F452091

General Info

Members Datasets Scaffolds Average Seq Length
479 304 958 333

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0003711|Ga0495638_0003711_2731_3822
Length 363
Sequence MGEHYEIIIDIATVPQQTLQKFANGRNSMVRIAVLGCGRIGRMHADNIAAHGRASLAGVFDVVTNASKEVAGKHGTKVFSSAEEAISSGDVDAVLIATTTATHADLLETAVAANKPILCEKPIDLSLDRVNRCAQVLAGTKVPIMLGFVRRFDTGHRAVRDAIKSGELGDLHQVVITSRDPGMPPVAYAEASGGIYRDMTIHDFDMARFILGEEVTEVSATGSRLVAPELMERLGDYDTVSVVLKTASGKQCIINNSRQAVYGYDQRVEALGNAGMAVSENKPLNMATFYKADYTGRGAPLMNFFIDRYLDAFMAEIGAFVDAVENGTAPEVGFEDGRLALVLAEAAIKSSQEGRTVKVSEVG

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
81 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
109 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
110 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
111 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
112 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
115 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
116 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
117 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
118 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
238 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
239 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
240 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
241 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
242 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
247 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
248 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
249 2511231007 Pseudomonas sp. GM18 Isolate Nodule
250 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
251 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
252 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
253 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
254 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
255 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
256 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
257 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
258 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
259 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
260 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
261 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
262 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
263 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
264 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
265 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
266 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
267 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
268 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
269 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
270 2643221582 Rhizobium sp. Root651 Isolate Unclassified
271 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
272 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
273 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
274 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
275 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
276 2791355262 Rhizobium sp. M1 Isolate Nodule
277 2791355267 Rhizobium sp. L18 Isolate Nodule
278 2818991450 Burkholderia sp. 604 Isolate Unclassified
279 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
280 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
281 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
282 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
283 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
284 2854911287 Brucella lupini LUP21 Isolate Unclassified
285 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
286 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
287 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
288 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
289 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
290 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
291 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
292 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
293 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
294 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
295 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
296 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
297 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
298 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
299 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
300 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
301 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
302 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
303 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
304 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.89
Metatranscriptomes 0
Isolates 12.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 2.92
Rhizoplane 4.8
Rhizosphere 69.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0003711 3300046460 Bacteria 11886
2 JGI24740J21852_10048922 3300001979 Bacteria 1225
3 JGI24739J22299_10000780 3300001989 Bacteria 11609
4 JGI25162J39368_1000350 3300002737 Bacteria 39592
5 JGI25157J39369_1000053 3300002741 Bacteria 110228
6 JGI25406J46586_10011616 3300003203 Bacteria 3856
7 JGI25406J46586_10014068 3300003203 Bacteria 3411
8 JGI25165J46597_1000474 3300003214 Bacteria 39621
9 JGI25153J46596_10000756 3300003215 Bacteria 19789
10 Ga0055528_1015533 3300003790 Bacteria 2745
