F452159
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 480 | 288 | 480 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100131565|Ga0070683_1001315653 |
| Length | 105 |
| Sequence | MPAQLSPEAAAVVRVLVPSPLRSYTGSAETDVAVPVLAPELPPTLGGVLAALNSKYPGIRFRIIDEQGQVRRHIKLFVGTTLARDLSAPIPSGHDVMIVAALSGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 102 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 103 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 159 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 180 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 187 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 191 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 192 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 193 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 194 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 195 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 277 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.88 |
| Nodule | 0 |
| Rhizoplane | 5 |
| Rhizosphere | 91.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000036 | 3300003214 | Bacteria | 286380 |
| 2 | Ga0065715_10040593 | 3300005293 | Unclassified | 1499 |
| 3 | Ga0070676_10725705 | 3300005328 | Unclassified | 727 |
| 4 | Ga0070683_100131565 | 3300005329 | Bacteria | 2368 |
| 5 | Ga0070690_100013069 | 3300005330 | Bacteria | 4899 |
| 6 | Ga0070670_100035630 | 3300005331 | Bacteria | 4283 |
| 7 | Ga0070670_100544817 | 3300005331 | Bacteria | 1035 |
| 8 | Ga0068869_101325210 | 3300005334 | Unclassified | 636 |
| 9 | Ga0070666_10141667 | 3300005335 | Bacteria | 1675 |
| 10 | Ga0070680_100219841 | 3300005336 | Bacteria | 1603 |
| 11 | Ga0070680_101035800 | 3300005336 | Bacteria | 709 |
| 12 | Ga0070680_101525829 | 3300005336 | Bacteria | 579 |
| 13 | Ga0068868_100143000 | 3300005338 | Bacteria | 1965 |
| 14 | Ga0068868_101163032 | 3300005338 | Unclassified | 712 |
| 15 | Ga0068868_101478115 | 3300005338 | Unclassified | 636 |
| 16 | Ga0070660_100030160 | 3300005339 | Bacteria | 4067 |
| 17 | Ga0070660_100528736 | 3300005339 | Bacteria | 983 |
| 18 | Ga0070689_100006129 | 3300005340 | Bacteria | 8285 |
| 19 | Ga0070661_100844017 | 3300005344 | Unclassified | 754 |
| 20 | Ga0070692_10535817 | 3300005345 | Bacteria | 765 |
| 21 | Ga0070675_100069340 | 3300005354 | Bacteria | 2921 |
| 22 | Ga0070671_100001056 | 3300005355 | Bacteria | 20295 |
| 23 | Ga0070674_100178247 | 3300005356 | Bacteria | 1625 |
| 24 | Ga0070674_100322274 | 3300005356 | Bacteria | 1239 |
| 25 | Ga0070673_100000288 | 3300005364 | Bacteria | 26193 |
| 26 | Ga0070688_100000246 | 3300005365 | Bacteria | 28716 |
| 27 | Ga0070659_101149173 | 3300005366 | Unclassified | 685 |
| 28 | Ga0070659_101750380 | 3300005366 | Bacteria | 556 |
| 29 | Ga0070667_100293427 | 3300005367 | Bacteria | 1463 |
| 30 | Ga0070667_100445767 | 3300005367 | Unclassified | 1182 |
| 31 | Ga0070709_10352404 | 3300005434 | Bacteria | 1088 |
| 32 | Ga0070713_100009493 | 3300005436 | Bacteria | 6968 |
| 33 | Ga0070710_10052426 | 3300005437 | Bacteria | 2294 |
| 34 | Ga0070701_10231570 | 3300005438 | Bacteria | 1107 |
| 35 | Ga0070701_11181850 | 3300005438 | Bacteria | 542 |
| 36 | Ga0070711_100006708 | 3300005439 | Bacteria | 6964 |
| 37 | Ga0070705_100452146 | 3300005440 | Unclassified | 964 |
| 38 | Ga0070694_100751084 | 3300005444 | Bacteria | 797 |
| 39 | Ga0070663_100254862 | 3300005455 | Bacteria | 1390 |
| 40 | Ga0070663_101303313 | 3300005455 | Unclassified | 641 |
| 41 | Ga0070678_100053633 | 3300005456 | Bacteria | 2933 |
| 42 | Ga0070662_100034357 | 3300005457 | Bacteria | 3575 |
| 43 | Ga0070662_100174522 | 3300005457 | Bacteria | 1690 |
| 44 | Ga0070662_101139184 | 3300005457 | Unclassified | 670 |
| 45 | Ga0070681_10040567 | 3300005458 | Bacteria | 4663 |
| 46 | Ga0070681_10384058 | 3300005458 | Bacteria | 1315 |
| 47 | Ga0068867_100232980 | 3300005459 | Bacteria | 1489 |
| 48 | Ga0068867_101864885 | 3300005459 | Bacteria | 566 |
| 49 | Ga0070685_10001919 | 3300005466 | Bacteria | 10785 |
| 50 | Ga0070706_100021407 | 3300005467 | Bacteria | 5956 |
| 51 | Ga0070706_101006648 | 3300005467 | Unclassified | 768 |
| 52 | Ga0070706_101192679 | 3300005467 | Unclassified | 699 |
| 53 | Ga0070707_100021703 | 3300005468 | Bacteria | 6068 |
| 54 | Ga0070707_101009851 | 3300005468 | Unclassified | 797 |
| 55 | Ga0070679_100492662 | 3300005530 | Bacteria | 1170 |
| 56 | Ga0070684_100242561 | 3300005535 | Bacteria | 1647 |
| 57 | Ga0070684_102048648 | 3300005535 | Bacteria | 540 |
| 58 | Ga0068853_100587707 | 3300005539 | Unclassified | 1057 |
| 59 | Ga0068853_100846628 | 3300005539 | Bacteria | 877 |
| 60 | Ga0068853_100967507 | 3300005539 | Bacteria | 819 |
| 61 | Ga0068853_102225262 | 3300005539 | Unclassified | 531 |
| 62 | Ga0070672_100013631 | 3300005543 | Bacteria | 5748 |
| 63 | Ga0070686_100204693 | 3300005544 | Bacteria | 1417 |
| 64 | Ga0070686_100562328 | 3300005544 | Bacteria | 894 |
| 65 | Ga0070696_100160412 | 3300005546 | Bacteria | 1656 |
| 66 | Ga0070696_100855068 | 3300005546 | Bacteria | 752 |
| 67 | Ga0070693_100022360 | 3300005547 | Bacteria | 3361 |
| 68 | Ga0070693_100345282 | 3300005547 | Bacteria | 1017 |
| 69 | Ga0070665_100030951 | 3300005548 | Bacteria | 5385 |
| 70 | Ga0070665_100108181 | 3300005548 | Bacteria | 2783 |
| 71 | Ga0070665_101852402 | 3300005548 | Unclassified | 609 |
| 72 | Ga0070704_100926981 | 3300005549 | Unclassified | 785 |
| 73 | Ga0070704_101434033 | 3300005549 | Unclassified | 634 |
| 74 | Ga0068855_100011712 | 3300005563 | Bacteria | 10599 |
| 75 | Ga0068855_100311371 | 3300005563 | Bacteria | 1742 |
| 76 | Ga0070664_100129014 | 3300005564 | Bacteria | 2220 |
| 77 | Ga0068854_100592397 | 3300005578 | Unclassified | 945 |
| 78 | Ga0068856_100278784 | 3300005614 | Bacteria | 1688 |
| 79 | Ga0070702_100150660 | 3300005615 | Bacteria | 1492 |
| 80 | Ga0068852_100036754 | 3300005616 | Bacteria | 4101 |
| 81 | Ga0068852_101346602 | 3300005616 | Unclassified | 736 |
| 82 | Ga0068859_100000740 | 3300005617 | Bacteria | 32876 |
| 83 | Ga0068864_100000422 | 3300005618 | Bacteria | 36527 |
| 84 | Ga0068866_10003735 | 3300005718 | Bacteria | 6244 |
| 85 | Ga0068861_100201866 | 3300005719 | Bacteria | 1669 |
| 86 | Ga0068851_10054065 | 3300005834 | Bacteria | 2045 |
| 87 | Ga0068851_10378607 | 3300005834 | Unclassified | 829 |
| 88 | Ga0068863_100009662 | 3300005841 | Bacteria | 9411 |
| 89 | Ga0068863_101953531 | 3300005841 | Unclassified | 597 |
| 90 | Ga0068858_100005858 | 3300005842 | Bacteria | 12008 |
| 91 | Ga0068860_100322453 | 3300005843 | Bacteria | 1516 |
| 92 | Ga0068860_100885954 | 3300005843 | Unclassified | 908 |
| 93 | Ga0081455_10012453 | 3300005937 | Bacteria | 8487 |
