0040508 3300035121 Unclassified 1345
2 JGI24034J26672_10000072 3300002239 Bacteria 25672
3 JGI24751J29686_10007924 3300002459 Bacteria 2171
4 rootH1_10073034 3300003323 Bacteria 4042
5 JGI25407J50210_10001596 3300003373 Bacteria 5171
6 Ga0055540_1016045 3300003792 Bacteria 2149
7 Ga0070658_10201425 3300005327 Bacteria 1680
8 Ga0070683_100031346 3300005329 Bacteria 4833
9 Ga0070683_100041221 3300005329 Bacteria 4246
10 Ga0070690_100011367 3300005330 Bacteria 5204
11 Ga0070670_100021583 3300005331 Bacteria 5537
12 Ga0070677_10000016 3300005333 Bacteria 52044
13 Ga0070680_100031724 3300005336 Bacteria 4248
14 Ga0070682_100082000 3300005337 Bacteria 2090
15 Ga0070682_100174749 3300005337 Unclassified 1495
16 Ga0068868_100039855 3300005338 Bacteria 3653
17 Ga0068868_100477274 3300005338 Bacteria 1089
18 Ga0070660_100240778 3300005339 Bacteria 1474
19 Ga0070689_100008515 3300005340 Bacteria 7229
20 Ga0070691_10061666 3300005341 Bacteria 1804
21 Ga0070661_100216521 3300005344 Unclassified 1467
22 Ga0070669_100016132 3300005353 Bacteria 5329
23 Ga0070669_100017253 3300005353 Bacteria 5149
24 Ga0070669_100080441 3300005353 Unclassified 2425
25 Ga0070669_100085988 3300005353 Bacteria 2349
26 Ga0070675_100240329 3300005354 Unclassified 1582
27 Ga0070671_100007938 3300005355 Bacteria 8488
28 Ga0070674_100000660 3300005356 Bacteria 17428
29 Ga0070673_100424501 3300005364 Bacteria 1192
30 Ga0070667_100006455 3300005367 Bacteria 9749
31 Ga0070667_100470149 3300005367 Bacteria 1150
32 Ga0070714_100049059 3300005435 Bacteria 3593
33 Ga0070710_10023556 3300005437 Bacteria 3238
34 Ga0070711_100004344 3300005439 Bacteria 8348
35 Ga0070711_100115229 3300005439 Bacteria 1979
36 Ga0070705_100000400 3300005440 Bacteria 25016
37 Ga0070694_100021997 3300005444 Bacteria 4083
38 Ga0070708_100039614 3300005445 Unclassified 4124
39 Ga0070708_100464526 3300005445 Unclassified 1194
40 Ga0070663_100101317 3300005455 Bacteria 2149
41 Ga0070678_100011659 3300005456 Bacteria 5432
42 Ga0070678_100431949 3300005456 Bacteria 1150
43 Ga0070681_10000818 3300005458 Bacteria 25982
44 Ga0068867_100000437 3300005459 Bacteria 27827
45 Ga0070706_100003808 3300005467 Bacteria 14735
46 Ga0070706_100096121 3300005467 Unclassified 2750
47 Ga0070707_100000708 3300005468 Bacteria 33250
48 Ga0070707_100029065 3300005468 Bacteria 5262
49 Ga0070707_100037337 3300005468 Bacteria 4636
50 Ga0070707_100414755 3300005468 Bacteria 1307
51 Ga0070707_100633662 3300005468 Bacteria 1032
52 Ga0070698_100002420 3300005471 Bacteria 20555
53 Ga0070698_100021824 3300005471 Bacteria 6705
54 Ga0070698_100028781 3300005471 Bacteria 5766
55 Ga0070698_100072897 3300005471 Bacteria 3441
56 Ga0070698_100129817 3300005471 Bacteria 2476
57 Ga0070698_100172459 3300005471 Bacteria 2103
58 Ga0070698_100201031 3300005471 Bacteria 1928
59 Ga0070699_100000095 3300005518 Bacteria 84699
60 Ga0070699_100021267 3300005518 Bacteria 5594
61 Ga0070699_100024496 3300005518 Bacteria 5201
62 Ga0070699_100033471 3300005518 Bacteria 4440
63 Ga0070699_100049086 3300005518 Bacteria 3653
64 Ga0070679_100045088 3300005530 Bacteria 4393
65 Ga0070684_100011479 3300005535 Bacteria 7055
66 Ga0070684_100201411 3300005535 Bacteria 1813
67 Ga0070684_100201809 3300005535 Bacteria 1811
68 Ga0070697_100612899 3300005536 Bacteria 957
69 Ga0070672_100020030 3300005543 Bacteria 4873
70 Ga0070672_100080910 3300005543 Bacteria 2603
71 Ga0070672_100353241 3300005543 Unclassified 1253
72 Ga0070686_100001650 3300005544 Bacteria 12461
73 Ga0070696_100042254 3300005546 Bacteria 3152
74 Ga0070696_100353854 3300005546 Bacteria 1138
75 Ga0070693_100010169 3300005547 Bacteria 4703
76 Ga0070665_100267525 3300005548 Bacteria 1711
77 Ga0070704_100000578 3300005549 Bacteria 17600
78 Ga0070664_100004844 3300005564 Bacteria 10783
79 Ga0070664_100017613 3300005564 Bacteria 5867
80 Ga0070664_100023982 3300005564 Bacteria 5041
81 Ga0070664_100031957 3300005564 Bacteria 4403
82 Ga0070664_100033411 3300005564 Bacteria 4309
83 Ga0068854_100055536 3300005578 Bacteria 2851
84 Ga0068856_100097573 3300005614 Bacteria 2928
85 Ga0068856_100234106 3300005614 Bacteria 1852
86 Ga0068856_100319789 3300005614 Bacteria 1569
87 Ga0068859_100102547 3300005617 Unclassified 2919
88 Ga0068859_100126656 3300005617 Bacteria 2623
89 Ga0068866_10000007 3300005718 Bacteria 121729
90 Ga0068870_10013818 3300005840 Unclassified 3802
91 Ga0068863_100006142 3300005841 Bacteria 11779
92 Ga0068863_100051824 3300005841 Bacteria 3889
93 Ga0068863_100369042 3300005841 Bacteria 1400
94 Ga0068863_100745130 3300005841 Bacteria 975
95 Ga0068858_100121741 3300005842 Bacteria 2440
96 Ga0068858_100284316 3300005842 Bacteria 1575
97 Ga0068860_100236784 3300005843 Bacteria 1775
98 Ga0068862_100178628 3300005844 Bacteria 1904
99 Ga0081455_10002567 3300005937 Bacteria 21554
100 Ga0081455_10033948 3300005937 Bacteria 4577
101 Ga0081455_10046203 3300005937 Bacteria 3780