11 Ga0055540_1000384 3300003792 Bacteria 36797
12 Ga0058692_1002224 3300003856 Bacteria 6605
13 Ga0065714_10067211 3300005288 Bacteria 5772
14 Ga0065704_10009956 3300005289 Bacteria 2778
15 Ga0070680_100104438 3300005336 Bacteria 2354
16 Ga0068868_100357187 3300005338 Bacteria 1253
17 Ga0070669_100013312 3300005353 Bacteria 5847
18 Ga0070669_100063270 3300005353 Bacteria 2723
19 Ga0070694_100046324 3300005444 Bacteria 2919
20 Ga0070662_100001139 3300005457 Bacteria 16278
21 Ga0070681_10155491 3300005458 Bacteria 2212
22 Ga0068867_100073622 3300005459 Bacteria 2558
23 Ga0070706_100009173 3300005467 Bacteria 9210
24 Ga0070698_100035512 3300005471 Bacteria 5155
25 Ga0070697_100116965 3300005536 Bacteria 2227
26 Ga0068853_100434240 3300005539 Bacteria 1233
27 Ga0070695_100012360 3300005545 Bacteria 5120
28 Ga0070696_100001268 3300005546 Bacteria 16415
29 Ga0070693_100044455 3300005547 Bacteria 2513
30 Ga0068851_10000338 3300005834 Bacteria 21202
31 Ga0068870_10076132 3300005840 Bacteria 1842
32 Ga0081539_10000890 3300005985 Bacteria 57132
33 Ga0081539_10002175 3300005985 Bacteria 28809
34 Ga0075365_10054216 3300006038 Bacteria 2658
35 Ga0075365_10078537 3300006038 Bacteria 2232
36 Ga0075368_10000054 3300006042 Bacteria 28035
37 Ga0075363_100004577 3300006048 Bacteria 6065
38 Ga0075363_100005826 3300006048 Bacteria 5538
39 Ga0075363_100127046 3300006048 Bacteria 1428
40 Ga0075367_10002241 3300006178 Bacteria 8740
41 Ga0075367_10020180 3300006178 Bacteria 3707
42 Ga0075370_10009764 3300006353 Bacteria 4998
43 Ga0075433_10034403 3300006852 Bacteria 4352
44 Ga0075436_100063503 3300006914 Bacteria 2552
45 Ga0079104_1007087 3300006946 Bacteria 4123
46 Ga0105251_10000001 3300009011 Bacteria 466643
47 Ga0105251_10000002 3300009011 Bacteria 350843
48 Ga0105251_10000292 3300009011 Bacteria 50581
49 Ga0105251_10000966 3300009011 Bacteria 25549
50 Ga0105251_10001869 3300009011 Bacteria 17307
51 Ga0105251_10009223 3300009011 Bacteria 5849
52 Ga0105244_10004704 3300009036 Bacteria 9295
53 Ga0105250_10000088 3300009092 Bacteria 80904
54 Ga0105250_10000431 3300009092 Bacteria 30668
55 Ga0111539_10129244 3300009094 Bacteria 2958
56 Ga0114129_10153543 3300009147 Bacteria 3150
57 Ga0105241_10000002 3300009174 Bacteria 869480
58 Ga0105238_10046008 3300009551 Bacteria 4407
59 Ga0105239_10069395 3300010375 Bacteria 3872
60 Ga0105246_10000279 3300011119 Bacteria 26696
61 Ga0157373_10005363 3300013100 Bacteria 9632
62 Ga0157373_10074764 3300013100 Bacteria 2390
63 Ga0157369_10004166 3300013105 Bacteria 17134
64 Ga0157378_10060106 3300013297 Bacteria 3391
65 Ga0163162_10197553 3300013306 Bacteria 2140
66 Ga0157375_10000050 3300013308 Bacteria 134913
67 Ga0182008_10000598 3300014497 Bacteria 26495
68 Ga0182007_10002098 3300015262 Bacteria 10219
69 Ga0182005_1011757 3300015265 Bacteria 2487
70 Ga0163161_10115860 3300017792 Bacteria 2009
71 Ga0209437_100400 3300025233 Bacteria 40383
72 Ga0209026_1000002 3300025250 Bacteria 1136158
73 Ga0209759_1000179 3300025256 Bacteria 105045
74 Ga0209233_1000037 3300025261 Bacteria 554620
75 Ga0209233_1018754 3300025261 Bacteria 1854
76 Ga0209673_1002071 3300025273 Bacteria 15086
77 Ga0209758_1000793 3300025297 Bacteria 44917
78 Ga0209758_1001268 3300025297 Bacteria 31270
79 Ga0209051_1000166 3300025303 Bacteria 120265
80 Ga0207656_10000156 3300025321 Bacteria 25322
81 Ga0207696_1000007 3300025711 Bacteria 578417
82 Ga0207696_1000091 3300025711 Bacteria 187999
83 Ga0207655_1006408 3300025728 Bacteria 7804
84 Ga0207713_1000008 3300025735 Bacteria 553952
85 Ga0207713_1000117 3300025735 Bacteria 129339
86 Ga0207713_1000345 3300025735 Bacteria 50910
87 Ga0207713_1000569 3300025735 Bacteria 36636
88 Ga0207713_1001488 3300025735 Bacteria 18530
89 Ga0207713_1004863 3300025735 Bacteria 8611
90 Ga0207647_10000615 3300025904 Bacteria 27759
91 Ga0207643_10161765 3300025908 Bacteria 1347
92 Ga0207684_10133489 3300025910 Bacteria 2131
93 Ga0207654_10000005 3300025911 Bacteria 869492
94 Ga0207652_10385720 3300025921 Bacteria 1264
95 Ga0207681_10002265 3300025923 Bacteria 12232
96 Ga0207681_10003449 3300025923 Bacteria 9854
97 Ga0207706_10000935 3300025933 Bacteria 29879
98 Ga0207661_10171381 3300025944 Bacteria 1890
99 Ga0207679_10064878 3300025945 Bacteria 2731
100 Ga0207639_10204274 3300026041 Bacteria 1697
101 Ga0207648_10160356 3300026089 Bacteria 1986
102 Ga0207698_10197637 3300026142 Bacteria 1798
103 Ga0209281_1000003 3300027111 Bacteria 1260089
104 Ga0209179_1022367 3300027512 Bacteria 1241
105 Ga0268265_10274342 3300028380 Bacteria 1506
106 Ga0265319_1003747 3300028563 Bacteria 7800
107 Ga0307517_10074635 3300028786 Bacteria 2988
108 Ga0307513_10008207 3300031456 Bacteria 13394
109 Ga0307509_10001769 3300031507 Bacteria 35880
110 Ga0307509_10171525 3300031507 Bacteria 2048
111 Ga0307508_10000430 3300031616 Bacteria 49980
112 Ga0316579_10026235 3300031691 Bacteria 2636
113 Ga0316576_10037349 3300031727 Bacteria 3477
114 Ga0316576_10072327 3300031727 Bacteria 2545
115 Ga0316578_10065546 3300031728 Bacteria 2145
116 Ga0307405_10000958 3300031731 Bacteria 11551
117 Ga0316577_10000222 3300031733 Bacteria 19490
118 Ga0316577_10012162 3300031733 Bacteria 4683
119 Ga0316577_10021794 3300031733 Bacteria 3555
120 Ga0316577_10064120 3300031733 Bacteria 2051
121 Ga0316577_10087463 3300031733 Bacteria 1743
122 Ga0307410_10114474 3300031852 Bacteria 1957
123 Ga0307406_10171211 3300031901 Bacteria 1572