| 94 | Ga0070717_11271764 | 3300006028 | Unclassified | 669 |
| 95 | Ga0070715_10008490 | 3300006163 | Bacteria | 3583 |
| 96 | Ga0070716_100100308 | 3300006173 | Bacteria | 1773 |
| 97 | Ga0070716_100206575 | 3300006173 | Bacteria | 1309 |
| 98 | Ga0070712_100004526 | 3300006175 | Bacteria | 8585 |
| 99 | Ga0075367_10159581 | 3300006178 | Bacteria | 1402 |
| 100 | Ga0097621_100160323 | 3300006237 | Bacteria | 1933 |
| 101 | Ga0097621_100175330 | 3300006237 | Bacteria | 1850 |
| 102 | Ga0075370_10333530 | 3300006353 | Bacteria | 905 |
| 103 | Ga0068871_100204649 | 3300006358 | Bacteria | 1705 |
| 104 | Ga0075433_10856731 | 3300006852 | Unclassified | 793 |
| 105 | Ga0075434_100056706 | 3300006871 | Bacteria | 3894 |
| 106 | Ga0075434_101805039 | 3300006871 | Unclassified | 618 |
| 107 | Ga0068865_100052968 | 3300006881 | Bacteria | 2814 |
| 108 | Ga0075436_100298027 | 3300006914 | Bacteria | 1155 |
| 109 | Ga0075436_101500754 | 3300006914 | Viruses | 512 |
| 110 | Ga0097620_100000740 | 3300006931 | Bacteria | 32876 |
| 111 | Ga0075435_100308459 | 3300007076 | Bacteria | 1354 |
| 112 | Ga0075435_100316333 | 3300007076 | Bacteria | 1336 |
| 113 | Ga0075435_100418971 | 3300007076 | Viruses | 1153 |
| 114 | Ga0099795_10010136 | 3300007788 | Bacteria | 2762 |
| 115 | Ga0105240_10068859 | 3300009093 | Bacteria | 4382 |
| 116 | Ga0105240_11580880 | 3300009093 | Bacteria | 686 |
| 117 | Ga0105245_10011848 | 3300009098 | Bacteria | 7585 |
| 118 | Ga0105245_10219881 | 3300009098 | Bacteria | 1832 |
| 119 | Ga0105245_10219883 | 3300009098 | Bacteria | 1832 |
| 120 | Ga0105245_10842897 | 3300009098 | Bacteria | 956 |
| 121 | Ga0105245_11702011 | 3300009098 | Bacteria | 683 |
| 122 | Ga0105243_10123618 | 3300009148 | Bacteria | 2186 |
| 123 | Ga0105243_10226206 | 3300009148 | Bacteria | 1657 |
| 124 | Ga0105243_10716163 | 3300009148 | Unclassified | 977 |
| 125 | Ga0105241_10132806 | 3300009174 | Bacteria | 2017 |
| 126 | Ga0105241_10415148 | 3300009174 | Bacteria | 1183 |
| 127 | Ga0105241_10863236 | 3300009174 | Bacteria | 838 |
| 128 | Ga0105242_10018207 | 3300009176 | Bacteria | 5489 |
| 129 | Ga0105242_10031898 | 3300009176 | Bacteria | 4212 |
| 130 | Ga0105242_10211778 | 3300009176 | Bacteria | 1728 |
| 131 | Ga0105242_10640531 | 3300009176 | Bacteria | 1032 |
| 132 | Ga0105248_10037006 | 3300009177 | Bacteria | 5458 |
| 133 | Ga0105248_10368337 | 3300009177 | Bacteria | 1617 |
| 134 | Ga0105248_11846167 | 3300009177 | Bacteria | 686 |
| 135 | Ga0105237_11092702 | 3300009545 | Bacteria | 804 |
| 136 | Ga0105238_10449513 | 3300009551 | Bacteria | 1285 |
| 137 | Ga0105249_10296823 | 3300009553 | Bacteria | 1619 |
| 138 | Ga0105249_12111934 | 3300009553 | Bacteria | 636 |
| 139 | Ga0105249_13259583 | 3300009553 | Bacteria | 522 |
| 140 | Ga0099796_10004216 | 3300010159 | Bacteria | 3451 |
| 141 | Ga0105239_10436126 | 3300010375 | Bacteria | 1485 |
| 142 | Ga0105239_10676383 | 3300010375 | Unclassified | 1179 |
| 143 | Ga0105239_11589775 | 3300010375 | Viruses | 756 |
| 144 | Ga0105246_10369705 | 3300011119 | Bacteria | 1181 |
| 145 | Ga0105246_10849500 | 3300011119 | Bacteria | 814 |
| 146 | Ga0157373_10422221 | 3300013100 | Bacteria | 957 |
| 147 | Ga0157371_11157621 | 3300013102 | Bacteria | 595 |
| 148 | Ga0157370_10892880 | 3300013104 | Bacteria | 807 |
| 149 | Ga0157370_11060560 | 3300013104 | Bacteria | 733 |
| 150 | Ga0157369_10503917 | 3300013105 | Unclassified | 1252 |
| 151 | Ga0157369_11303820 | 3300013105 | Unclassified | 740 |
| 152 | Ga0157374_10001706 | 3300013296 | Bacteria | 18421 |
| 153 | Ga0157378_10216435 | 3300013297 | Bacteria | 1819 |
| 154 | Ga0157378_10375609 | 3300013297 | Bacteria | 1395 |
| 155 | Ga0157378_10870956 | 3300013297 | Unclassified | 930 |
| 156 | Ga0157378_12277005 | 3300013297 | Unclassified | 593 |
| 157 | Ga0157378_12670953 | 3300013297 | Unclassified | 552 |
| 158 | Ga0163162_10270128 | 3300013306 | Bacteria | 1832 |
| 159 | Ga0163162_10274041 | 3300013306 | Bacteria | 1819 |
| 160 | Ga0163162_10695011 | 3300013306 | Bacteria | 1139 |
| 161 | Ga0157372_10272235 | 3300013307 | Bacteria | 1968 |
| 162 | Ga0157372_13185201 | 3300013307 | Bacteria | 523 |
| 163 | Ga0157375_10001525 | 3300013308 | Bacteria | 19910 |
| 164 | Ga0157375_11491364 | 3300013308 | Bacteria | 798 |
| 165 | Ga0163163_10000748 | 3300014325 | Bacteria | 27686 |
| 166 | Ga0163163_11870877 | 3300014325 | Bacteria | 660 |
| 167 | Ga0157379_10022888 | 3300014968 | Bacteria | 5539 |
| 168 | Ga0157376_10156348 | 3300014969 | Bacteria | 2062 |
| 169 | Ga0157376_10177763 | 3300014969 | Bacteria | 1943 |
| 170 | Ga0157376_10178971 | 3300014969 | Bacteria | 1936 |
| 171 | Ga0163161_10043650 | 3300017792 | Bacteria | 3228 |
| 172 | Ga0213874_10188094 | 3300021377 | Bacteria | 737 |
| 173 | Ga0213871_10053114 | 3300021441 | Bacteria | 1115 |
| 174 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 175 | Ga0209233_1000982 | 3300025261 | Bacteria | 12227 |
| 176 | Ga0207656_10268053 | 3300025321 | Bacteria | 840 |
| 177 | Ga0207692_10005142 | 3300025898 | Bacteria | 5219 |
| 178 | Ga0207680_10003729 | 3300025903 | Bacteria | 7166 |
| 179 | Ga0207680_10698613 | 3300025903 | Bacteria | 727 |
| 180 | Ga0207685_10006663 | 3300025905 | Bacteria | 3163 |
| 181 | Ga0207699_10092635 | 3300025906 | Bacteria | 1900 |
| 182 | Ga0207645_10037113 | 3300025907 | Bacteria | 3128 |
| 183 | Ga0207643_10079373 | 3300025908 | Bacteria | 1899 |
| 184 | Ga0207705_10214232 | 3300025909 | Unclassified | 1461 |
| 185 | Ga0207705_10280530 | 3300025909 | Bacteria | 1275 |
| 186 | Ga0207684_10015437 | 3300025910 | Bacteria | 6572 |
| 187 | Ga0207684_10805790 | 3300025910 | Unclassified | 794 |
| 188 | Ga0207654_10227222 | 3300025911 | Bacteria | 1241 |
| 189 | Ga0207654_10464937 | 3300025911 | Bacteria | 889 |
| 190 | Ga0207654_10714402 | 3300025911 | Unclassified | 720 |
| 191 | Ga0207707_10330537 | 3300025912 | Bacteria | 1315 |
| 192 | Ga0207695_10028065 | 3300025913 | Bacteria | 6251 |
| 193 | Ga0207693_10003184 | 3300025915 | Bacteria | 14101 |
| 194 | Ga0207693_10201302 | 3300025915 | Unclassified | 1566 |
| 195 | Ga0207663_10000577 | 3300025916 | Bacteria | 16163 |
| 196 | Ga0207663_10193963 | 3300025916 | Bacteria | 1460 |
| 197 | Ga0207660_10009355 | 3300025917 | Bacteria | 6341 |
| 198 | Ga0207660_11637369 | 3300025917 | Bacteria | 518 |
| 199 | Ga0207694_10935643 | 3300025924 | Bacteria | 733 |
| 200 | Ga0207650_10070874 | 3300025925 | Bacteria | 2621 |
| 201 | Ga0207650_10701094 | 3300025925 | Bacteria | 855 |
| 202 | Ga0207659_10930369 | 3300025926 | Bacteria | 748 |
| 203 | Ga0207659_11164419 | 3300025926 | Unclassified | 663 |
| 204 | Ga0207687_10001115 | 3300025927 | Bacteria | 18251 |
| 205 | Ga0207687_10014765 | 3300025927 | Bacteria | 5115 |