102 Ga0081455_10083391 3300005937 Bacteria 2612
103 Ga0081455_10083779 3300005937 Bacteria 2605
104 Ga0081455_10136265 3300005937 Bacteria 1913
105 Ga0081538_10000035 3300005981 Bacteria 120009
106 Ga0081538_10000152 3300005981 Bacteria 71751
107 Ga0081538_10001050 3300005981 Bacteria 29447
108 Ga0081538_10040146 3300005981 Bacteria 2989
109 Ga0081539_10001387 3300005985 Bacteria 41711
110 Ga0075365_10060983 3300006038 Bacteria 2517
111 Ga0075364_10043806 3300006051 Bacteria 2910
112 Ga0097621_100003141 3300006237 Bacteria 11335
113 Ga0068871_100032698 3300006358 Bacteria 4112
114 Ga0068871_100185484 3300006358 Unclassified 1789
115 Ga0068871_100215307 3300006358 Bacteria 1663
116 Ga0075428_100026940 3300006844 Bacteria 6366
117 Ga0075428_100083590 3300006844 Bacteria 3483
118 Ga0075430_100098326 3300006846 Unclassified 2445
119 Ga0075431_100010984 3300006847 Bacteria 9114
120 Ga0075431_100051097 3300006847 Bacteria 4264
121 Ga0075431_100075618 3300006847 Unclassified 3475
122 Ga0075431_100144367 3300006847 Unclassified 2453
123 Ga0075434_100015465 3300006871 Bacteria 7318
124 Ga0075434_100103261 3300006871 Bacteria 2859
125 Ga0075429_100001675 3300006880 Bacteria 18321
126 Ga0075429_100099190 3300006880 Bacteria 2541
127 Ga0075429_100106304 3300006880 Bacteria 2452
128 Ga0075429_100190722 3300006880 Unclassified 1796
129 Ga0075429_100577690 3300006880 Bacteria 985
130 Ga0075436_100013103 3300006914 Bacteria 5684
131 Ga0097620_100102549 3300006931 Unclassified 2919
132 Ga0097620_100126652 3300006931 Bacteria 2623
133 Ga0075435_100174078 3300007076 Unclassified 1817
134 Ga0075435_100391859 3300007076 Bacteria 1194
135 Ga0111539_10261130 3300009094 Bacteria 2016
136 Ga0111539_10598838 3300009094 Unclassified 1283
137 Ga0105245_10000049 3300009098 Bacteria 128277
138 Ga0105245_10057025 3300009098 Bacteria 3512
139 Ga0105245_10135146 3300009098 Bacteria 2317
140 Ga0105245_10709722 3300009098 Bacteria 1039
141 Ga0114129_10064393 3300009147 Bacteria 5115
142 Ga0114129_10083919 3300009147 Bacteria 4423
143 Ga0114129_10163767 3300009147 Bacteria 3036
144 Ga0114129_10209721 3300009147 Bacteria 2634
145 Ga0114129_10336155 3300009147 Bacteria 2004
146 Ga0105243_10005712 3300009148 Bacteria 9667
147 Ga0105243_10137449 3300009148 Bacteria 2081
148 Ga0105241_10406832 3300009174 Unclassified 1195
149 Ga0105242_10320691 3300009176 Bacteria 1421
150 Ga0105248_10128103 3300009177 Bacteria 2864
151 Ga0105237_10406278 3300009545 Bacteria 1367
152 Ga0105238_10293045 3300009551 Bacteria 1610
153 Ga0105249_10000039 3300009553 Bacteria 196325
154 Ga0105249_10150137 3300009553 Bacteria 2243
155 Ga0105239_10058452 3300010375 Bacteria 4232
156 Ga0157374_10594419 3300013296 Unclassified 1116
157 Ga0157378_10002699 3300013297 Bacteria 15811
158 Ga0157378_10146958 3300013297 Bacteria 2193
159 Ga0157378_10213158 3300013297 Bacteria 1832
160 Ga0163162_10695634 3300013306 Bacteria 1138
161 Ga0157375_10426464 3300013308 Bacteria 1492
162 Ga0163163_10004715 3300014325 Bacteria 11680
163 Ga0163163_10515136 3300014325 Bacteria 1258
164 Ga0157379_10049023 3300014968 Bacteria 3770
165 Ga0157379_10101119 3300014968 Bacteria 2587
166 Ga0157376_10009116 3300014969 Bacteria 7193
167 Ga0157376_10305447 3300014969 Bacteria 1508
168 Ga0182007_10025146 3300015262 Unclassified 2076
169 Ga0163161_10000013 3300017792 Bacteria 258747
170 Ga0213873_10002474 3300021358 Bacteria 3199
171 Ga0209051_1005472 3300025303 Bacteria 7411
172 Ga0207682_10000409 3300025893 Bacteria 19717
173 Ga0207692_10006199 3300025898 Bacteria 4841
174 Ga0207642_10000008 3300025899 Bacteria 132651
175 Ga0207685_10000003 3300025905 Bacteria 344527
176 Ga0207705_10147167 3300025909 Bacteria 1763
177 Ga0207684_10004500 3300025910 Bacteria 13106
178 Ga0207684_10080377 3300025910 Unclassified 2773
179 Ga0207707_10010499 3300025912 Bacteria 8038
180 Ga0207663_10000297 3300025916 Bacteria 21600
181 Ga0207660_10012383 3300025917 Bacteria 5580
182 Ga0207660_10037570 3300025917 Bacteria 3375
183 Ga0207662_10051396 3300025918 Unclassified 2452
184 Ga0207657_10249405 3300025919 Bacteria 1416
185 Ga0207652_10055509 3300025921 Bacteria 3407
186 Ga0207646_10004513 3300025922 Bacteria 15081
187 Ga0207646_10076075 3300025922 Bacteria 2999
188 Ga0207681_10079708 3300025923 Bacteria 2308
189 Ga0207694_10253193 3300025924 Bacteria 1441
190 Ga0207650_10149088 3300025925 Bacteria 1844
191 Ga0207659_10012636 3300025926 Bacteria 5382
192 Ga0207659_10339412 3300025926 Bacteria 1244
193 Ga0207687_10000189 3300025927 Bacteria 41272
194 Ga0207687_10136889 3300025927 Bacteria 1853
195 Ga0207687_10365797 3300025927 Bacteria 1178
196 Ga0207664_10040141 3300025929 Bacteria 3637
197 Ga0207644_10009299 3300025931 Bacteria 6451
198 Ga0207706_10001023 3300025933 Bacteria 28500
199 Ga0207706_10239779 3300025933 Bacteria 1585
200 Ga0207686_10013735 3300025934 Unclassified 4490
201 Ga0207686_10061412 3300025934 Bacteria 2382