124 Ga0307407_10167103 3300031903 Bacteria 1445
125 Ga0307409_100332521 3300031995 Bacteria 1426
126 Ga0307510_10097814 3300033180 Bacteria 2742
127 Ga0307510_10123800 3300033180 Bacteria 2281
128 Ga0373946_0087778 3300035171 Bacteria 1373
129 Ga0316574_0017856 3300035398 Bacteria 4160
130 Ga0316574_0283064 3300035398 Bacteria 1056
131 Ga0373947_0039721 3300035725 Bacteria 2801
132 Ga0316582_0000745 3300036647 Bacteria 13020
133 Ga0316582_0004291 3300036647 Bacteria 7173
134 Ga0316582_0094900 3300036647 Bacteria 1968
135 Ga0316582_0101014 3300036647 Bacteria 1910
136 Ga0316584_0000161 3300036712 Bacteria 31222
137 Ga0316584_0002151 3300036712 Bacteria 12334
138 Ga0316584_0003443 3300036712 Bacteria 10273
139 Ga0316584_0007086 3300036712 Bacteria 7639
140 Ga0316584_0111716 3300036712 Bacteria 2045
141 Ga0395899_0113235 3300037312 Bacteria 1949
142 Ga0395898_0020177 3300037466 Bacteria 6770
143 Ga0395898_0135539 3300037466 Bacteria 2357
144 Ga0395898_0433287 3300037466 Bacteria 1253
145 Ga0395905_0000185 3300037471 Bacteria 99394
146 Ga0395905_0004520 3300037471 Bacteria 14409
147 Ga0395905_0137251 3300037471 Bacteria 2301
148 Ga0316581_0001374 3300037588 Bacteria 5429
149 Ga0395901_0076627 3300038443 Bacteria 3489
150 Ga0395901_0380543 3300038443 Bacteria 1453
151 Ga0395901_0459043 3300038443 Bacteria 1302
152 Ga0400483_093241 3300039062 Bacteria 1501
153 Ga0400487_16784 3300039110 Bacteria 1514
154 Ga0451795_1056918 3300041456 Bacteria 1658
155 Ga0451833_0213720 3300041491 Bacteria 1617
156 Ga0451841_1362367 3300041498 Bacteria 1712
157 Ga0451853_1272035 3300041512 Bacteria 1722
158 Ga0439463_014052 3300042016 Bacteria 1973
159 Ga0450894_002934 3300042131 Bacteria 2259
160 Ga0450898_000679 3300042134 Bacteria 4100
161 Ga0450899_003176 3300042135 Bacteria 1769
162 Ga0439459_0019767 3300042438 Bacteria 1279
163 Ga0466969_0090323 3300044656 Bacteria 1452
164 Ga0466965_0073627 3300044683 Bacteria 1720
165 Ga0466966_0102043 3300044684 Bacteria 1774
166 Ga0466966_0110832 3300044684 Bacteria 1691
167 Ga0466961_0000291 3300044693 Bacteria 33308
168 Ga0466961_0009073 3300044693 Bacteria 6342
169 Ga0466961_0084073 3300044693 Bacteria 2013
170 Ga0466963_0009949 3300044694 Bacteria 5744
171 Ga0466964_0019140 3300044706 Bacteria 2630
172 Ga0466957_0011486 3300044842 Bacteria 5111
173 Ga0466957_0047097 3300044842 Bacteria 2619
174 Ga0466959_0018291 3300045049 Bacteria 5145
175 Ga0466959_0024584 3300045049 Bacteria 4463
176 Ga0466958_0088991 3300045836 Bacteria 1908
177 Ga0466967_0030582 3300045976 Bacteria 4520
178 Ga0495627_003174 3300046453 Bacteria 7403
179 Ga0495591_000131 3300046458 Bacteria 82199
180 Ga0495591_001248 3300046458 Bacteria 16341
181 Ga0495591_007866 3300046458 Bacteria 4452
182 Ga0495591_007991 3300046458 Bacteria 4397
183 Ga0495629_0000152 3300046459 Bacteria 60605
184 Ga0495629_0007216 3300046459 Bacteria 8183
185 Ga0495638_0000785 3300046460 Bacteria 33482
186 Ga0495653_0009895 3300046463 Bacteria 7797
187 Ga0495653_0033253 3300046463 Bacteria 4087
188 Ga0495650_0003554 3300046471 Bacteria 11281
189 Ga0495650_0039589 3300046471 Bacteria 2033
190 Ga0495580_0172551 3300046472 Bacteria 1494
191 Ga0495580_0226551 3300046472 Bacteria 1284
192 Ga0495582_0063073 3300046473 Bacteria 2047
193 Ga0495605_0000001 3300046474 Bacteria 614538
194 Ga0495605_0000132 3300046474 Bacteria 97986
195 Ga0495605_0007127 3300046474 Bacteria 6363
196 Ga0495662_0051997 3300046476 Bacteria 1978
197 Ga0495664_0035863 3300046477 Bacteria 2922
198 Ga0495584_0013570 3300046491 Bacteria 4158
199 Ga0495585_0026094 3300046492 Bacteria 3339
200 Ga0495585_0061824 3300046492 Bacteria 2058
201 Ga0495585_0080017 3300046492 Bacteria 1771
202 Ga0495594_0119088 3300046499 Bacteria 1492
203 Ga0495596_0048506 3300046500 Bacteria 1665
204 Ga0495596_0057376 3300046500 Bacteria 1519
205 Ga0495607_0000018 3300046501 Bacteria 167673
206 Ga0495607_0006946 3300046501 Bacteria 7888
207 Ga0495607_0010315 3300046501 Bacteria 6285
208 Ga0495607_0012573 3300046501 Bacteria 5581
209 Ga0495607_0098817 3300046501 Bacteria 1567
210 Ga0495583_0000651 3300046506 Bacteria 45809
211 Ga0495583_0001236 3300046506 Bacteria 27137
212 Ga0495583_0002032 3300046506 Bacteria 18425
213 Ga0495583_0002095 3300046506 Bacteria 17997
214 Ga0495583_0002581 3300046506 Bacteria 15189
215 Ga0495583_0031913 3300046506 Bacteria 2547
216 Ga0495583_0103857 3300046506 Bacteria 1210
217 Ga0495606_0000176 3300046507 Bacteria 113311
218 Ga0495606_0000794 3300046507 Bacteria 48239
219 Ga0495606_0001289 3300046507 Bacteria 34720
220 Ga0495606_0010536 3300046507 Bacteria 7655
221 Ga0495610_0000940 3300046512 Bacteria 27024
222 Ga0495610_0006348 3300046512 Bacteria 8167
223 Ga0495610_0023057 3300046512 Bacteria 3391
224 Ga0495616_0107204 3300046513 Bacteria 1302
225 Ga0495620_0001338 3300046515 Bacteria 14966
226 Ga0495620_0009921 3300046515 Bacteria 5040
227 Ga0495628_0013724 3300046516 Bacteria 6810
228 Ga0495628_0049203 3300046516 Bacteria 3338
229 Ga0495631_0005171 3300046518 Bacteria 6872
230 Ga0495631_0008440 3300046518 Bacteria 5191
231 Ga0495631_0058205 3300046518 Bacteria 1681
232 Ga0495632_0003819 3300046519 Bacteria 10482
233 Ga0495632_0004270 3300046519 Bacteria 9753
234 Ga0495632_0008634 3300046519 Bacteria 6222
235 Ga0495637_0000202 3300046520 Bacteria 46505
236 Ga0495637_0002261 3300046520 Bacteria 10693
237 Ga0495637_0007350 3300046520 Bacteria 5469