| 206 | Ga0207687_10512848 | 3300025927 | Bacteria | 1002 |
| 207 | Ga0207700_10011158 | 3300025928 | Bacteria | 5717 |
| 208 | Ga0207644_10013274 | 3300025931 | Bacteria | 5489 |
| 209 | Ga0207644_10242814 | 3300025931 | Bacteria | 1434 |
| 210 | Ga0207644_11745097 | 3300025931 | Unclassified | 521 |
| 211 | Ga0207706_10081463 | 3300025933 | Bacteria | 2844 |
| 212 | Ga0207706_10265452 | 3300025933 | Bacteria | 1498 |
| 213 | Ga0207706_10682929 | 3300025933 | Bacteria | 878 |
| 214 | Ga0207706_11296588 | 3300025933 | Unclassified | 602 |
| 215 | Ga0207686_10001673 | 3300025934 | Bacteria | 12345 |
| 216 | Ga0207686_10033406 | 3300025934 | Bacteria | 3071 |
| 217 | Ga0207686_10057839 | 3300025934 | Bacteria | 2442 |
| 218 | Ga0207686_10320410 | 3300025934 | Bacteria | 1158 |
| 219 | Ga0207709_10425058 | 3300025935 | Bacteria | 1021 |
| 220 | Ga0207709_11197466 | 3300025935 | Bacteria | 626 |
| 221 | Ga0207670_10016203 | 3300025936 | Bacteria | 4473 |
| 222 | Ga0207669_10091106 | 3300025937 | Bacteria | 1985 |
| 223 | Ga0207669_10704372 | 3300025937 | Bacteria | 830 |
| 224 | Ga0207704_10101851 | 3300025938 | Bacteria | 1916 |
| 225 | Ga0207665_10010146 | 3300025939 | Bacteria | 6183 |
| 226 | Ga0207665_10320237 | 3300025939 | Bacteria | 1163 |
| 227 | Ga0207691_10018523 | 3300025940 | Bacteria | 6598 |
| 228 | Ga0207691_10111054 | 3300025940 | Bacteria | 2438 |
| 229 | Ga0207691_10365567 | 3300025940 | Bacteria | 1233 |
| 230 | Ga0207711_10000495 | 3300025941 | Bacteria | 40705 |
| 231 | Ga0207711_10373381 | 3300025941 | Bacteria | 1323 |
| 232 | Ga0207689_10449830 | 3300025942 | Bacteria | 1077 |
| 233 | Ga0207689_10468421 | 3300025942 | Unclassified | 1054 |
| 234 | Ga0207661_10104077 | 3300025944 | Bacteria | 2390 |
| 235 | Ga0207679_10093111 | 3300025945 | Bacteria | 2336 |
| 236 | Ga0207679_10229208 | 3300025945 | Bacteria | 1567 |
| 237 | Ga0207667_10261359 | 3300025949 | Bacteria | 1770 |
| 238 | Ga0207667_10377571 | 3300025949 | Bacteria | 1444 |
| 239 | Ga0207651_10000412 | 3300025960 | Bacteria | 18175 |
| 240 | Ga0207651_10903520 | 3300025960 | Bacteria | 787 |
| 241 | Ga0207712_11643977 | 3300025961 | Bacteria | 576 |
| 242 | Ga0207640_10244693 | 3300025981 | Bacteria | 1388 |
| 243 | Ga0207640_10454767 | 3300025981 | Bacteria | 1056 |
| 244 | Ga0207658_10022073 | 3300025986 | Bacteria | 4427 |
| 245 | Ga0207658_10497122 | 3300025986 | Unclassified | 1086 |
| 246 | Ga0207658_10570258 | 3300025986 | Bacteria | 1014 |
| 247 | Ga0207658_12187088 | 3300025986 | Bacteria | 502 |
| 248 | Ga0207677_10000254 | 3300026023 | Bacteria | 41317 |
| 249 | Ga0207677_11081186 | 3300026023 | Bacteria | 730 |
| 250 | Ga0207703_10000640 | 3300026035 | Bacteria | 35154 |
| 251 | Ga0207639_10696449 | 3300026041 | Bacteria | 942 |
| 252 | Ga0207678_10098059 | 3300026067 | Bacteria | 2504 |
| 253 | Ga0207678_10605725 | 3300026067 | Bacteria | 960 |
| 254 | Ga0207702_10340923 | 3300026078 | Bacteria | 1432 |
| 255 | Ga0207641_10001482 | 3300026088 | Bacteria | 23006 |
| 256 | Ga0207648_10019985 | 3300026089 | Bacteria | 6042 |
| 257 | Ga0207648_10571307 | 3300026089 | Bacteria | 1040 |
| 258 | Ga0207676_10000481 | 3300026095 | Bacteria | 33594 |
| 259 | Ga0207676_12498385 | 3300026095 | Bacteria | 513 |
| 260 | Ga0207675_100642932 | 3300026118 | Bacteria | 1066 |
| 261 | Ga0207675_100943984 | 3300026118 | Bacteria | 880 |
| 262 | Ga0207683_10057110 | 3300026121 | Bacteria | 3426 |
| 263 | Ga0207683_10615711 | 3300026121 | Unclassified | 1005 |
| 264 | Ga0207698_10286644 | 3300026142 | Bacteria | 1526 |
| 265 | Ga0207698_12351197 | 3300026142 | Unclassified | 544 |
| 266 | Ga0207698_12755522 | 3300026142 | Bacteria | 500 |
| 267 | Ga0268266_10030201 | 3300028379 | Bacteria | 4605 |
| 268 | Ga0268266_10079518 | 3300028379 | Bacteria | 2855 |
| 269 | Ga0268266_11410160 | 3300028379 | Unclassified | 672 |
| 270 | Ga0268264_10001658 | 3300028381 | Bacteria | 20536 |
| 271 | Ga0268264_10295691 | 3300028381 | Bacteria | 1522 |
| 272 | Ga0268264_10784650 | 3300028381 | Unclassified | 951 |
| 273 | Ga0265338_10620265 | 3300028800 | Bacteria | 752 |
| 274 | Ga0307409_100793046 | 3300031995 | Bacteria | 954 |
| 275 | Ga0307415_100224693 | 3300032126 | Bacteria | 1508 |
| 276 | Ga0373926_0082457 | 3300035083 | Bacteria | 1190 |
| 277 | Ga0373926_0087500 | 3300035083 | Bacteria | 1156 |
| 278 | Ga0373928_0110823 | 3300035084 | Unclassified | 726 |
| 279 | Ga0373934_0001393 | 3300035086 | Bacteria | 8817 |
| 280 | Ga0373923_0000210 | 3300035111 | Bacteria | 12063 |
| 281 | Ga0373936_0058841 | 3300035113 | Bacteria | 1565 |
| 282 | Ga0373936_0095399 | 3300035113 | Bacteria | 1250 |
| 283 | Ga0373945_0008878 | 3300035116 | Bacteria | 3284 |
| 284 | Ga0373945_0059727 | 3300035116 | Bacteria | 1420 |
| 285 | Ga0373945_0339375 | 3300035116 | Bacteria | 650 |
| 286 | Ga0373953_0002347 | 3300035117 | Bacteria | 5699 |
| 287 | Ga0373954_0002454 | 3300035118 | Bacteria | 7773 |
| 288 | Ga0373956_0000920 | 3300035119 | Bacteria | 12203 |
| 289 | Ga0373957_0016546 | 3300035120 | Bacteria | 2553 |
| 290 | Ga0373943_0011339 | 3300035170 | Bacteria | 4009 |
| 291 | Ga0373943_0052707 | 3300035170 | Bacteria | 2006 |
| 292 | Ga0373943_0102812 | 3300035170 | Bacteria | 1497 |
| 293 | Ga0373943_0363563 | 3300035170 | Bacteria | 831 |
| 294 | Ga0373946_0142663 | 3300035171 | Bacteria | 1111 |
| 295 | Ga0373946_0172238 | 3300035171 | Bacteria | 1022 |
| 296 | Ga0373946_0176720 | 3300035171 | Unclassified | 1011 |
| 297 | Ga0373955_0001397 | 3300035172 | Bacteria | 10273 |
| 298 | Ga0373924_0042119 | 3300035410 | Bacteria | 1872 |
| 299 | Ga0373931_0146510 | 3300035691 | Bacteria | 1373 |
| 300 | Ga0373931_0307897 | 3300035691 | Bacteria | 980 |
| 301 | Ga0373935_0047165 | 3300035692 | Bacteria | 2723 |
| 302 | Ga0373935_0149787 | 3300035692 | Bacteria | 1582 |
| 303 | Ga0373935_0160871 | 3300035692 | Bacteria | 1530 |
| 304 | Ga0373935_0892106 | 3300035692 | Unclassified | 658 |
| 305 | Ga0373927_0049957 | 3300035695 | Bacteria | 2704 |
| 306 | Ga0373927_0058660 | 3300035695 | Bacteria | 2489 |
| 307 | Ga0373933_0051983 | 3300035724 | Bacteria | 2450 |
| 308 | Ga0373933_0057006 | 3300035724 | Bacteria | 2346 |
| 309 | Ga0373933_1069745 | 3300035724 | Unclassified | 531 |
| 310 | Ga0373947_0008022 | 3300035725 | Bacteria | 6090 |
| 311 | Ga0373947_0026644 | 3300035725 | Bacteria | 3380 |
| 312 | Ga0373947_0338964 | 3300035725 | Bacteria | 1007 |
| 313 | Ga0373937_0006300 | 3300036401 | Bacteria | 10233 |
| 314 | Ga0373937_0020390 | 3300036401 | Bacteria | 5944 |
| 315 | Ga0373937_0786376 | 3300036401 | Bacteria | 899 |
| 316 | Ga0373925_0013479 | 3300037068 | Bacteria | 5917 |
| 317 | Ga0373925_0413387 | 3300037068 | Bacteria | 1101 |