202 Ga0207709_10031354 3300025935 Unclassified 3104
203 Ga0207709_10113829 3300025935 Bacteria 1814
204 Ga0207669_10000475 3300025937 Bacteria 17506
205 Ga0207669_10031695 3300025937 Unclassified 2957
206 Ga0207669_10074304 3300025937 Bacteria 2149
207 Ga0207691_10006175 3300025940 Bacteria 11580
208 Ga0207691_10043657 3300025940 Bacteria 4130
209 Ga0207661_10010994 3300025944 Bacteria 6539
210 Ga0207661_10093944 3300025944 Bacteria 2504
211 Ga0207679_10012497 3300025945 Bacteria 5537
212 Ga0207679_10013779 3300025945 Bacteria 5302
213 Ga0207679_10030869 3300025945 Bacteria 3746
214 Ga0207679_10050767 3300025945 Bacteria 3032
215 Ga0207679_10195401 3300025945 Bacteria 1686
216 Ga0207667_10126244 3300025949 Unclassified 2635
217 Ga0207712_10000003 3300025961 Bacteria 615314
218 Ga0207668_10358578 3300025972 Bacteria 1221
219 Ga0207658_10005453 3300025986 Bacteria 8725
220 Ga0207658_10087605 3300025986 Bacteria 2405
221 Ga0207677_10035665 3300026023 Bacteria 3233
222 Ga0207677_10143120 3300026023 Unclassified 1834
223 Ga0207677_10301572 3300026023 Bacteria 1324
224 Ga0207703_10497889 3300026035 Bacteria 1143
225 Ga0207708_10002662 3300026075 Bacteria 13123
226 Ga0207708_10099833 3300026075 Bacteria 2246
227 Ga0207702_10055698 3300026078 Bacteria 3354
228 Ga0207641_10002088 3300026088 Bacteria 18922
229 Ga0207641_10343254 3300026088 Bacteria 1421
230 Ga0207641_10489934 3300026088 Bacteria 1192
231 Ga0207648_10000999 3300026089 Bacteria 31945
232 Ga0207648_10012153 3300026089 Bacteria 8069
233 Ga0207683_10009335 3300026121 Bacteria 8356
234 Ga0207683_10459270 3300026121 Bacteria 1174
235 Ga0209969_1000199 3300027360 Bacteria 8006
236 Ga0209967_1001015 3300027364 Unclassified 3586
237 Ga0209996_1000460 3300027395 Bacteria 4881
238 Ga0210000_1000245 3300027462 Bacteria 7722
239 Ga0209968_1000126 3300027526 Bacteria 13553
240 Ga0209970_1004145 3300027614 Unclassified 2413
241 Ga0209971_1003105 3300027682 Unclassified 3965
242 Ga0209966_1000139 3300027695 Bacteria 30744
243 Ga0209998_10000598 3300027717 Bacteria 9679
244 Ga0209974_10000113 3300027876 Bacteria 23369
245 Ga0209974_10000683 3300027876 Bacteria 11549
246 Ga0207428_10043539 3300027907 Unclassified 3625
247 Ga0268266_10002458 3300028379 Bacteria 19817
248 Ga0268266_10143187 3300028379 Bacteria 2147
249 Ga0268265_10119518 3300028380 Bacteria 2168
250 Ga0268264_10001856 3300028381 Bacteria 19212
251 Ga0268264_10099568 3300028381 Bacteria 2523
252 Ga0265337_1000349 3300028556 Bacteria 24642
253 Ga0265326_10000132 3300028558 Bacteria 38517
254 Ga0265322_10000012 3300028654 Bacteria 152373
255 Ga0265338_10016509 3300028800 Bacteria 8026
256 Ga0265338_10347098 3300028800 Bacteria 1068
257 Ga0265324_10000466 3300029957 Bacteria 28483
258 Ga0265328_10003240 3300031239 Bacteria 7215
259 Ga0265320_10000001 3300031240 Bacteria 847191
260 Ga0265329_10003910 3300031242 Bacteria 6376
261 Ga0265339_10048896 3300031249 Bacteria 2317
262 Ga0265331_10020602 3300031250 Bacteria 3383
263 Ga0265327_10000003 3300031251 Bacteria 852750
264 Ga0265316_10116971 3300031344 Bacteria 2015
265 Ga0265313_10074063 3300031595 Bacteria 1562
266 Ga0265314_10000334 3300031711 Bacteria 66204
267 Ga0316578_10193531 3300031728 Bacteria 1225
268 Ga0307405_10358158 3300031731 Bacteria 1128
269 Ga0307413_10120513 3300031824 Bacteria 1776
270 Ga0307413_10151145 3300031824 Bacteria 1618
271 Ga0307406_10002717 3300031901 Bacteria 9644
272 Ga0307409_100017724 3300031995 Bacteria 4758
273 Ga0307409_100061599 3300031995 Bacteria 2933
274 Ga0307409_100524434 3300031995 Unclassified 1158
275 Ga0307416_100025943 3300032002 Bacteria 4309
276 Ga0307416_100029776 3300032002 Bacteria 4084
277 Ga0307416_100098254 3300032002 Unclassified 2539
278 Ga0307414_10143856 3300032004 Bacteria 1871
279 Ga0307411_10091060 3300032005 Bacteria 2129
280 Ga0307411_10237448 3300032005 Bacteria 1425
281 Ga0307415_100107079 3300032126 Bacteria 2065
282 Ga0307415_100426685 3300032126 Bacteria 1139
283 Ga0373934_0043704 3300035086 Bacteria 1771
284 Ga0373954_0012373 3300035118 Bacteria 3793
285 Ga0373956_0009666 3300035119 Bacteria 3926
286 Ga0373924_0057007 3300035410 Bacteria 1628
287 Ga0373927_0177129 3300035695 Bacteria 1398
288 Ga0373927_0302153 3300035695 Bacteria 1053
289 Ga0373933_0039037 3300035724 Bacteria 2792
290 Ga0373937_0026867 3300036401 Bacteria 5203
291 Ga0373937_0437306 3300036401 Bacteria 1242
292 Ga0373925_0192882 3300037068 Bacteria 1617
293 Ga0395900_0100007 3300037418 Bacteria 2978
294 Ga0395905_0000028 3300037471 Bacteria 294492
295 Ga0395901_0047136 3300038443 Bacteria 4475
296 Ga0436365_1757162 3300039437 Bacteria 1044
297 Ga0436361_0628394 3300039447 Bacteria 9381
298 Ga0436362_1129453 3300039453 Bacteria 10713
299 Ga0439466_0021560 3300041411 Bacteria 2281
300 Ga0451791_0393948 3300041451 Bacteria 3320
301 Ga0451795_1701782 3300041456 Bacteria 2871