238 Ga0495637_0015082 3300046520 Bacteria 3632
239 Ga0495643_0008792 3300046522 Bacteria 6362
240 Ga0495644_0003896 3300046523 Bacteria 5874
241 Ga0495648_0002590 3300046524 Bacteria 16563
242 Ga0495648_0007696 3300046524 Bacteria 8589
243 Ga0495648_0011783 3300046524 Bacteria 6561
244 Ga0495648_0080261 3300046524 Bacteria 1859
245 Ga0495648_0173918 3300046524 Bacteria 1101
246 Ga0495666_0008516 3300046526 Bacteria 5143
247 Ga0495654_0000119 3300046530 Bacteria 88217
248 Ga0495654_0003370 3300046530 Bacteria 9843
249 Ga0495654_0004292 3300046530 Bacteria 8504
250 Ga0495654_0064581 3300046530 Bacteria 1749
251 Ga0495665_0005681 3300046531 Bacteria 6731
252 Ga0495640_0096561 3300046533 Bacteria 1944
253 Ga0495586_0038940 3300046535 Bacteria 2555
254 Ga0495609_0000014 3300046538 Bacteria 326023
255 Ga0495609_0000067 3300046538 Bacteria 130284
256 Ga0495597_0034289 3300046542 Bacteria 2294
257 Ga0495622_0003196 3300046557 Bacteria 7760
258 Ga0495633_0070886 3300046558 Bacteria 1626
259 Ga0495656_0092741 3300046615 Bacteria 1384
260 Ga0495668_0006421 3300046616 Bacteria 7700
261 Ga0495668_0020337 3300046616 Bacteria 3819
262 Ga0495668_0154245 3300046616 Bacteria 1258
263 Ga0495611_0000175 3300046648 Bacteria 46491
264 Ga0495611_0000950 3300046648 Bacteria 15530
265 Ga0495611_0007803 3300046648 Bacteria 4545
266 Ga0495611_0010652 3300046648 Bacteria 3893
267 Ga0495625_0000028 3300046660 Bacteria 256946
268 Ga0495625_0004366 3300046660 Bacteria 13420
269 Ga0495625_0125373 3300046660 Bacteria 1744
270 Ga0495635_0077317 3300046663 Bacteria 2280
271 Ga0495661_0000135 3300046665 Bacteria 86985
272 Ga0495661_0000191 3300046665 Bacteria 71123
273 Ga0495661_0000698 3300046665 Bacteria 33395
274 Ga0495661_0007574 3300046665 Bacteria 7565
275 Ga0495588_0042257 3300046674 Bacteria 2330
276 Ga0495588_0043913 3300046674 Bacteria 2288
277 Ga0495646_0081036 3300046680 Bacteria 1892
278 Ga0495646_0100335 3300046680 Bacteria 1661
279 Ga0495624_0001078 3300046690 Bacteria 21554
280 Ga0495670_0125761 3300046691 Bacteria 1334
281 Ga0495670_0128810 3300046691 Bacteria 1318
282 Ga0495671_0026715 3300046692 Bacteria 2989
283 Ga0495649_0024512 3300046694 Bacteria 3364
284 Ga0495649_0040376 3300046694 Bacteria 2556
285 Ga0495589_0000377 3300046794 Bacteria 34084
286 Ga0495589_0007570 3300046794 Bacteria 5689
287 Ga0495660_0004711 3300046810 Bacteria 8229
288 Ga0495660_0034018 3300046810 Bacteria 2854
289 Ga0495660_0076525 3300046810 Bacteria 1763
290 Ga0495581_0152949 3300047315 Bacteria 1348
291 Ga0495674_0002112 3300047319 Bacteria 19511
292 Ga0495674_0035028 3300047319 Bacteria 4532
293 Ga0495674_0109875 3300047319 Bacteria 2338
294 Ga0495672_0000177 3300047320 Bacteria 92373
295 Ga0495672_0014127 3300047320 Bacteria 5478
296 Ga0495672_0038416 3300047320 Bacteria 2920
297 Ga0495676_0000006 3300047321 Bacteria 280508
298 Ga0495676_0009634 3300047321 Bacteria 8790
299 Ga0495676_0047881 3300047321 Bacteria 3451
300 Ga0495680_0067722 3300047322 Bacteria 2729
301 Ga0495683_0031868 3300047323 Bacteria 2685
302 Ga0495683_0105067 3300047323 Bacteria 1354
303 Ga0495687_016768 3300047443 Bacteria 3674
304 Ga0495675_0070116 3300047444 Bacteria 2213
305 Ga0495679_000226 3300047446 Bacteria 47732
306 Ga0495679_000427 3300047446 Bacteria 31171
307 Ga0495679_001677 3300047446 Bacteria 12308
308 Ga0495679_008977 3300047446 Bacteria 4031
309 Ga0495673_0000279 3300047469 Bacteria 69195
310 Ga0495673_0001663 3300047469 Bacteria 17119
311 Ga0495673_0003800 3300047469 Bacteria 9759
312 Ga0495673_0006065 3300047469 Bacteria 7177
313 Ga0495673_0014424 3300047469 Bacteria 4109
314 Ga0495681_0000789 3300047470 Bacteria 24391
315 Ga0495686_0090797 3300047472 Bacteria 1854
316 Ga0495593_0002456 3300047673 Bacteria 11150
317 Ga0495593_0013399 3300047673 Bacteria 4679
318 Ga0495626_0000019 3300048091 Bacteria 225494
319 Ga0496100_0016405 3300048903 Bacteria 4350
320 Ga0496100_0145571 3300048903 Bacteria 1684
321 Ga0496102_0031092 3300048905 Bacteria 4785
322 Ga0496102_0113223 3300048905 Bacteria 2531
323 Ga0496104_0058642 3300048907 Bacteria 3644
324 Ga0496108_0029826 3300048911 Bacteria 4520
325 Ga0496108_0166730 3300048911 Bacteria 1905
326 Ga0496110_0112458 3300048913 Bacteria 2448
327 Ga0496110_0132203 3300048913 Bacteria 2254
328 Ga0496110_0223772 3300048913 Bacteria 1711
329 Ga0496110_0409969 3300048913 Bacteria 1235
330 Ga0496111_0055626 3300048914 Bacteria 2862
331 Ga0496114_0066942 3300048917 Bacteria 3012
332 Ga0496114_0106860 3300048917 Bacteria 2395
333 Ga0496116_0015672 3300048919 Bacteria 5981
334 Ga0496116_0162367 3300048919 Bacteria 1224
335 Ga0496117_0007078 3300048920 Bacteria 11091
336 Ga0496117_0035173 3300048920 Bacteria 3764
337 Ga0496117_0037521 3300048920 Bacteria 3609
338 Ga0496117_0047577 3300048920 Bacteria 3074
339 Ga0496118_0000897 3300048921 Bacteria 46751
340 Ga0496118_0049679 3300048921 Bacteria 3227
341 Ga0496119_0006413 3300048922 Bacteria 10913
342 Ga0496119_0019177 3300048922 Bacteria 5052
343 Ga0496120_0004700 3300048923 Bacteria 11265
344 Ga0496121_0001435 3300048924 Bacteria 40263
345 Ga0496121_0005397 3300048924 Bacteria 16415
346 Ga0496121_0017703 3300048924 Bacteria 7253
347 Ga0496122_0000327 3300048925 Bacteria 103468
348 Ga0496122_0005708 3300048925 Bacteria 14671
349 Ga0496122_0030429 3300048925 Bacteria 4522
350 Ga0496122_0047190 3300048925 Bacteria 3327
351 Ga0496122_0062147 3300048925 Bacteria 2736
352 Ga0496123_0000115 3300048926 Bacteria 163097