| 318 | Ga0373925_0485605 | 3300037068 | Bacteria | 1013 |
| 319 | Ga0373925_0525142 | 3300037068 | Bacteria | 973 |
| 320 | Ga0395899_0329570 | 3300037312 | Bacteria | 1026 |
| 321 | Ga0395900_0015810 | 3300037418 | Bacteria | 7693 |
| 322 | Ga0395898_1644118 | 3300037466 | Bacteria | 566 |
| 323 | Ga0395905_0046098 | 3300037471 | Bacteria | 4088 |
| 324 | Ga0395905_0089718 | 3300037471 | Bacteria | 2881 |
| 325 | Ga0395905_0105647 | 3300037471 | Bacteria | 2644 |
| 326 | Ga0395905_0194838 | 3300037471 | Bacteria | 1900 |
| 327 | Ga0395905_0840130 | 3300037471 | Bacteria | 821 |
| 328 | Ga0395905_1800288 | 3300037471 | Bacteria | 518 |
| 329 | Ga0436360_0059423 | 3300039438 | Bacteria | 697 |
| 330 | Ga0436360_0743645 | 3300039438 | Bacteria | 1935 |
| 331 | Ga0436361_1196724 | 3300039447 | Bacteria | 1110 |
| 332 | Ga0436363_1119547 | 3300039450 | Bacteria | 6556 |
| 333 | Ga0436362_1045778 | 3300039453 | Bacteria | 1895 |
| 334 | Ga0436362_1242066 | 3300039453 | Bacteria | 657 |
| 335 | Ga0451789_0308947 | 3300041443 | Bacteria | 1104 |
| 336 | Ga0451802_0959190 | 3300041460 | Unclassified | 867 |
| 337 | Ga0451807_0192404 | 3300041486 | Bacteria | 1276 |
| 338 | Ga0451839_0292333 | 3300041496 | Bacteria | 852 |
| 339 | Ga0451845_0926531 | 3300041501 | Unclassified | 705 |
| 340 | Ga0451853_1607039 | 3300041512 | Bacteria | 713 |
| 341 | Ga0451853_3736650 | 3300041512 | Bacteria | 2343 |
| 342 | Ga0451577_0194437 | 3300042876 | Bacteria | 1830 |
| 343 | Ga0453684_0042938 | 3300044712 | Bacteria | 6086 |
| 344 | Ga0453684_0056669 | 3300044712 | Bacteria | 5080 |
| 345 | Ga0495603_0501779 | 3300046455 | Unclassified | 695 |
| 346 | Ga0495603_0516385 | 3300046455 | Unclassified | 684 |
| 347 | Ga0495629_0743771 | 3300046459 | Unclassified | 649 |
| 348 | Ga0495641_0554179 | 3300046461 | Unclassified | 525 |
| 349 | Ga0495653_0151317 | 3300046463 | Unclassified | 1621 |
| 350 | Ga0495653_0189315 | 3300046463 | Bacteria | 1405 |
| 351 | Ga0495653_0915140 | 3300046463 | Bacteria | 522 |
| 352 | Ga0495580_0009062 | 3300046472 | Bacteria | 7850 |
| 353 | Ga0495580_0313645 | 3300046472 | Unclassified | 1066 |
| 354 | Ga0495582_0016415 | 3300046473 | Bacteria | 4057 |
| 355 | Ga0495639_0162430 | 3300046475 | Bacteria | 1082 |
| 356 | Ga0495662_0026964 | 3300046476 | Bacteria | 2775 |
| 357 | Ga0495662_0052425 | 3300046476 | Bacteria | 1970 |
| 358 | Ga0495664_0214451 | 3300046477 | Bacteria | 1166 |
| 359 | Ga0495664_0295679 | 3300046477 | Bacteria | 978 |
| 360 | Ga0495584_0447398 | 3300046491 | Unclassified | 657 |
| 361 | Ga0495594_0130684 | 3300046499 | Unclassified | 1422 |
| 362 | Ga0495608_0181078 | 3300046511 | Bacteria | 1333 |
| 363 | Ga0495618_0174696 | 3300046514 | Bacteria | 1366 |
| 364 | Ga0495628_0331300 | 3300046516 | Bacteria | 1122 |
| 365 | Ga0495630_0058441 | 3300046517 | Bacteria | 2891 |
| 366 | Ga0495630_0069934 | 3300046517 | Bacteria | 2641 |
| 367 | Ga0495630_0096911 | 3300046517 | Bacteria | 2230 |
| 368 | Ga0495663_0243332 | 3300046525 | Bacteria | 637 |
| 369 | Ga0495666_0046885 | 3300046526 | Bacteria | 2082 |
| 370 | Ga0495666_0078305 | 3300046526 | Bacteria | 1566 |
| 371 | Ga0495666_0111746 | 3300046526 | Bacteria | 1283 |
| 372 | Ga0495652_0249852 | 3300046529 | Bacteria | 1315 |
| 373 | Ga0495665_0055603 | 3300046531 | Bacteria | 2089 |
| 374 | Ga0495640_0199395 | 3300046533 | Bacteria | 1269 |
| 375 | Ga0495640_0746924 | 3300046533 | Bacteria | 585 |
| 376 | Ga0495586_0174591 | 3300046535 | Bacteria | 1214 |
| 377 | Ga0495621_0004073 | 3300046539 | Bacteria | 4070 |
| 378 | Ga0495645_0126038 | 3300046543 | Bacteria | 1799 |
| 379 | Ga0495645_0471200 | 3300046543 | Bacteria | 789 |
| 380 | Ga0495667_0112656 | 3300046559 | Bacteria | 1758 |
| 381 | Ga0495634_0006196 | 3300046642 | Bacteria | 9115 |
| 382 | Ga0495634_0276294 | 3300046642 | Unclassified | 1021 |
| 383 | Ga0495635_0013358 | 3300046663 | Bacteria | 5748 |
| 384 | Ga0495635_0168269 | 3300046663 | Bacteria | 1491 |
| 385 | Ga0495659_0025567 | 3300046664 | Bacteria | 2022 |
| 386 | Ga0495588_0041659 | 3300046674 | Bacteria | 2346 |
| 387 | Ga0495657_0489922 | 3300046675 | Unclassified | 717 |
| 388 | Ga0495599_0268763 | 3300046678 | Bacteria | 1035 |
| 389 | Ga0495623_0008420 | 3300046679 | Bacteria | 6701 |
| 390 | Ga0495646_0592170 | 3300046680 | Unclassified | 564 |
| 391 | Ga0495647_0002734 | 3300046681 | Bacteria | 5596 |
| 392 | Ga0495647_0308056 | 3300046681 | Bacteria | 715 |
| 393 | Ga0495647_0389427 | 3300046681 | Unclassified | 639 |
| 394 | Ga0495658_0012093 | 3300046683 | Bacteria | 4359 |
| 395 | Ga0495613_0004932 | 3300046689 | Bacteria | 10027 |
| 396 | Ga0495613_0009140 | 3300046689 | Bacteria | 7347 |
| 397 | Ga0495624_0283143 | 3300046690 | Bacteria | 1001 |
| 398 | Ga0495581_0000879 | 3300047315 | Bacteria | 16066 |
| 399 | Ga0495581_0569471 | 3300047315 | Bacteria | 657 |
| 400 | Ga0495604_0102756 | 3300047317 | Bacteria | 2098 |
| 401 | Ga0495674_0329633 | 3300047319 | Bacteria | 1242 |
| 402 | Ga0495674_0906711 | 3300047319 | Bacteria | 680 |
| 403 | Ga0495676_0063469 | 3300047321 | Bacteria | 2879 |
| 404 | Ga0495676_0563556 | 3300047321 | Bacteria | 744 |
| 405 | Ga0495676_1085712 | 3300047321 | Bacteria | 509 |
| 406 | Ga0495680_0018982 | 3300047322 | Bacteria | 5822 |
| 407 | Ga0495680_0721395 | 3300047322 | Bacteria | 657 |
| 408 | Ga0495675_0246810 | 3300047444 | Bacteria | 1073 |
| 409 | Ga0495684_0009051 | 3300047471 | Bacteria | 7686 |
| 410 | Ga0495684_0370270 | 3300047471 | Bacteria | 1013 |
| 411 | Ga0495593_0172782 | 3300047673 | Bacteria | 1089 |
| 412 | Ga0495614_0054877 | 3300048089 | Bacteria | 1709 |
| 413 | Ga0496100_0101876 | 3300048903 | Bacteria | 1980 |
| 414 | Ga0496101_1155165 | 3300048904 | Bacteria | 607 |
| 415 | Ga0496104_0003090 | 3300048907 | Bacteria | 14349 |
| 416 | Ga0496105_0008052 | 3300048908 | Bacteria | 8191 |
| 417 | Ga0496105_0602059 | 3300048908 | Bacteria | 853 |
| 418 | Ga0496107_0029893 | 3300048910 | Bacteria | 3880 |
| 419 | Ga0496108_0015347 | 3300048911 | Bacteria | 6248 |
| 420 | Ga0496108_0016049 | 3300048911 | Bacteria | 6107 |
| 421 | Ga0496109_0014974 | 3300048912 | Bacteria | 6750 |
| 422 | Ga0496109_0031869 | 3300048912 | Bacteria | 4735 |
| 423 | Ga0496109_0399314 | 3300048912 | Unclassified | 1299 |
| 424 | Ga0496110_0073594 | 3300048913 | Bacteria | 3032 |
| 425 | Ga0496110_0363128 | 3300048913 | Bacteria | 1319 |
| 426 | Ga0496111_0076466 | 3300048914 | Bacteria | 2440 |
| 427 | Ga0496112_0005494 | 3300048915 | Bacteria | 10973 |
| 428 | Ga0496112_0019235 | 3300048915 | Bacteria | 6441 |
| 429 | Ga0496112_1452597 | 3300048915 | Bacteria | 600 |
| 430 | Ga0496113_0401120 | 3300048916 | Bacteria | 1101 |
| 431 | Ga0496114_0013724 | 3300048917 | Bacteria | 6494 |