302 Ga0451802_1551305 3300041460 Bacteria 1746
303 Ga0451806_602743 3300041462 Bacteria 1494
304 Ga0451833_0178340 3300041491 Bacteria 4393
305 Ga0451839_1362152 3300041496 Bacteria 1791
306 Ga0439452_004605 3300042010 Bacteria 4586
307 Ga0450902_010218 3300042137 Bacteria 1484
308 Ga0439446_0018186 3300042156 Bacteria 1967
309 Ga0439460_0027592 3300042461 Bacteria 1596
310 Ga0453684_0020459 3300044712 Bacteria 9977
311 Ga0451576_0047157 3300045051 Unclassified 4531
312 Ga0451576_0057136 3300045051 Bacteria 4079
313 Ga0451576_0256192 3300045051 Bacteria 1829
314 Ga0466967_0082296 3300045976 Bacteria 2909
315 Ga0466967_0125064 3300045976 Bacteria 2381
316 Ga0466967_0387543 3300045976 Bacteria 1358
317 Ga0495592_0002059 3300046454 Bacteria 14160
318 Ga0495592_0045984 3300046454 Bacteria 3255
319 Ga0495603_0021438 3300046455 Bacteria 3914
320 Ga0495629_0067001 3300046459 Bacteria 2506
321 Ga0495651_0447278 3300046462 Bacteria 835
322 Ga0495653_0001280 3300046463 Bacteria 19454
323 Ga0495653_0046252 3300046463 Bacteria 3371
324 Ga0495653_0171782 3300046463 Bacteria 1496
325 Ga0495662_0000682 3300046476 Bacteria 16040
326 Ga0495606_0006513 3300046507 Bacteria 10745
327 Ga0495608_0003899 3300046511 Bacteria 10724
328 Ga0495618_0000053 3300046514 Bacteria 84115
329 Ga0495618_0000108 3300046514 Bacteria 60531
330 Ga0495618_0070749 3300046514 Bacteria 2219
331 Ga0495628_0007021 3300046516 Bacteria 9761
332 Ga0495628_0010374 3300046516 Bacteria 7918
333 Ga0495628_0255394 3300046516 Bacteria 1307
334 Ga0495630_0000162 3300046517 Bacteria 52137
335 Ga0495630_0002121 3300046517 Bacteria 13796
336 Ga0495652_0000009 3300046529 Bacteria 311000
337 Ga0495652_0025744 3300046529 Bacteria 5200
338 Ga0495640_0010527 3300046533 Bacteria 7142
339 Ga0495640_0067408 3300046533 Bacteria 2410
340 Ga0495645_0000018 3300046543 Bacteria 155263
341 Ga0495645_0027443 3300046543 Bacteria 4137
342 Ga0495645_0055621 3300046543 Bacteria 2873
343 Ga0495667_0000109 3300046559 Bacteria 59985
344 Ga0495656_0000721 3300046615 Bacteria 10685
345 Ga0495656_0020113 3300046615 Bacteria 2586
346 Ga0495634_0000021 3300046642 Bacteria 120521
347 Ga0495634_0001593 3300046642 Bacteria 19872
348 Ga0495634_0370215 3300046642 Bacteria 855
349 Ga0495635_0000006 3300046663 Bacteria 301820
350 Ga0495635_0074136 3300046663 Bacteria 2331
351 Ga0495657_0000016 3300046675 Bacteria 183127
352 Ga0495599_0117966 3300046678 Bacteria 1650
353 Ga0495623_0138435 3300046679 Bacteria 1450
354 Ga0495647_0000002 3300046681 Bacteria 174959
355 Ga0495669_0000493 3300046684 Bacteria 18156
356 Ga0495613_0000042 3300046689 Bacteria 130403
357 Ga0495624_0000005 3300046690 Bacteria 158127
358 Ga0495600_0000922 3300046809 Bacteria 15759
359 Ga0495604_0003275 3300047317 Bacteria 12942
360 Ga0495674_0000961 3300047319 Bacteria 27559
361 Ga0495676_0013442 3300047321 Bacteria 7355
362 Ga0495680_0000094 3300047322 Bacteria 80355
363 Ga0495680_0001999 3300047322 Bacteria 21403
364 Ga0495680_0068998 3300047322 Bacteria 2699
365 Ga0495685_066341 3300047447 Unclassified 1212
366 Ga0495686_0008917 3300047472 Bacteria 7291
367 Ga0495602_0182613 3300048088 Bacteria 1616
368 Ga0496100_0132500 3300048903 Bacteria 1757
369 Ga0496100_0432075 3300048903 Bacteria 1007
370 Ga0496101_0038531 3300048904 Bacteria 3395
371 Ga0496101_0042436 3300048904 Bacteria 3247
372 Ga0496102_0003898 3300048905 Bacteria 12640
373 Ga0496102_0028952 3300048905 Bacteria 4952
374 Ga0496103_0026332 3300048906 Bacteria 3521
375 Ga0496103_0036457 3300048906 Bacteria 3012
376 Ga0496104_0000214 3300048907 Bacteria 51141
377 Ga0496104_0000992 3300048907 Bacteria 24270
378 Ga0496104_0028178 3300048907 Bacteria 5205
379 Ga0496104_0072770 3300048907 Bacteria 3269
380 Ga0496104_0103587 3300048907 Bacteria 2726
381 Ga0496105_0000876 3300048908 Bacteria 20602
382 Ga0496105_0002662 3300048908 Bacteria 13010
383 Ga0496105_0003424 3300048908 Bacteria 11740
384 Ga0496105_0116067 3300048908 Bacteria 2208
385 Ga0496106_0000101 3300048909 Bacteria 65644
386 Ga0496106_0151611 3300048909 Bacteria 1829
387 Ga0496107_0040408 3300048910 Bacteria 3348
388 Ga0496107_0332501 3300048910 Bacteria 1130
389 Ga0496108_0002650 3300048911 Bacteria 14342
390 Ga0496108_0152857 3300048911 Bacteria 1992
391 Ga0496109_0004618 3300048912 Bacteria 11496
392 Ga0496109_0009730 3300048912 Bacteria 8207
393 Ga0496109_0035600 3300048912 Bacteria 4492
394 Ga0496109_0256556 3300048912 Bacteria 1647
395 Ga0496110_0003337 3300048913 Bacteria 12268
396 Ga0496110_0114179 3300048913 Bacteria 2430
397 Ga0496110_0126654 3300048913 Bacteria 2304
398 Ga0496110_0126785 3300048913 Bacteria 2303
399 Ga0496110_0183878 3300048913 Bacteria 1898
400 Ga0496111_0000850 3300048914 Bacteria 16511
401 Ga0496111_0216521 3300048914 Bacteria 1423
402 Ga0496113_0015794 3300048916 Bacteria 5202
403 Ga0496113_0052550 3300048916 Bacteria 3044
404 Ga0496114_0001632 3300048917 Bacteria 17022