353 Ga0496123_0001974 3300048926 Bacteria 26588
354 Ga0496123_0009858 3300048926 Bacteria 8530
355 Ga0496123_0034362 3300048926 Bacteria 3633
356 Ga0496124_0001309 3300048927 Bacteria 37591
357 Ga0496124_0012416 3300048927 Bacteria 8411
358 Ga0496124_0036395 3300048927 Bacteria 4294
359 Ga0496124_0144479 3300048927 Bacteria 1873
360 Ga0496124_0181928 3300048927 Bacteria 1617
361 Ga0496125_0000245 3300048928 Bacteria 111310
362 Ga0496125_0001265 3300048928 Bacteria 37668
363 Ga0496125_0004266 3300048928 Bacteria 16636
364 Ga0496125_0024665 3300048928 Bacteria 5524
365 Ga0496125_0037402 3300048928 Bacteria 4221
366 Ga0496126_0010016 3300048929 Bacteria 10003
367 Ga0496126_0015283 3300048929 Bacteria 7727
368 Ga0496126_0112853 3300048929 Bacteria 2366
369 Ga0495678_000072 3300049459 Bacteria 128270
370 Ga0495678_051076 3300049459 Bacteria 1600
371 Ga0495682_0000361 3300049460 Bacteria 33190
372 Ga0501034_0245700 3300049571 Bacteria 1735
373 Ga0501036_0222182 3300049572 Bacteria 1586
374 Ga0501036_0442364 3300049572 Bacteria 1083
375 Ga0501042_0075319 3300049578 Bacteria 2415
376 Ga0501042_0165363 3300049578 Bacteria 1596
377 Ga0501043_0176607 3300049579 Bacteria 1665
378 Ga0501048_0050950 3300049582 Bacteria 2948
379 Ga0501048_0235577 3300049582 Bacteria 1299
380 Ga0501067_0007004 3300049583 Bacteria 6259
381 Ga0501067_0026481 3300049583 Bacteria 3212
382 Ga0501067_0036006 3300049583 Bacteria 2749
383 Ga0501068_0001431 3300049584 Bacteria 12660
384 Ga0501068_0107666 3300049584 Bacteria 1731
385 Ga0501070_0151912 3300049586 Bacteria 1910
386 Ga0501071_0153466 3300049587 Bacteria 1719
387 Ga0501072_0099390 3300049588 Bacteria 2313
388 Ga0501076_0055347 3300049592 Bacteria 3146
389 Ga0501077_0093613 3300049593 Bacteria 1905
390 Ga0501079_0106086 3300049741 Bacteria 2180
391 Ga0501045_0020356 3300049824 Bacteria 4739
392 Ga0501045_0030078 3300049824 Bacteria 3929
393 Ga0501045_0069329 3300049824 Bacteria 2592
394 Ga0501045_0122109 3300049824 Bacteria 1934
395 nmdc:mga03n38_14184_c1 3300050490 Bacteria 3048
396 nmdc:mga03n38_51157_c1 3300050490 Bacteria 1844
397 nmdc:mga00v17_222101_c1 3300050491 Bacteria 1223
398 nmdc:mga00v17_87229_c1 3300050491 Bacteria 1956
399 nmdc:mga0yw44_104940_c1 3300050492 Bacteria 1805
400 nmdc:mga0yw44_24640_c1 3300050492 Bacteria 3408
401 nmdc:mga06z11_17109_c1 3300050494 Bacteria 3283
402 nmdc:mga06z11_48526_c1 3300050494 Bacteria 2161
403 nmdc:mga05p37_283603_c1 3300050507 Bacteria 1974
404 nmdc:mga08y16_104569_c1 3300050511 Bacteria 2947
405 nmdc:mga0a205_10875_c1 3300050515 Bacteria 8372
406 nmdc:mga0sz30_10110_c1 3300050516 Bacteria 2333
407 nmdc:mga0sz30_14389_c1 3300050516 Bacteria 3112
408 Ga0495619_0178112 3300053085 Bacteria 1471
409 Ga0500643_035422 3300053087 Bacteria 1497
410 Ga0500557_009971 3300053105 Bacteria 2355
411 Ga0500594_0002368 3300053118 Bacteria 4097
412 Ga0500618_000475 3300053125 Bacteria 25939
413 Ga0500652_065695 3300053131 Bacteria 1499
414 Ga0500588_0036435 3300053146 Bacteria 1455
415 Ga0500634_0000568 3300053161 Bacteria 12224
416 Ga0501084_0303315 3300054114 Bacteria 1349
417 Ga0501082_0196692 3300060353 Bacteria 1754
418 Ga0466962_0000953 3300061719 Bacteria 13127
419 Ga0530510_0129340 3300061734 Bacteria 1857
420 Ga0530510_0319961 3300061734 Bacteria 1163
421 Ga0530510_0320828 3300061734 Bacteria 1161
422 2511136705 2510917022 Bacteria 6504556
423 2511182008 2510917028 Bacteria 6185411
424 2511273294 2511231007 Bacteria 6306603
425 2514052121 2513237166 Bacteria 10373764
426 2585276312 2582581307 Bacteria 6597605
427 2585329093 2582581315 Bacteria 7318924
428 2585393681 2582581866 Bacteria 6859583
429 2585564112 2585427531 Bacteria 6992870
430 2585820603 2585427590 Bacteria 6824633
431 2585903042 2585427609 Bacteria 6667127
432 2587978383 2585428125 Bacteria 6662905
433 2597863656 2597489888 Bacteria 6179543
434 2597869625 2597489889 Bacteria 6297495
435 2599398564 2599185167 Bacteria 6353609
436 2599450617 2599185179 Bacteria 6611171
437 2599507134 2599185189 Bacteria 5862825
438 2599513048 2599185190 Bacteria 6285678
439 2599520741 2599185191 Bacteria 6297582
440 2599880308 2599185288 Bacteria 6666191
441 2599891725 2599185290 Bacteria 6289611
442 2601692068 2600255296 Bacteria 5784754
443 2617386576 2617270742 Bacteria 6808054
444 2643870419 2643221571 Bacteria 6228673
445 2643916999 2643221582 Bacteria 5804683
446 2644620981 2643221713 Bacteria 6554480
447 2738688022 2738541271 Bacteria 5657310
448 2738806532 2738541294 Bacteria 6925949
449 2738893892 2738541309 Bacteria 6926455
450 2739263543 2738543016 Bacteria 5657564
451 2793335263 2791355262 Bacteria 6774204
452 2793366322 2791355267 Bacteria 7222458
453 2819622489 2818991450 Bacteria 6962147
454 2841739752 2841734538 Bacteria 6784580
455 2841861667 2841859092 Bacteria 5436171
456 2842518067 2842515876 Bacteria 5436280
457 2842827135 2842826826 Bacteria 5974129
458 2842843146 2842837860 Bacteria 6066181
459 2854915528 2854911287 Bacteria 5582813
460 2881635949 2881633906 Bacteria 2972201
461 2883092776 2883087390 Bacteria 9532701
462 2900635172 2900634093 Bacteria 10263517
463 2904624945 2904615490 Bacteria 10047340
464 2928111904 2928108538 Bacteria 7360024
465 2928139143 2928135762 Bacteria 7259641
466 2928508841 2928503688 Bacteria 7268108
467 2931393701 2931390751 Bacteria 6273349
468 2933013696 2933011516 Bacteria 5439334
469 2937828003 2937822353 Bacteria 7290551