| 432 | Ga0496114_0407185 | 3300048917 | Bacteria | 1204 |
| 433 | Ga0496115_0373431 | 3300048918 | Bacteria | 1161 |
| 434 | Ga0501031_0050411 | 3300049568 | Bacteria | 2712 |
| 435 | Ga0501033_0014998 | 3300049570 | Bacteria | 5881 |
| 436 | Ga0501034_1060006 | 3300049571 | Bacteria | 693 |
| 437 | Ga0501036_0085493 | 3300049572 | Bacteria | 2666 |
| 438 | Ga0501038_0031685 | 3300049574 | Bacteria | 4670 |
| 439 | Ga0501039_0480789 | 3300049575 | Bacteria | 975 |
| 440 | Ga0501040_0079685 | 3300049576 | Bacteria | 2267 |
| 441 | Ga0501041_0002085 | 3300049577 | Bacteria | 11251 |
| 442 | Ga0501042_0004777 | 3300049578 | Bacteria | 8654 |
| 443 | Ga0501042_0580053 | 3300049578 | Unclassified | 815 |
| 444 | Ga0501046_0024882 | 3300049580 | Bacteria | 4905 |
| 445 | Ga0501068_0007079 | 3300049584 | Bacteria | 6211 |
| 446 | Ga0501070_0348556 | 3300049586 | Bacteria | 1202 |
| 447 | Ga0501071_0028308 | 3300049587 | Bacteria | 3948 |
| 448 | Ga0501071_0826234 | 3300049587 | Unclassified | 715 |
| 449 | Ga0501071_1482828 | 3300049587 | Bacteria | 524 |
| 450 | Ga0501072_0206376 | 3300049588 | Bacteria | 1566 |
| 451 | Ga0501072_1112070 | 3300049588 | Bacteria | 615 |
| 452 | Ga0501072_1519070 | 3300049588 | Bacteria | 517 |
| 453 | Ga0501073_0437155 | 3300049589 | Bacteria | 904 |
| 454 | Ga0501074_0380733 | 3300049590 | Bacteria | 1001 |
| 455 | Ga0501074_0752737 | 3300049590 | Bacteria | 687 |
| 456 | Ga0501075_0030036 | 3300049591 | Bacteria | 4022 |
| 457 | Ga0501076_0135072 | 3300049592 | Bacteria | 2002 |
| 458 | Ga0501077_0004246 | 3300049593 | Bacteria | 8659 |
| 459 | Ga0501079_0004267 | 3300049741 | Bacteria | 10607 |
| 460 | Ga0501081_0031968 | 3300049743 | Bacteria | 3568 |
| 461 | Ga0501035_0149732 | 3300049822 | Bacteria | 2026 |
| 462 | Ga0501045_0045517 | 3300049824 | Bacteria | 3194 |
| 463 | nmdc:mga0k408_857181_c1 | 3300050493 | Unclassified | 528 |
| 464 | nmdc:mga06z11_233389_c1 | 3300050494 | Bacteria | 1078 |
| 465 | nmdc:mga0n895_634780_c1 | 3300050512 | Bacteria | 1068 |
| 466 | nmdc:mga0n895_77090_c1 | 3300050512 | Bacteria | 3315 |
| 467 | nmdc:mga0rr50_284254_c1 | 3300050513 | Bacteria | 1381 |
| 468 | nmdc:mga0rr50_413698_c1 | 3300050513 | Bacteria | 1140 |
| 469 | nmdc:mga0rr50_804432_c1 | 3300050513 | Viruses | 802 |
| 470 | nmdc:mga08x19_238877_c1 | 3300050514 | Bacteria | 1252 |
| 471 | nmdc:mga0sz30_454479_c1 | 3300050516 | Bacteria | 575 |
| 472 | Ga0495601_0123483 | 3300053077 | Bacteria | 1683 |
| 473 | Ga0495612_0019390 | 3300053078 | Bacteria | 2724 |
| 474 | Ga0495612_0085565 | 3300053078 | Bacteria | 1329 |
| 475 | Ga0495619_0004675 | 3300053085 | Bacteria | 8724 |
| 476 | Ga0495619_0122294 | 3300053085 | Bacteria | 1785 |
| 477 | Ga0500566_0176463 | 3300053094 | Bacteria | 1100 |
| 478 | Ga0501084_1051638 | 3300054114 | Bacteria | 684 |
| 479 | Ga0501082_0015246 | 3300060353 | Bacteria | 6620 |
| 480 | Ga0530510_0047448 | 3300061734 | Bacteria | 3103 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025915 | Ga0207693_10201302 | Ga0207693_102013023 | 77 |
| 2 | 3300035116 | Ga0373945_0339375 | Ga0373945_0339375_366_602 | 77 |
| 3 | 3300035692 | Ga0373935_0160871 | Ga0373935_0160871_119_355 | 77 |
| 4 | 3300046477 | Ga0495664_0295679 | Ga0495664_0295679_379_615 | 77 |
| 5 | 3300047321 | Ga0495676_0063469 | Ga0495676_0063469_1401_1637 | 77 |
| 6 | 3300025907 | Ga0207645_10037113 | Ga0207645_100371133 | 83 |
| 7 | 3300049590 | Ga0501074_0380733 | Ga0501074_0380733_119_376 | 83 |
| 8 | 3300025960 | Ga0207651_10903520 | Ga0207651_109035201 | 84 |
| 9 | 3300042876 | Ga0451577_0194437 | Ga0451577_0194437_1235_1492 | 84 |
| 10 | 3300044712 | Ga0453684_0056669 | Ga0453684_0056669_1967_2224 | 84 |
| 11 | 3300050493 | nmdc:mga0k408_857181_c1 | nmdc:mga0k408_857181_c1_92_349 | 84 |
| 12 | 3300005293 | Ga0065715_10040593 | Ga0065715_100405933 | 85 |
| 13 | 3300005328 | Ga0070676_10725705 | Ga0070676_107257052 | 85 |
| 14 | 3300005330 | Ga0070690_100013069 | Ga0070690_1000130691 | 85 |
| 15 | 3300005331 | Ga0070670_100035630 | Ga0070670_1000356303 | 85 |
| 16 | 3300005334 | Ga0068869_101325210 | Ga0068869_1013252102 | 85 |
| 17 | 3300005335 | Ga0070666_10141667 | Ga0070666_101416672 | 85 |
| 18 | 3300005338 | Ga0068868_100143000 | Ga0068868_1001430002 | 85 |
| 19 | 3300005338 | Ga0068868_101478115 | Ga0068868_1014781151 | 85 |
| 20 | 3300005340 | Ga0070689_100006129 | Ga0070689_10000612911 | 85 |
| 21 | 3300005345 | Ga0070692_10535817 | Ga0070692_105358172 | 85 |
| 22 | 3300005355 | Ga0070671_100001056 | Ga0070671_1000010568 | 85 |
| 23 | 3300005356 | Ga0070674_100178247 | Ga0070674_1001782473 | 85 |
| 24 | 3300005356 | Ga0070674_100322274 | Ga0070674_1003222742 | 85 |
| 25 | 3300005364 | Ga0070673_100000288 | Ga0070673_10000028816 | 85 |
| 26 | 3300005365 | Ga0070688_100000246 | Ga0070688_1000002468 | 85 |
| 27 | 3300005366 | Ga0070659_101750380 | Ga0070659_1017503802 | 85 |
| 28 | 3300005367 | Ga0070667_100445767 | Ga0070667_1004457672 | 85 |
| 29 | 3300005434 | Ga0070709_10352404 | Ga0070709_103524041 | 85 |
| 30 | 3300005436 | Ga0070713_100009493 | Ga0070713_1000094938 | 85 |
| 31 | 3300005437 | Ga0070710_10052426 | Ga0070710_100524261 | 85 |
| 32 | 3300005438 | Ga0070701_10231570 | Ga0070701_102315702 | 85 |
| 33 | 3300005438 | Ga0070701_11181850 | Ga0070701_111818502 | 85 |
| 34 | 3300005439 | Ga0070711_100006708 | Ga0070711_1000067087 | 85 |
| 35 | 3300005440 | Ga0070705_100452146 | Ga0070705_1004521462 | 85 |
| 36 | 3300005444 | Ga0070694_100751084 | Ga0070694_1007510842 | 85 |
| 37 | 3300005455 | Ga0070663_100254862 | Ga0070663_1002548622 | 85 |
| 38 | 3300005456 | Ga0070678_100053633 | Ga0070678_1000536334 | 85 |
| 39 | 3300005457 | Ga0070662_100034357 | Ga0070662_1000343571 | 85 |
| 40 | 3300005457 | Ga0070662_101139184 | Ga0070662_1011391842 | 85 |
| 41 | 3300005458 | Ga0070681_10384058 | Ga0070681_103840582 | 85 |
| 42 | 3300005459 | Ga0068867_100232980 | Ga0068867_1002329801 | 85 |
| 43 | 3300005459 | Ga0068867_101864885 | Ga0068867_1018648852 | 85 |
| 44 | 3300005466 | Ga0070685_10001919 | Ga0070685_100019198 | 85 |
| 45 | 3300005467 | Ga0070706_100021407 | Ga0070706_1000214073 | 85 |
| 46 | 3300005467 | Ga0070706_101192679 | Ga0070706_1011926791 | 85 |
| 47 | 3300005468 | Ga0070707_100021703 | Ga0070707_1000217034 | 85 |
| 48 | 3300005468 | Ga0070707_101009851 | Ga0070707_1010098512 | 85 |
| 49 | 3300005535 | Ga0070684_100242561 | Ga0070684_1002425612 | 85 |
| 50 | 3300005535 | Ga0070684_102048648 | Ga0070684_1020486481 | 85 |
| 51 | 3300005539 | Ga0068853_100967507 | Ga0068853_1009675072 | 85 |
| 52 | 3300005543 | Ga0070672_100013631 | Ga0070672_1000136317 | 85 |
| 53 | 3300005544 | Ga0070686_100204693 | Ga0070686_1002046932 | 85 |