405 Ga0496114_0064329 3300048917 Bacteria 3072
406 Ga0496114_0325521 3300048917 Bacteria 1358
407 Ga0496115_0005201 3300048918 Bacteria 9463
408 Ga0496115_0022707 3300048918 Bacteria 4865
409 Ga0496118_0155155 3300048921 Bacteria 1426
410 Ga0501295_003866 3300049518 Bacteria 1890
411 Ga0501298_002384 3300049521 Bacteria 2838
412 Ga0501303_000571 3300049526 Unclassified 2862
413 Ga0501032_0386740 3300049569 Bacteria 899
414 Ga0501034_0643800 3300049571 Bacteria 962
415 Ga0501039_0284417 3300049575 Bacteria 1300
416 Ga0501040_0251880 3300049576 Bacteria 1260
417 Ga0501040_0382207 3300049576 Bacteria 1010
418 Ga0501041_0196000 3300049577 Bacteria 1266
419 Ga0501042_0168352 3300049578 Bacteria 1581
420 Ga0501046_0044763 3300049580 Bacteria 3519
421 Ga0501047_0033060 3300049581 Bacteria 4994
422 Ga0501047_0033722 3300049581 Bacteria 4941
423 Ga0501068_0054729 3300049584 Unclassified 2417
424 Ga0501068_0094684 3300049584 Unclassified 1846
425 Ga0501071_0213394 3300049587 Unclassified 1452
426 Ga0501072_0501908 3300049588 Bacteria 960
427 Ga0501073_0004896 3300049589 Bacteria 10051
428 Ga0501073_0072278 3300049589 Bacteria 2402
429 Ga0501073_0284384 3300049589 Bacteria 1141
430 Ga0501075_0459306 3300049591 Bacteria 971
431 Ga0501076_0170672 3300049592 Bacteria 1773
432 Ga0501076_0234095 3300049592 Bacteria 1502
433 Ga0501216_000731 3300049660 Bacteria 4076
434 Ga0501249_048034 3300049679 Unclassified 976
435 Ga0501258_006463 3300049687 Unclassified 1165
436 Ga0501266_010140 3300049763 Unclassified 1196
437 Ga0501271_000800 3300049768 Bacteria 2675
438 Ga0501035_0226474 3300049822 Bacteria 1595
439 Ga0501035_0372791 3300049822 Unclassified 1191
440 Ga0501044_0107371 3300049823 Bacteria 2803
441 nmdc:mga00v17_37638_c1 3300050491 Bacteria 2890
442 nmdc:mga0yw44_350120_c1 3300050492 Bacteria 994
443 nmdc:mga0yw44_444863_c1 3300050492 Bacteria 878
444 nmdc:mga05p37_173835_c1 3300050507 Bacteria 2625
445 nmdc:mga05p37_19378_c1 3300050507 Bacteria 8231
446 nmdc:mga09592_116648_c1 3300050508 Bacteria 2291
447 nmdc:mga09592_146955_c1 3300050508 Bacteria 2032
448 nmdc:mga09592_203176_c1 3300050508 Bacteria 1716
449 nmdc:mga09592_81203_c1 3300050508 Unclassified 2763
450 nmdc:mga0qj67_16009_c1 3300050509 Bacteria 5680
451 nmdc:mga0qj67_42122_c1 3300050509 Bacteria 3594
452 nmdc:mga0qj67_50409_c1 3300050509 Bacteria 3292
453 nmdc:mga06r32_65889_c1 3300050510 Bacteria 3495
454 nmdc:mga08y16_647898_c1 3300050511 Bacteria 1061
455 nmdc:mga0n895_167982_c1 3300050512 Bacteria 2226
456 nmdc:mga0rr50_336192_c1 3300050513 Bacteria 1268
457 nmdc:mga0rr50_520443_c1 3300050513 Bacteria 1012
458 nmdc:mga0rr50_65656_c1 3300050513 Bacteria 2750
459 nmdc:mga08x19_326749_c1 3300050514 Bacteria 1068
460 Ga0495601_0000185 3300053077 Bacteria 33092
461 Ga0495601_0049990 3300053077 Bacteria 2637
462 Ga0495601_0208056 3300053077 Bacteria 1278
463 Ga0495612_0000027 3300053078 Bacteria 100974
464 Ga0495612_0004574 3300053078 Bacteria 5738
465 Ga0495595_0000066 3300053084 Bacteria 51901
466 Ga0495619_0017555 3300053085 Bacteria 4532
467 Ga0500643_021304 3300053087 Bacteria 2102
468 Ga0501084_0000328 3300054114 Bacteria 36335
469 Ga0590075_015856 3300059424 Bacteria 1850
470 Ga0530510_0047973 3300061734 Bacteria 3087
471 Ga0530510_0292803 3300061734 Bacteria 1217
472 2506866144 2506783011 Bacteria 5323186
473 2643751894 2643221546 Bacteria 2910897
474 2644538370 2643221697 Bacteria 3575694
475 2774902477 2773857933 Bacteria 5818019
476 2896256559 2896253425 Bacteria 3418029
477 2902840147 2902837492 Bacteria 6697721
478 3003002128 3002998708 Bacteria 11715108
479 3006322120 3006321560 Bacteria 8247479
480 Ga0373960_0040508
481 JGI24034J26672_10000072
482 JGI24751J29686_10007924
483 rootH1_10073034
484 JGI25407J50210_10001596
485 Ga0055540_1016045
486 Ga0070658_10201425
487 Ga0070683_100031346
488 Ga0070683_100041221
489 Ga0070690_100011367
490 Ga0070670_100021583
491 Ga0070677_10000016
492 Ga0070680_100031724
493 Ga0070682_100082000
494 Ga0070682_100174749
495 Ga0068868_100039855
496 Ga0068868_100477274
497 Ga0070660_100240778
498 Ga0070689_100008515
499 Ga0070691_10061666
500 Ga0070661_100216521
501 Ga0070669_100016132
502 Ga0070669_100017253
503 Ga0070669_100080441
504 Ga0070669_100085988
505 Ga0070675_100240329
506 Ga0070671_100007938
507 Ga0070674_100000660
508 Ga0070673_100424501
509 Ga0070667_100006455
510 Ga0070667_100470149
511 Ga0070714_100049059
512 Ga0070710_10023556
513 Ga0070711_100004344
514 Ga0070711_100115229
515 Ga0070705_100000400
516 Ga0070694_100021997
517 Ga0070708_100039614
518 Ga0070708_100464526
519 Ga0070663_100101317
520 Ga0070678_100011659
521 Ga0070678_100431949
522 Ga0070681_10000818
523 Ga0068867_100000437
524 Ga0070706_100003808
525 Ga0070706_100096121
526 Ga0070707_100000708
527 Ga0070707_100029065
528 Ga0070707_100037337
529 Ga0070707_100414755
530 Ga0070707_100633662
531 Ga0070698_100002420
532 Ga0070698_100021824