470 2945933243 2945928738 Bacteria 6053221
471 2945964014 2945961074 Bacteria 7342064
472 2946009481 2946006987 Bacteria 6705746
473 2946030722 2946027586 Bacteria 6049274
474 3006988150 3006984091 Bacteria 4207523
475 8003572911 8003570095 Bacteria 5747666
476 8054567363 8054563764 Bacteria 5592885
477 8055269597 8055266321 Bacteria 7999742
478 8056380033 8056375014 Bacteria 7006639
479 8057875928 8057874678 Bacteria 7494653
480 Ga0495638_0003711
481 JGI24740J21852_10048922
482 JGI24739J22299_10000780
483 JGI25162J39368_1000350
484 JGI25157J39369_1000053
485 JGI25406J46586_10011616
486 JGI25406J46586_10014068
487 JGI25165J46597_1000474
488 JGI25153J46596_10000756
489 Ga0055528_1015533
490 Ga0055540_1000384
491 Ga0058692_1002224
492 Ga0065714_10067211
493 Ga0065704_10009956
494 Ga0070680_100104438
495 Ga0068868_100357187
496 Ga0070669_100013312
497 Ga0070669_100063270
498 Ga0070694_100046324
499 Ga0070662_100001139
500 Ga0070681_10155491
501 Ga0068867_100073622
502 Ga0070706_100009173
503 Ga0070698_100035512
504 Ga0070697_100116965
505 Ga0068853_100434240
506 Ga0070695_100012360
507 Ga0070696_100001268
508 Ga0070693_100044455
509 Ga0068851_10000338
510 Ga0068870_10076132
511 Ga0081539_10000890
512 Ga0081539_10002175
513 Ga0075365_10054216
514 Ga0075365_10078537
515 Ga0075368_10000054
516 Ga0075363_100004577
517 Ga0075363_100005826
518 Ga0075363_100127046
519 Ga0075367_10002241
520 Ga0075367_10020180
521 Ga0075370_10009764
522 Ga0075433_10034403
523 Ga0075436_100063503
524 Ga0079104_1007087
525 Ga0105251_10000001
526 Ga0105251_10000002
527 Ga0105251_10000292
528 Ga0105251_10000966
529 Ga0105251_10001869
530 Ga0105251_10009223
531 Ga0105244_10004704
532 Ga0105250_10000088
533 Ga0105250_10000431
534 Ga0111539_10129244
535 Ga0114129_10153543
536 Ga0105241_10000002
537 Ga0105238_10046008
538 Ga0105239_10069395
539 Ga0105246_10000279
540 Ga0157373_10005363
541 Ga0157373_10074764
542 Ga0157369_10004166
543 Ga0157378_10060106
544 Ga0163162_10197553
545 Ga0157375_10000050
546 Ga0182008_10000598
547 Ga0182007_10002098
548 Ga0182005_1011757
549 Ga0163161_10115860
550 Ga0209437_100400
551 Ga0209026_1000002
552 Ga0209759_1000179
553 Ga0209233_1000037
554 Ga0209233_1018754
555 Ga0209673_1002071
556 Ga0209758_1000793
557 Ga0209758_1001268
558 Ga0209051_1000166
559 Ga0207656_10000156
560 Ga0207696_1000007
561 Ga0207696_1000091
562 Ga0207655_1006408
563 Ga0207713_1000008
564 Ga0207713_1000117
565 Ga0207713_1000345
566 Ga0207713_1000569
567 Ga0207713_1001488
568 Ga0207713_1004863
569 Ga0207647_10000615
570 Ga0207643_10161765
571 Ga0207684_10133489
572 Ga0207654_10000005
573 Ga0207652_10385720
574 Ga0207681_10002265
575 Ga0207681_10003449
576 Ga0207706_10000935
577 Ga0207661_10171381
578 Ga0207679_10064878
579 Ga0207639_10204274
580 Ga0207648_10160356
581 Ga0207698_10197637
582 Ga0209281_1000003
583 Ga0209179_1022367
584 Ga0268265_10274342
585 Ga0265319_1003747
586 Ga0307517_10074635
587 Ga0307513_10008207
588 Ga0307509_10001769
589 Ga0307509_10171525
590 Ga0307508_10000430
591 Ga0316579_10026235
592 Ga0316576_10037349
593 Ga0316576_10072327
594 Ga0316578_10065546
595 Ga0307405_10000958
596 Ga0316577_10000222
597 Ga0316577_10012162
598 Ga0316577_10021794
599 Ga0316577_10064120
600 Ga0316577_10087463
601 Ga0307410_10114474
602 Ga0307406_10171211
603 Ga0307407_10167103
604 Ga0307409_100332521
605 Ga0307510_10097814
606 Ga0307510_10123800
607 Ga0373946_0087778
608 Ga0316574_0017856
609 Ga0316574_0283064
610 Ga0373947_0039721
611 Ga0316582_0000745
612 Ga0316582_0004291
613 Ga0316582_0094900
614 Ga0316582_0101014
615 Ga0316584_0000161
616 Ga0316584_0002151
617 Ga0316584_0003443
618 Ga0316584_0007086
619 Ga0316584_0111716
620 Ga0395899_0113235
621 Ga0395898_0020177
622 Ga0395898_0135539
623 Ga0395898_0433287
624 Ga0395905_0000185
625 Ga0395905_0004520
626 Ga0395905_0137251
627 Ga0316581_0001374
628 Ga0395901_0076627
629 Ga0395901_0380543
630 Ga0395901_0459043
631 Ga0400483_093241
632 Ga0400487_16784
633 Ga0451795_1056918
634 Ga0451833_0213720
635 Ga0451841_1362367
636 Ga0451853_1272035
637 Ga0439463_014052
638 Ga0450894_002934
639 Ga0450898_000679
640 Ga0450899_003176
641 Ga0439459_0019767
642 Ga0466969_0090323
643 Ga0466965_0073627
644 Ga0466966_0102043
645 Ga0466966_0110832
646 Ga0466961_0000291
647 Ga0466961_0009073
648 Ga0466961_0084073
649 Ga0466963_0009949
650 Ga0466964_0019140
651 Ga0466957_0011486
652 Ga0466957_0047097
653 Ga0466959_0018291
654 Ga0466959_0024584
655 Ga0466958_0088991
656 Ga0466967_0030582
657 Ga0495627_003174
658 Ga0495591_000131
659 Ga0495591_001248
660 Ga0495591_007866
661 Ga0495591_007991
662 Ga0495629_0000152
663 Ga0495629_0007216
664 Ga0495638_0000785
665 Ga0495653_0009895
666 Ga0495653_0033253
667 Ga0495650_0003554
668 Ga0495650_0039589
669 Ga0495580_0172551
670 Ga0495580_0226551
671 Ga0495582_0063073
672 Ga0495605_0000001
673 Ga0495605_0000132
674 Ga0495605_0007127
675 Ga0495662_0051997
676 Ga0495664_0035863
677 Ga0495584_0013570
678 Ga0495585_0026094
679 Ga0495585_0061824
680 Ga0495585_0080017
681 Ga0495594_0119088
682 Ga0495596_0048506
683 Ga0495596_0057376
684 Ga0495607_0000018
685 Ga0495607_0006946
686 Ga0495607_0010315
687 Ga0495607_0012573
688 Ga0495607_0098817
689 Ga0495583_0000651
690 Ga0495583_0001236
691 Ga0495583_0002032
692 Ga0495583_0002095
693 Ga0495583_0002581
694 Ga0495583_0031913
695 Ga0495583_0103857
696 Ga0495606_0000176
697 Ga0495606_0000794
698 Ga0495606_0001289
699 Ga0495606_0010536