| 54 | 3300005544 | Ga0070686_100562328 | Ga0070686_1005623281 | 85 |
| 55 | 3300005546 | Ga0070696_100160412 | Ga0070696_1001604122 | 85 |
| 56 | 3300005546 | Ga0070696_100855068 | Ga0070696_1008550681 | 85 |
| 57 | 3300005547 | Ga0070693_100022360 | Ga0070693_1000223604 | 85 |
| 58 | 3300005547 | Ga0070693_100345282 | Ga0070693_1003452822 | 85 |
| 59 | 3300005548 | Ga0070665_100030951 | Ga0070665_1000309517 | 85 |
| 60 | 3300005549 | Ga0070704_100926981 | Ga0070704_1009269812 | 85 |
| 61 | 3300005549 | Ga0070704_101434033 | Ga0070704_1014340332 | 85 |
| 62 | 3300005578 | Ga0068854_100592397 | Ga0068854_1005923972 | 85 |
| 63 | 3300005614 | Ga0068856_100278784 | Ga0068856_1002787842 | 85 |
| 64 | 3300005615 | Ga0070702_100150660 | Ga0070702_1001506601 | 85 |
| 65 | 3300005616 | Ga0068852_100036754 | Ga0068852_1000367542 | 85 |
| 66 | 3300005617 | Ga0068859_100000740 | Ga0068859_10000074016 | 85 |
| 67 | 3300005618 | Ga0068864_100000422 | Ga0068864_10000042219 | 85 |
| 68 | 3300005718 | Ga0068866_10003735 | Ga0068866_100037353 | 85 |
| 69 | 3300005719 | Ga0068861_100201866 | Ga0068861_1002018663 | 85 |
| 70 | 3300005834 | Ga0068851_10054065 | Ga0068851_100540651 | 85 |
| 71 | 3300005841 | Ga0068863_100009662 | Ga0068863_1000096627 | 85 |
| 72 | 3300005841 | Ga0068863_101953531 | Ga0068863_1019535312 | 85 |
| 73 | 3300005842 | Ga0068858_100005858 | Ga0068858_10000585811 | 85 |
| 74 | 3300005843 | Ga0068860_100322453 | Ga0068860_1003224531 | 85 |
| 75 | 3300005843 | Ga0068860_100885954 | Ga0068860_1008859542 | 85 |
| 76 | 3300005937 | Ga0081455_10012453 | Ga0081455_1001245310 | 85 |
| 77 | 3300006028 | Ga0070717_11271764 | Ga0070717_112717642 | 85 |
| 78 | 3300006163 | Ga0070715_10008490 | Ga0070715_100084901 | 85 |
| 79 | 3300006173 | Ga0070716_100100308 | Ga0070716_1001003082 | 85 |
| 80 | 3300006175 | Ga0070712_100004526 | Ga0070712_1000045267 | 85 |
| 81 | 3300006178 | Ga0075367_10159581 | Ga0075367_101595812 | 85 |
| 82 | 3300006237 | Ga0097621_100160323 | Ga0097621_1001603232 | 85 |
| 83 | 3300006237 | Ga0097621_100175330 | Ga0097621_1001753302 | 85 |
| 84 | 3300006358 | Ga0068871_100204649 | Ga0068871_1002046492 | 85 |
| 85 | 3300006852 | Ga0075433_10856731 | Ga0075433_108567312 | 85 |
| 86 | 3300006871 | Ga0075434_100056706 | Ga0075434_1000567064 | 85 |
| 87 | 3300006871 | Ga0075434_101805039 | Ga0075434_1018050391 | 85 |
| 88 | 3300006914 | Ga0075436_100298027 | Ga0075436_1002980272 | 85 |
| 89 | 3300006914 | Ga0075436_101500754 | Ga0075436_1015007542 | 85 |
| 90 | 3300006931 | Ga0097620_100000740 | Ga0097620_10000074017 | 85 |
| 91 | 3300007076 | Ga0075435_100308459 | Ga0075435_1003084591 | 85 |
| 92 | 3300007076 | Ga0075435_100316333 | Ga0075435_1003163332 | 85 |
| 93 | 3300007076 | Ga0075435_100418971 | Ga0075435_1004189712 | 85 |
| 94 | 3300009098 | Ga0105245_10011848 | Ga0105245_100118486 | 85 |
| 95 | 3300009098 | Ga0105245_10219881 | Ga0105245_102198812 | 85 |
| 96 | 3300009098 | Ga0105245_10219883 | Ga0105245_102198832 | 85 |
| 97 | 3300009098 | Ga0105245_10842897 | Ga0105245_108428972 | 85 |
| 98 | 3300009098 | Ga0105245_11702011 | Ga0105245_117020111 | 85 |
| 99 | 3300009148 | Ga0105243_10123618 | Ga0105243_101236182 | 85 |
| 100 | 3300009148 | Ga0105243_10226206 | Ga0105243_102262062 | 85 |
| 101 | 3300009148 | Ga0105243_10716163 | Ga0105243_107161632 | 85 |
| 102 | 3300009174 | Ga0105241_10132806 | Ga0105241_101328062 | 85 |
| 103 | 3300009174 | Ga0105241_10415148 | Ga0105241_104151482 | 85 |
| 104 | 3300009174 | Ga0105241_10863236 | Ga0105241_108632362 | 85 |
| 105 | 3300009176 | Ga0105242_10018207 | Ga0105242_100182075 | 85 |
| 106 | 3300009176 | Ga0105242_10031898 | Ga0105242_100318984 | 85 |
| 107 | 3300009176 | Ga0105242_10211778 | Ga0105242_102117782 | 85 |
| 108 | 3300009176 | Ga0105242_10640531 | Ga0105242_106405312 | 85 |
| 109 | 3300009177 | Ga0105248_10037006 | Ga0105248_100370067 | 85 |
| 110 | 3300009177 | Ga0105248_10368337 | Ga0105248_103683372 | 85 |
| 111 | 3300009545 | Ga0105237_11092702 | Ga0105237_110927021 | 85 |
| 112 | 3300009551 | Ga0105238_10449513 | Ga0105238_104495131 | 85 |
| 113 | 3300009553 | Ga0105249_10296823 | Ga0105249_102968232 | 85 |
| 114 | 3300009553 | Ga0105249_12111934 | Ga0105249_121119342 | 85 |
| 115 | 3300009553 | Ga0105249_13259583 | Ga0105249_132595832 | 85 |
| 116 | 3300010375 | Ga0105239_10436126 | Ga0105239_104361262 | 85 |
| 117 | 3300010375 | Ga0105239_10676383 | Ga0105239_106763833 | 85 |
| 118 | 3300010375 | Ga0105239_11589775 | Ga0105239_115897752 | 85 |
| 119 | 3300011119 | Ga0105246_10369705 | Ga0105246_103697052 | 85 |
| 120 | 3300011119 | Ga0105246_10849500 | Ga0105246_108495002 | 85 |
| 121 | 3300013100 | Ga0157373_10422221 | Ga0157373_104222212 | 85 |
| 122 | 3300013102 | Ga0157371_11157621 | Ga0157371_111576211 | 85 |
| 123 | 3300013105 | Ga0157369_11303820 | Ga0157369_113038201 | 85 |
| 124 | 3300013296 | Ga0157374_10001706 | Ga0157374_1000170614 | 85 |
| 125 | 3300013297 | Ga0157378_10216435 | Ga0157378_102164352 | 85 |
| 126 | 3300013297 | Ga0157378_10375609 | Ga0157378_103756092 | 85 |
| 127 | 3300013297 | Ga0157378_10870956 | Ga0157378_108709562 | 85 |
| 128 | 3300013297 | Ga0157378_12277005 | Ga0157378_122770052 | 85 |
| 129 | 3300013297 | Ga0157378_12670953 | Ga0157378_126709531 | 85 |
| 130 | 3300013306 | Ga0163162_10270128 | Ga0163162_102701282 | 85 |
| 131 | 3300013306 | Ga0163162_10274041 | Ga0163162_102740412 | 85 |
| 132 | 3300013306 | Ga0163162_10695011 | Ga0163162_106950112 | 85 |
| 133 | 3300013307 | Ga0157372_13185201 | Ga0157372_131852012 | 85 |
| 134 | 3300013308 | Ga0157375_10001525 | Ga0157375_100015257 | 85 |
| 135 | 3300013308 | Ga0157375_11491364 | Ga0157375_114913641 | 85 |
| 136 | 3300014325 | Ga0163163_10000748 | Ga0163163_100007487 | 85 |
| 137 | 3300014325 | Ga0163163_11870877 | Ga0163163_118708772 | 85 |
| 138 | 3300014968 | Ga0157379_10022888 | Ga0157379_100228881 | 85 |
| 139 | 3300014969 | Ga0157376_10156348 | Ga0157376_101563482 | 85 |
| 140 | 3300014969 | Ga0157376_10177763 | Ga0157376_101777632 | 85 |
| 141 | 3300014969 | Ga0157376_10178971 | Ga0157376_101789712 | 85 |
| 142 | 3300017792 | Ga0163161_10043650 | Ga0163161_100436503 | 85 |
| 143 | 3300025321 | Ga0207656_10268053 | Ga0207656_102680531 | 85 |
| 144 | 3300025898 | Ga0207692_10005142 | Ga0207692_100051421 | 85 |
| 145 | 3300025903 | Ga0207680_10003729 | Ga0207680_100037299 | 85 |
| 146 | 3300025905 | Ga0207685_10006663 | Ga0207685_100066632 | 85 |
| 147 | 3300025906 | Ga0207699_10092635 | Ga0207699_100926353 | 85 |
| 148 | 3300025908 | Ga0207643_10079373 | Ga0207643_100793733 | 85 |
| 149 | 3300025910 | Ga0207684_10015437 | Ga0207684_100154376 | 85 |
| 150 | 3300025911 | Ga0207654_10227222 | Ga0207654_102272223 | 85 |