533 Ga0070698_100028781
534 Ga0070698_100072897
535 Ga0070698_100129817
536 Ga0070698_100172459
537 Ga0070698_100201031
538 Ga0070699_100000095
539 Ga0070699_100021267
540 Ga0070699_100024496
541 Ga0070699_100033471
542 Ga0070699_100049086
543 Ga0070679_100045088
544 Ga0070684_100011479
545 Ga0070684_100201411
546 Ga0070684_100201809
547 Ga0070697_100612899
548 Ga0070672_100020030
549 Ga0070672_100080910
550 Ga0070672_100353241
551 Ga0070686_100001650
552 Ga0070696_100042254
553 Ga0070696_100353854
554 Ga0070693_100010169
555 Ga0070665_100267525
556 Ga0070704_100000578
557 Ga0070664_100004844
558 Ga0070664_100017613
559 Ga0070664_100023982
560 Ga0070664_100031957
561 Ga0070664_100033411
562 Ga0068854_100055536
563 Ga0068856_100097573
564 Ga0068856_100234106
565 Ga0068856_100319789
566 Ga0068859_100102547
567 Ga0068859_100126656
568 Ga0068866_10000007
569 Ga0068870_10013818
570 Ga0068863_100006142
571 Ga0068863_100051824
572 Ga0068863_100369042
573 Ga0068863_100745130
574 Ga0068858_100121741
575 Ga0068858_100284316
576 Ga0068860_100236784
577 Ga0068862_100178628
578 Ga0081455_10002567
579 Ga0081455_10033948
580 Ga0081455_10046203
581 Ga0081455_10083391
582 Ga0081455_10083779
583 Ga0081455_10136265
584 Ga0081538_10000035
585 Ga0081538_10000152
586 Ga0081538_10001050
587 Ga0081538_10040146
588 Ga0081539_10001387
589 Ga0075365_10060983
590 Ga0075364_10043806
591 Ga0097621_100003141
592 Ga0068871_100032698
593 Ga0068871_100185484
594 Ga0068871_100215307
595 Ga0075428_100026940
596 Ga0075428_100083590
597 Ga0075430_100098326
598 Ga0075431_100010984
599 Ga0075431_100051097
600 Ga0075431_100075618
601 Ga0075431_100144367
602 Ga0075434_100015465
603 Ga0075434_100103261
604 Ga0075429_100001675
605 Ga0075429_100099190
606 Ga0075429_100106304
607 Ga0075429_100190722
608 Ga0075429_100577690
609 Ga0075436_100013103
610 Ga0097620_100102549
611 Ga0097620_100126652
612 Ga0075435_100174078
613 Ga0075435_100391859
614 Ga0111539_10261130
615 Ga0111539_10598838
616 Ga0105245_10000049
617 Ga0105245_10057025
618 Ga0105245_10135146
619 Ga0105245_10709722
620 Ga0114129_10064393
621 Ga0114129_10083919
622 Ga0114129_10163767
623 Ga0114129_10209721
624 Ga0114129_10336155
625 Ga0105243_10005712
626 Ga0105243_10137449
627 Ga0105241_10406832
628 Ga0105242_10320691
629 Ga0105248_10128103
630 Ga0105237_10406278
631 Ga0105238_10293045
632 Ga0105249_10000039
633 Ga0105249_10150137
634 Ga0105239_10058452
635 Ga0157374_10594419
636 Ga0157378_10002699
637 Ga0157378_10146958
638 Ga0157378_10213158
639 Ga0163162_10695634
640 Ga0157375_10426464
641 Ga0163163_10004715
642 Ga0163163_10515136
643 Ga0157379_10049023
644 Ga0157379_10101119
645 Ga0157376_10009116
646 Ga0157376_10305447
647 Ga0182007_10025146
648 Ga0163161_10000013
649 Ga0213873_10002474
650 Ga0209051_1005472
651 Ga0207682_10000409
652 Ga0207692_10006199
653 Ga0207642_10000008
654 Ga0207685_10000003
655 Ga0207705_10147167
656 Ga0207684_10004500
657 Ga0207684_10080377
658 Ga0207707_10010499
659 Ga0207663_10000297
660 Ga0207660_10012383
661 Ga0207660_10037570
662 Ga0207662_10051396
663 Ga0207657_10249405
664 Ga0207652_10055509
665 Ga0207646_10004513
666 Ga0207646_10076075
667 Ga0207681_10079708
668 Ga0207694_10253193
669 Ga0207650_10149088
670 Ga0207659_10012636
671 Ga0207659_10339412
672 Ga0207687_10000189
673 Ga0207687_10136889
674 Ga0207687_10365797
675 Ga0207664_10040141
676 Ga0207644_10009299
677 Ga0207706_10001023
678 Ga0207706_10239779
679 Ga0207686_10013735
680 Ga0207686_10061412
681 Ga0207709_10031354
682 Ga0207709_10113829
683 Ga0207669_10000475
684 Ga0207669_10031695
685 Ga0207669_10074304
686 Ga0207691_10006175
687 Ga0207691_10043657
688 Ga0207661_10010994
689 Ga0207661_10093944
690 Ga0207679_10012497
691 Ga0207679_10013779
692 Ga0207679_10030869
693 Ga0207679_10050767
694 Ga0207679_10195401
695 Ga0207667_10126244
696 Ga0207712_10000003
697 Ga0207668_10358578
698 Ga0207658_10005453
699 Ga0207658_10087605
700 Ga0207677_10035665
701 Ga0207677_10143120
702 Ga0207677_10301572
703 Ga0207703_10497889
704 Ga0207708_10002662
705 Ga0207708_10099833
706 Ga0207702_10055698
707 Ga0207641_10002088
708 Ga0207641_10343254
709 Ga0207641_10489934
710 Ga0207648_10000999
711 Ga0207648_10012153
712 Ga0207683_10009335
713 Ga0207683_10459270
714 Ga0209969_1000199
715 Ga0209967_1001015
716 Ga0209996_1000460
717 Ga0210000_1000245
718 Ga0209968_1000126
719 Ga0209970_1004145
720 Ga0209971_1003105
721 Ga0209966_1000139
722 Ga0209998_10000598
723 Ga0209974_10000113
724 Ga0209974_10000683
725 Ga0207428_10043539
726 Ga0268266_10002458
727 Ga0268266_10143187
728 Ga0268265_10119518
729 Ga0268264_10001856
730 Ga0268264_10099568
731 Ga0265337_1000349
732 Ga0265326_10000132
733 Ga0265322_10000012
734 Ga0265338_10016509
735 Ga0265338_10347098
736 Ga0265324_10000466
737 Ga0265328_10003240
738 Ga0265320_10000001
739 Ga0265329_10003910
740 Ga0265339_10048896
741 Ga0265331_10020602