700 Ga0495610_0000940
701 Ga0495610_0006348
702 Ga0495610_0023057
703 Ga0495616_0107204
704 Ga0495620_0001338
705 Ga0495620_0009921
706 Ga0495628_0013724
707 Ga0495628_0049203
708 Ga0495631_0005171
709 Ga0495631_0008440
710 Ga0495631_0058205
711 Ga0495632_0003819
712 Ga0495632_0004270
713 Ga0495632_0008634
714 Ga0495637_0000202
715 Ga0495637_0002261
716 Ga0495637_0007350
717 Ga0495637_0015082
718 Ga0495643_0008792
719 Ga0495644_0003896
720 Ga0495648_0002590
721 Ga0495648_0007696
722 Ga0495648_0011783
723 Ga0495648_0080261
724 Ga0495648_0173918
725 Ga0495666_0008516
726 Ga0495654_0000119
727 Ga0495654_0003370
728 Ga0495654_0004292
729 Ga0495654_0064581
730 Ga0495665_0005681
731 Ga0495640_0096561
732 Ga0495586_0038940
733 Ga0495609_0000014
734 Ga0495609_0000067
735 Ga0495597_0034289
736 Ga0495622_0003196
737 Ga0495633_0070886
738 Ga0495656_0092741
739 Ga0495668_0006421
740 Ga0495668_0020337
741 Ga0495668_0154245
742 Ga0495611_0000175
743 Ga0495611_0000950
744 Ga0495611_0007803
745 Ga0495611_0010652
746 Ga0495625_0000028
747 Ga0495625_0004366
748 Ga0495625_0125373
749 Ga0495635_0077317
750 Ga0495661_0000135
751 Ga0495661_0000191
752 Ga0495661_0000698
753 Ga0495661_0007574
754 Ga0495588_0042257
755 Ga0495588_0043913
756 Ga0495646_0081036
757 Ga0495646_0100335
758 Ga0495624_0001078
759 Ga0495670_0125761
760 Ga0495670_0128810
761 Ga0495671_0026715
762 Ga0495649_0024512
763 Ga0495649_0040376
764 Ga0495589_0000377
765 Ga0495589_0007570
766 Ga0495660_0004711
767 Ga0495660_0034018
768 Ga0495660_0076525
769 Ga0495581_0152949
770 Ga0495674_0002112
771 Ga0495674_0035028
772 Ga0495674_0109875
773 Ga0495672_0000177
774 Ga0495672_0014127
775 Ga0495672_0038416
776 Ga0495676_0000006
777 Ga0495676_0009634
778 Ga0495676_0047881
779 Ga0495680_0067722
780 Ga0495683_0031868
781 Ga0495683_0105067
782 Ga0495687_016768
783 Ga0495675_0070116
784 Ga0495679_000226
785 Ga0495679_000427
786 Ga0495679_001677
787 Ga0495679_008977
788 Ga0495673_0000279
789 Ga0495673_0001663
790 Ga0495673_0003800
791 Ga0495673_0006065
792 Ga0495673_0014424
793 Ga0495681_0000789
794 Ga0495686_0090797
795 Ga0495593_0002456
796 Ga0495593_0013399
797 Ga0495626_0000019
798 Ga0496100_0016405
799 Ga0496100_0145571
800 Ga0496102_0031092
801 Ga0496102_0113223
802 Ga0496104_0058642
803 Ga0496108_0029826
804 Ga0496108_0166730
805 Ga0496110_0112458
806 Ga0496110_0132203
807 Ga0496110_0223772
808 Ga0496110_0409969
809 Ga0496111_0055626
810 Ga0496114_0066942
811 Ga0496114_0106860
812 Ga0496116_0015672
813 Ga0496116_0162367
814 Ga0496117_0007078
815 Ga0496117_0035173
816 Ga0496117_0037521
817 Ga0496117_0047577
818 Ga0496118_0000897
819 Ga0496118_0049679
820 Ga0496119_0006413
821 Ga0496119_0019177
822 Ga0496120_0004700
823 Ga0496121_0001435
824 Ga0496121_0005397
825 Ga0496121_0017703
826 Ga0496122_0000327
827 Ga0496122_0005708
828 Ga0496122_0030429
829 Ga0496122_0047190
830 Ga0496122_0062147
831 Ga0496123_0000115
832 Ga0496123_0001974
833 Ga0496123_0009858
834 Ga0496123_0034362
835 Ga0496124_0001309
836 Ga0496124_0012416
837 Ga0496124_0036395
838 Ga0496124_0144479
839 Ga0496124_0181928
840 Ga0496125_0000245
841 Ga0496125_0001265
842 Ga0496125_0004266
843 Ga0496125_0024665
844 Ga0496125_0037402
845 Ga0496126_0010016
846 Ga0496126_0015283
847 Ga0496126_0112853
848 Ga0495678_000072
849 Ga0495678_051076
850 Ga0495682_0000361
851 Ga0501034_0245700
852 Ga0501036_0222182
853 Ga0501036_0442364
854 Ga0501042_0075319
855 Ga0501042_0165363
856 Ga0501043_0176607
857 Ga0501048_0050950
858 Ga0501048_0235577
859 Ga0501067_0007004
860 Ga0501067_0026481
861 Ga0501067_0036006
862 Ga0501068_0001431
863 Ga0501068_0107666
864 Ga0501070_0151912
865 Ga0501071_0153466
866 Ga0501072_0099390
867 Ga0501076_0055347
868 Ga0501077_0093613
869 Ga0501079_0106086
870 Ga0501045_0020356
871 Ga0501045_0030078
872 Ga0501045_0069329
873 Ga0501045_0122109
874 nmdc:mga03n38_14184_c1
875 nmdc:mga03n38_51157_c1
876 nmdc:mga00v17_222101_c1
877 nmdc:mga00v17_87229_c1
878 nmdc:mga0yw44_104940_c1
879 nmdc:mga0yw44_24640_c1
880 nmdc:mga06z11_17109_c1
881 nmdc:mga06z11_48526_c1
882 nmdc:mga05p37_283603_c1
883 nmdc:mga08y16_104569_c1
884 nmdc:mga0a205_10875_c1
885 nmdc:mga0sz30_10110_c1
886 nmdc:mga0sz30_14389_c1
887 Ga0495619_0178112
888 Ga0500643_035422
889 Ga0500557_009971
890 Ga0500594_0002368
891 Ga0500618_000475
892 Ga0500652_065695
893 Ga0500588_0036435
894 Ga0500634_0000568
895 Ga0501084_0303315
896 Ga0501082_0196692
897 Ga0466962_0000953
898 Ga0530510_0129340
899 Ga0530510_0319961
900 Ga0530510_0320828
901 2511136705
902 2511182008
903 2511273294
904 2514052121
905 2585276312
906 2585329093
907 2585393681
908 2585564112
909 2585820603
910 2585903042
911 2587978383
912 2597863656
913 2597869625
914 2599398564
915 2599450617
916 2599507134
917 2599513048
918 2599520741
919 2599880308
920 2599891725
921 2601692068
922 2617386576
923 2643870419
924 2643916999
925 2644620981
926 2738688022
927 2738806532
928 2738893892
929 2739263543
930 2793335263
931 2793366322
932 2819622489
933 2841739752
934 2841861667
935 2842518067
936 2842827135
937 2842843146
938 2854915528
939 2881635949
940 2883092776
941 2900635172
942 2904624945
943 2928111904
944 2928139143
945 2928508841
946 2931393701
947 2933013696
948 2937828003
949 2945933243
950 2945964014
951 2946009481
952 2946030722
953 3006988150
954 8003572911
955 8054567363
956 8055269597
957 8056380033
958 8057875928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