| 151 | 3300025911 | Ga0207654_10464937 | Ga0207654_104649372 | 85 |
| 152 | 3300025911 | Ga0207654_10714402 | Ga0207654_107144021 | 85 |
| 153 | 3300025912 | Ga0207707_10330537 | Ga0207707_103305372 | 85 |
| 154 | 3300025915 | Ga0207693_10003184 | Ga0207693_1000318414 | 85 |
| 155 | 3300025916 | Ga0207663_10000577 | Ga0207663_100005777 | 85 |
| 156 | 3300025916 | Ga0207663_10193963 | Ga0207663_101939632 | 85 |
| 157 | 3300025924 | Ga0207694_10935643 | Ga0207694_109356432 | 85 |
| 158 | 3300025925 | Ga0207650_10070874 | Ga0207650_100708743 | 85 |
| 159 | 3300025926 | Ga0207659_10930369 | Ga0207659_109303692 | 85 |
| 160 | 3300025926 | Ga0207659_11164419 | Ga0207659_111644191 | 85 |
| 161 | 3300025927 | Ga0207687_10001115 | Ga0207687_100011153 | 85 |
| 162 | 3300025927 | Ga0207687_10014765 | Ga0207687_100147654 | 85 |
| 163 | 3300025927 | Ga0207687_10512848 | Ga0207687_105128482 | 85 |
| 164 | 3300025928 | Ga0207700_10011158 | Ga0207700_100111587 | 85 |
| 165 | 3300025931 | Ga0207644_10013274 | Ga0207644_100132743 | 85 |
| 166 | 3300025931 | Ga0207644_10242814 | Ga0207644_102428141 | 85 |
| 167 | 3300025933 | Ga0207706_10081463 | Ga0207706_100814634 | 85 |
| 168 | 3300025933 | Ga0207706_10682929 | Ga0207706_106829292 | 85 |
| 169 | 3300025933 | Ga0207706_11296588 | Ga0207706_112965882 | 85 |
| 170 | 3300025934 | Ga0207686_10001673 | Ga0207686_100016736 | 85 |
| 171 | 3300025934 | Ga0207686_10033406 | Ga0207686_100334062 | 85 |
| 172 | 3300025934 | Ga0207686_10057839 | Ga0207686_100578393 | 85 |
| 173 | 3300025934 | Ga0207686_10320410 | Ga0207686_103204102 | 85 |
| 174 | 3300025935 | Ga0207709_10425058 | Ga0207709_104250582 | 85 |
| 175 | 3300025935 | Ga0207709_11197466 | Ga0207709_111974662 | 85 |
| 176 | 3300025936 | Ga0207670_10016203 | Ga0207670_100162032 | 85 |
| 177 | 3300025937 | Ga0207669_10091106 | Ga0207669_100911062 | 85 |
| 178 | 3300025937 | Ga0207669_10704372 | Ga0207669_107043721 | 85 |
| 179 | 3300025939 | Ga0207665_10010146 | Ga0207665_100101467 | 85 |
| 180 | 3300025940 | Ga0207691_10018523 | Ga0207691_100185237 | 85 |
| 181 | 3300025940 | Ga0207691_10365567 | Ga0207691_103655672 | 85 |
| 182 | 3300025941 | Ga0207711_10000495 | Ga0207711_1000049532 | 85 |
| 183 | 3300025941 | Ga0207711_10373381 | Ga0207711_103733812 | 85 |
| 184 | 3300025942 | Ga0207689_10449830 | Ga0207689_104498302 | 85 |
| 185 | 3300025942 | Ga0207689_10468421 | Ga0207689_104684212 | 85 |
| 186 | 3300025945 | Ga0207679_10093111 | Ga0207679_100931113 | 85 |
| 187 | 3300025960 | Ga0207651_10000412 | Ga0207651_100004127 | 85 |
| 188 | 3300025961 | Ga0207712_11643977 | Ga0207712_116439772 | 85 |
| 189 | 3300025986 | Ga0207658_10022073 | Ga0207658_100220733 | 85 |
| 190 | 3300025986 | Ga0207658_10570258 | Ga0207658_105702582 | 85 |
| 191 | 3300025986 | Ga0207658_12187088 | Ga0207658_121870881 | 85 |
| 192 | 3300026023 | Ga0207677_10000254 | Ga0207677_1000025422 | 85 |
| 193 | 3300026023 | Ga0207677_11081186 | Ga0207677_110811862 | 85 |
| 194 | 3300026035 | Ga0207703_10000640 | Ga0207703_1000064020 | 85 |
| 195 | 3300026067 | Ga0207678_10605725 | Ga0207678_106057252 | 85 |
| 196 | 3300026078 | Ga0207702_10340923 | Ga0207702_103409232 | 85 |
| 197 | 3300026088 | Ga0207641_10001482 | Ga0207641_1000148224 | 85 |
| 198 | 3300026089 | Ga0207648_10019985 | Ga0207648_100199856 | 85 |
| 199 | 3300026095 | Ga0207676_10000481 | Ga0207676_1000048127 | 85 |
| 200 | 3300026095 | Ga0207676_12498385 | Ga0207676_124983852 | 85 |
| 201 | 3300026118 | Ga0207675_100642932 | Ga0207675_1006429321 | 85 |
| 202 | 3300026118 | Ga0207675_100943984 | Ga0207675_1009439842 | 85 |
| 203 | 3300026121 | Ga0207683_10057110 | Ga0207683_100571102 | 85 |
| 204 | 3300026142 | Ga0207698_10286644 | Ga0207698_102866441 | 85 |
| 205 | 3300026142 | Ga0207698_12755522 | Ga0207698_127555221 | 85 |
| 206 | 3300028379 | Ga0268266_10030201 | Ga0268266_100302013 | 85 |
| 207 | 3300028381 | Ga0268264_10001658 | Ga0268264_1000165811 | 85 |
| 208 | 3300028381 | Ga0268264_10295691 | Ga0268264_102956912 | 85 |
| 209 | 3300028381 | Ga0268264_10784650 | Ga0268264_107846502 | 85 |
| 210 | 3300035083 | Ga0373926_0082457 | Ga0373926_0082457_368_628 | 85 |
| 211 | 3300035083 | Ga0373926_0087500 | Ga0373926_0087500_234_494 | 85 |
| 212 | 3300035084 | Ga0373928_0110823 | Ga0373928_0110823_139_399 | 85 |
| 213 | 3300035086 | Ga0373934_0001393 | Ga0373934_0001393_6431_6691 | 85 |
| 214 | 3300035111 | Ga0373923_0000210 | Ga0373923_0000210_5129_5389 | 85 |
| 215 | 3300035113 | Ga0373936_0058841 | Ga0373936_0058841_1079_1339 | 85 |
| 216 | 3300035113 | Ga0373936_0095399 | Ga0373936_0095399_547_807 | 85 |
| 217 | 3300035116 | Ga0373945_0008878 | Ga0373945_0008878_2973_3233 | 85 |
| 218 | 3300035116 | Ga0373945_0059727 | Ga0373945_0059727_378_638 | 85 |
| 219 | 3300035117 | Ga0373953_0002347 | Ga0373953_0002347_4303_4563 | 85 |
| 220 | 3300035118 | Ga0373954_0002454 | Ga0373954_0002454_4223_4483 | 85 |
| 221 | 3300035119 | Ga0373956_0000920 | Ga0373956_0000920_5288_5548 | 85 |
| 222 | 3300035120 | Ga0373957_0016546 | Ga0373957_0016546_1436_1696 | 85 |
| 223 | 3300035170 | Ga0373943_0011339 | Ga0373943_0011339_3532_3792 | 85 |
| 224 | 3300035170 | Ga0373943_0052707 | Ga0373943_0052707_800_1060 | 85 |
| 225 | 3300035170 | Ga0373943_0102812 | Ga0373943_0102812_726_986 | 85 |
| 226 | 3300035170 | Ga0373943_0363563 | Ga0373943_0363563_367_627 | 85 |
| 227 | 3300035171 | Ga0373946_0142663 | Ga0373946_0142663_139_399 | 85 |
| 228 | 3300035171 | Ga0373946_0172238 | Ga0373946_0172238_155_415 | 85 |
| 229 | 3300035171 | Ga0373946_0176720 | Ga0373946_0176720_318_578 | 85 |
| 230 | 3300035172 | Ga0373955_0001397 | Ga0373955_0001397_4616_4876 | 85 |
| 231 | 3300035410 | Ga0373924_0042119 | Ga0373924_0042119_928_1188 | 85 |
| 232 | 3300035691 | Ga0373931_0146510 | Ga0373931_0146510_895_1155 | 85 |
| 233 | 3300035692 | Ga0373935_0047165 | Ga0373935_0047165_2051_2311 | 85 |
| 234 | 3300035692 | Ga0373935_0149787 | Ga0373935_0149787_1183_1443 | 85 |
| 235 | 3300035692 | Ga0373935_0892106 | Ga0373935_0892106_141_401 | 85 |
| 236 | 3300035695 | Ga0373927_0049957 | Ga0373927_0049957_104_364 | 85 |
| 237 | 3300035695 | Ga0373927_0058660 | Ga0373927_0058660_1437_1697 | 85 |
| 238 | 3300035724 | Ga0373933_0051983 | Ga0373933_0051983_2053_2313 | 85 |
| 239 | 3300035724 | Ga0373933_0057006 | Ga0373933_0057006_574_834 | 85 |
| 240 | 3300035724 | Ga0373933_1069745 | Ga0373933_1069745_216_476 | 85 |
| 241 | 3300035725 | Ga0373947_0008022 | Ga0373947_0008022_4722_4982 | 85 |
| 242 | 3300035725 | Ga0373947_0026644 | Ga0373947_0026644_1612_1872 | 85 |
| 243 | 3300035725 | Ga0373947_0338964 | Ga0373947_0338964_622_882 | 85 |
| 244 | 3300036401 | Ga0373937_0006300 | Ga0373937_0006300_3725_3985 | 85 |