742 Ga0265327_10000003
743 Ga0265316_10116971
744 Ga0265313_10074063
745 Ga0265314_10000334
746 Ga0316578_10193531
747 Ga0307405_10358158
748 Ga0307413_10120513
749 Ga0307413_10151145
750 Ga0307406_10002717
751 Ga0307409_100017724
752 Ga0307409_100061599
753 Ga0307409_100524434
754 Ga0307416_100025943
755 Ga0307416_100029776
756 Ga0307416_100098254
757 Ga0307414_10143856
758 Ga0307411_10091060
759 Ga0307411_10237448
760 Ga0307415_100107079
761 Ga0307415_100426685
762 Ga0373934_0043704
763 Ga0373954_0012373
764 Ga0373956_0009666
765 Ga0373924_0057007
766 Ga0373927_0177129
767 Ga0373927_0302153
768 Ga0373933_0039037
769 Ga0373937_0026867
770 Ga0373937_0437306
771 Ga0373925_0192882
772 Ga0395900_0100007
773 Ga0395905_0000028
774 Ga0395901_0047136
775 Ga0436365_1757162
776 Ga0436361_0628394
777 Ga0436362_1129453
778 Ga0439466_0021560
779 Ga0451791_0393948
780 Ga0451795_1701782
781 Ga0451802_1551305
782 Ga0451806_602743
783 Ga0451833_0178340
784 Ga0451839_1362152
785 Ga0439452_004605
786 Ga0450902_010218
787 Ga0439446_0018186
788 Ga0439460_0027592
789 Ga0453684_0020459
790 Ga0451576_0047157
791 Ga0451576_0057136
792 Ga0451576_0256192
793 Ga0466967_0082296
794 Ga0466967_0125064
795 Ga0466967_0387543
796 Ga0495592_0002059
797 Ga0495592_0045984
798 Ga0495603_0021438
799 Ga0495629_0067001
800 Ga0495651_0447278
801 Ga0495653_0001280
802 Ga0495653_0046252
803 Ga0495653_0171782
804 Ga0495662_0000682
805 Ga0495606_0006513
806 Ga0495608_0003899
807 Ga0495618_0000053
808 Ga0495618_0000108
809 Ga0495618_0070749
810 Ga0495628_0007021
811 Ga0495628_0010374
812 Ga0495628_0255394
813 Ga0495630_0000162
814 Ga0495630_0002121
815 Ga0495652_0000009
816 Ga0495652_0025744
817 Ga0495640_0010527
818 Ga0495640_0067408
819 Ga0495645_0000018
820 Ga0495645_0027443
821 Ga0495645_0055621
822 Ga0495667_0000109
823 Ga0495656_0000721
824 Ga0495656_0020113
825 Ga0495634_0000021
826 Ga0495634_0001593
827 Ga0495634_0370215
828 Ga0495635_0000006
829 Ga0495635_0074136
830 Ga0495657_0000016
831 Ga0495599_0117966
832 Ga0495623_0138435
833 Ga0495647_0000002
834 Ga0495669_0000493
835 Ga0495613_0000042
836 Ga0495624_0000005
837 Ga0495600_0000922
838 Ga0495604_0003275
839 Ga0495674_0000961
840 Ga0495676_0013442
841 Ga0495680_0000094
842 Ga0495680_0001999
843 Ga0495680_0068998
844 Ga0495685_066341
845 Ga0495686_0008917
846 Ga0495602_0182613
847 Ga0496100_0132500
848 Ga0496100_0432075
849 Ga0496101_0038531
850 Ga0496101_0042436
851 Ga0496102_0003898
852 Ga0496102_0028952
853 Ga0496103_0026332
854 Ga0496103_0036457
855 Ga0496104_0000214
856 Ga0496104_0000992
857 Ga0496104_0028178
858 Ga0496104_0072770
859 Ga0496104_0103587
860 Ga0496105_0000876
861 Ga0496105_0002662
862 Ga0496105_0003424
863 Ga0496105_0116067
864 Ga0496106_0000101
865 Ga0496106_0151611
866 Ga0496107_0040408
867 Ga0496107_0332501
868 Ga0496108_0002650
869 Ga0496108_0152857
870 Ga0496109_0004618
871 Ga0496109_0009730
872 Ga0496109_0035600
873 Ga0496109_0256556
874 Ga0496110_0003337
875 Ga0496110_0114179
876 Ga0496110_0126654
877 Ga0496110_0126785
878 Ga0496110_0183878
879 Ga0496111_0000850
880 Ga0496111_0216521
881 Ga0496113_0015794
882 Ga0496113_0052550
883 Ga0496114_0001632
884 Ga0496114_0064329
885 Ga0496114_0325521
886 Ga0496115_0005201
887 Ga0496115_0022707
888 Ga0496118_0155155
889 Ga0501295_003866
890 Ga0501298_002384
891 Ga0501303_000571
892 Ga0501032_0386740
893 Ga0501034_0643800
894 Ga0501039_0284417
895 Ga0501040_0251880
896 Ga0501040_0382207
897 Ga0501041_0196000
898 Ga0501042_0168352
899 Ga0501046_0044763
900 Ga0501047_0033060
901 Ga0501047_0033722
902 Ga0501068_0054729
903 Ga0501068_0094684
904 Ga0501071_0213394
905 Ga0501072_0501908
906 Ga0501073_0004896
907 Ga0501073_0072278
908 Ga0501073_0284384
909 Ga0501075_0459306
910 Ga0501076_0170672
911 Ga0501076_0234095
912 Ga0501216_000731
913 Ga0501249_048034
914 Ga0501258_006463
915 Ga0501266_010140
916 Ga0501271_000800
917 Ga0501035_0226474
918 Ga0501035_0372791
919 Ga0501044_0107371
920 nmdc:mga00v17_37638_c1
921 nmdc:mga0yw44_350120_c1
922 nmdc:mga0yw44_444863_c1
923 nmdc:mga05p37_173835_c1
924 nmdc:mga05p37_19378_c1
925 nmdc:mga09592_116648_c1
926 nmdc:mga09592_146955_c1
927 nmdc:mga09592_203176_c1
928 nmdc:mga09592_81203_c1
929 nmdc:mga0qj67_16009_c1
930 nmdc:mga0qj67_42122_c1
931 nmdc:mga0qj67_50409_c1
932 nmdc:mga06r32_65889_c1
933 nmdc:mga08y16_647898_c1
934 nmdc:mga0n895_167982_c1
935 nmdc:mga0rr50_336192_c1
936 nmdc:mga0rr50_520443_c1
937 nmdc:mga0rr50_65656_c1
938 nmdc:mga08x19_326749_c1
939 Ga0495601_0000185
940 Ga0495601_0049990
941 Ga0495601_0208056
942 Ga0495612_0000027
943 Ga0495612_0004574
944 Ga0495595_0000066
945 Ga0495619_0017555
946 Ga0500643_021304
947 Ga0501084_0000328
948 Ga0590075_015856
949 Ga0530510_0047973
950 Ga0530510_0292803
951 2506866144
952 2643751894
953 2644538370
954 2774902477
955 2896256559
956 2902840147
957 3003002128
958 3006322120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