30

148

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

156

278

0.95

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

160

359

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3euw-assembly1.cif.gz_B crystal structure of a myo-inositol dehydrogenase from corynebacterium glutamicum atcc 13032 0.9639 1 331
3ezy-assembly1.cif.gz_B crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.9623 2 335
4hkt-assembly1.cif.gz_D crystal structure of a putative myo-inositol dehydrogenase from sinorhizobium meliloti 1021 (target psi-012312) 0.9611 1 331
3ezy-assembly1.cif.gz_C crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.9595 2 333
3ezy-assembly1.cif.gz_B crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.9594 2 335
ID Description Score Start End Superfamily
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9626 1 119 3.40.50.720
3euwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 1 113 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9547 1 119 3.40.50.720
3ezyC02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9535 121 333 3.30.360.10
3euwD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9419 121 331 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A534B6X1-F1-model_v4 Inositol 2-dehydrogenase 0.9727 1 141 GO:0000166
GO:0005737
GO:0006740
GO:0016491
AF-A0A1X6P8B4-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9678 1 335 GO:0000166
GO:0016491
AF-A0A6I2WRQ7-F1-model_v4 deleted 0.9642 2 185
AF-A0A7C3ZRM2-F1-model_v4 Inositol 2-dehydrogenase (EC 1.1.1.18) 0.9636 1 330 GO:0000166
GO:0050112
AF-A0A1X6P8B4-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9622 1 335 GO:0000166
GO:0016491

Map