42

233

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

48

263

0.91

PF08659

KR

KR domain

43

215

0.87

PF08643

DUF1776

Fungal family of unknown function (DUF1776)

127

311

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e6o-assembly1.cif.gz_B crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.946 2 181
7e6o-assembly1.cif.gz_A crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9437 2 181
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9335 3 179
3wxb-assembly1.cif.gz_A crystal structure of nadph bound carbonyl reductase from chicken fatty liver 0.9306 1 185
3o03-assembly1.cif.gz_A quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 0.9283 2 184
ID Description Score Start End Superfamily
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9584 2 188 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9487 2 155 3.40.50.720
af_Q20840_35_300_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9455 2 256 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9453 86 181 3.40.50.720
af_Q20012_42_307_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9431 2 256 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2G4FFX5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9783 52 174 GO:0008202
GO:0008667
GO:0019290
AF-A0A6J4VSJ5-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9755 2 280 GO:0008202
GO:0016491
AF-A0A816WYK5-F1-model_v4 Uncharacterized protein 0.9744 2 144 GO:0008202
GO:0016491
AF-A0A382QW44-F1-model_v4 Oxidoreductase 0.972 6 186 GO:0008667
GO:0019290
AF-L8YAS2-F1-model_v4 17-beta-hydroxysteroid dehydrogenase type 6 0.9715 2 165 GO:0005525
GO:0008202
GO:0016491
GO:0043231

Map