| 245 | 3300036401 | Ga0373937_0020390 | Ga0373937_0020390_4262_4522 | 85 |
| 246 | 3300036401 | Ga0373937_0786376 | Ga0373937_0786376_508_768 | 85 |
| 247 | 3300037068 | Ga0373925_0013479 | Ga0373925_0013479_3329_3589 | 85 |
| 248 | 3300037068 | Ga0373925_0413387 | Ga0373925_0413387_244_504 | 85 |
| 249 | 3300037068 | Ga0373925_0485605 | Ga0373925_0485605_154_414 | 85 |
| 250 | 3300037068 | Ga0373925_0525142 | Ga0373925_0525142_225_485 | 85 |
| 251 | 3300041443 | Ga0451789_0308947 | Ga0451789_0308947_282_542 | 85 |
| 252 | 3300041460 | Ga0451802_0959190 | Ga0451802_0959190_359_619 | 85 |
| 253 | 3300041486 | Ga0451807_0192404 | Ga0451807_0192404_733_993 | 85 |
| 254 | 3300041496 | Ga0451839_0292333 | Ga0451839_0292333_529_789 | 85 |
| 255 | 3300041501 | Ga0451845_0926531 | Ga0451845_0926531_259_519 | 85 |
| 256 | 3300041512 | Ga0451853_1607039 | Ga0451853_1607039_310_576 | 85 |
| 257 | 3300041512 | Ga0451853_3736650 | Ga0451853_3736650_1628_1888 | 85 |
| 258 | 3300046455 | Ga0495603_0501779 | Ga0495603_0501779_24_284 | 85 |
| 259 | 3300046455 | Ga0495603_0516385 | Ga0495603_0516385_39_299 | 85 |
| 260 | 3300046459 | Ga0495629_0743771 | Ga0495629_0743771_310_570 | 85 |
| 261 | 3300046461 | Ga0495641_0554179 | Ga0495641_0554179_173_433 | 85 |
| 262 | 3300046463 | Ga0495653_0151317 | Ga0495653_0151317_1152_1412 | 85 |
| 263 | 3300046463 | Ga0495653_0915140 | Ga0495653_0915140_91_351 | 85 |
| 264 | 3300046472 | Ga0495580_0009062 | Ga0495580_0009062_4876_5136 | 85 |
| 265 | 3300046472 | Ga0495580_0313645 | Ga0495580_0313645_401_661 | 85 |
| 266 | 3300046473 | Ga0495582_0016415 | Ga0495582_0016415_2515_2775 | 85 |
| 267 | 3300046475 | Ga0495639_0162430 | Ga0495639_0162430_342_602 | 85 |
| 268 | 3300046476 | Ga0495662_0026964 | Ga0495662_0026964_2485_2745 | 85 |
| 269 | 3300046476 | Ga0495662_0052425 | Ga0495662_0052425_832_1098 | 85 |
| 270 | 3300046477 | Ga0495664_0214451 | Ga0495664_0214451_91_351 | 85 |
| 271 | 3300046491 | Ga0495584_0447398 | Ga0495584_0447398_229_489 | 85 |
| 272 | 3300046499 | Ga0495594_0130684 | Ga0495594_0130684_989_1249 | 85 |
| 273 | 3300046511 | Ga0495608_0181078 | Ga0495608_0181078_582_842 | 85 |
| 274 | 3300046514 | Ga0495618_0174696 | Ga0495618_0174696_177_443 | 85 |
| 275 | 3300046516 | Ga0495628_0331300 | Ga0495628_0331300_93_353 | 85 |
| 276 | 3300046517 | Ga0495630_0058441 | Ga0495630_0058441_2073_2339 | 85 |
| 277 | 3300046517 | Ga0495630_0069934 | Ga0495630_0069934_763_1023 | 85 |
| 278 | 3300046517 | Ga0495630_0096911 | Ga0495630_0096911_262_522 | 85 |
| 279 | 3300046525 | Ga0495663_0243332 | Ga0495663_0243332_86_346 | 85 |
| 280 | 3300046526 | Ga0495666_0046885 | Ga0495666_0046885_185_445 | 85 |
| 281 | 3300046526 | Ga0495666_0078305 | Ga0495666_0078305_764_1024 | 85 |
| 282 | 3300046526 | Ga0495666_0111746 | Ga0495666_0111746_53_319 | 85 |
| 283 | 3300046529 | Ga0495652_0249852 | Ga0495652_0249852_674_934 | 85 |
| 284 | 3300046531 | Ga0495665_0055603 | Ga0495665_0055603_1371_1631 | 85 |
| 285 | 3300046533 | Ga0495640_0199395 | Ga0495640_0199395_586_846 | 85 |
| 286 | 3300046533 | Ga0495640_0746924 | Ga0495640_0746924_23_289 | 85 |
| 287 | 3300046535 | Ga0495586_0174591 | Ga0495586_0174591_152_418 | 85 |
| 288 | 3300046539 | Ga0495621_0004073 | Ga0495621_0004073_2247_2507 | 85 |
| 289 | 3300046543 | Ga0495645_0126038 | Ga0495645_0126038_1488_1748 | 85 |
| 290 | 3300046543 | Ga0495645_0471200 | Ga0495645_0471200_139_399 | 85 |
| 291 | 3300046559 | Ga0495667_0112656 | Ga0495667_0112656_608_868 | 85 |
| 292 | 3300046642 | Ga0495634_0006196 | Ga0495634_0006196_8772_9038 | 85 |
| 293 | 3300046642 | Ga0495634_0276294 | Ga0495634_0276294_713_973 | 85 |
| 294 | 3300046663 | Ga0495635_0013358 | Ga0495635_0013358_5328_5588 | 85 |
| 295 | 3300046663 | Ga0495635_0168269 | Ga0495635_0168269_145_405 | 85 |
| 296 | 3300046664 | Ga0495659_0025567 | Ga0495659_0025567_154_414 | 85 |
| 297 | 3300046674 | Ga0495588_0041659 | Ga0495588_0041659_137_397 | 85 |
| 298 | 3300046675 | Ga0495657_0489922 | Ga0495657_0489922_26_286 | 85 |
| 299 | 3300046678 | Ga0495599_0268763 | Ga0495599_0268763_141_401 | 85 |
| 300 | 3300046679 | Ga0495623_0008420 | Ga0495623_0008420_357_617 | 85 |
| 301 | 3300046680 | Ga0495646_0592170 | Ga0495646_0592170_97_357 | 85 |
| 302 | 3300046681 | Ga0495647_0002734 | Ga0495647_0002734_2644_2904 | 85 |
| 303 | 3300046681 | Ga0495647_0308056 | Ga0495647_0308056_140_400 | 85 |
| 304 | 3300046681 | Ga0495647_0389427 | Ga0495647_0389427_262_522 | 85 |
| 305 | 3300046683 | Ga0495658_0012093 | Ga0495658_0012093_2441_2701 | 85 |
| 306 | 3300046689 | Ga0495613_0004932 | Ga0495613_0004932_4271_4531 | 85 |
| 307 | 3300046689 | Ga0495613_0009140 | Ga0495613_0009140_5571_5837 | 85 |
| 308 | 3300046690 | Ga0495624_0283143 | Ga0495624_0283143_541_801 | 85 |
| 309 | 3300047315 | Ga0495581_0000879 | Ga0495581_0000879_10731_10991 | 85 |
| 310 | 3300047315 | Ga0495581_0569471 | Ga0495581_0569471_190_456 | 85 |
| 311 | 3300047317 | Ga0495604_0102756 | Ga0495604_0102756_1014_1274 | 85 |
| 312 | 3300047319 | Ga0495674_0329633 | Ga0495674_0329633_140_400 | 85 |
| 313 | 3300047319 | Ga0495674_0906711 | Ga0495674_0906711_292_552 | 85 |
| 314 | 3300047321 | Ga0495676_0563556 | Ga0495676_0563556_14_280 | 85 |
| 315 | 3300047321 | Ga0495676_1085712 | Ga0495676_1085712_191_451 | 85 |
| 316 | 3300047322 | Ga0495680_0018982 | Ga0495680_0018982_858_1118 | 85 |
| 317 | 3300047322 | Ga0495680_0721395 | Ga0495680_0721395_209_469 | 85 |
| 318 | 3300047444 | Ga0495675_0246810 | Ga0495675_0246810_376_636 | 85 |
| 319 | 3300047471 | Ga0495684_0009051 | Ga0495684_0009051_3829_4089 | 85 |
| 320 | 3300047471 | Ga0495684_0370270 | Ga0495684_0370270_325_585 | 85 |
| 321 | 3300047673 | Ga0495593_0172782 | Ga0495593_0172782_32_292 | 85 |
| 322 | 3300048089 | Ga0495614_0054877 | Ga0495614_0054877_1425_1685 | 85 |
| 323 | 3300048903 | Ga0496100_0101876 | Ga0496100_0101876_1548_1808 | 85 |
| 324 | 3300048904 | Ga0496101_1155165 | Ga0496101_1155165_175_435 | 85 |
| 325 | 3300048907 | Ga0496104_0003090 | Ga0496104_0003090_11593_11853 | 85 |
| 326 | 3300048908 | Ga0496105_0008052 | Ga0496105_0008052_4146_4406 | 85 |
| 327 | 3300048908 | Ga0496105_0602059 | Ga0496105_0602059_376_636 | 85 |
| 328 | 3300048910 | Ga0496107_0029893 | Ga0496107_0029893_583_843 | 85 |
| 329 | 3300048911 | Ga0496108_0015347 | Ga0496108_0015347_1725_1985 | 85 |
| 330 | 3300048911 | Ga0496108_0016049 | Ga0496108_0016049_2690_2950 | 85 |
| 331 | 3300048912 | Ga0496109_0014974 | Ga0496109_0014974_6037_6297 | 85 |
| 332 | 3300048912 | Ga0496109_0031869 | Ga0496109_0031869_2111_2371 | 85 |
| 333 | 3300048913 | Ga0496110_0073594 | Ga0496110_0073594_202_462 | 85 |
| 334 | 3300048913 | Ga0496110_0363128 | Ga0496110_0363128_750_1010 | 85 |
| 335 | 3300048914 | Ga0496111_0076466 | Ga0496111_0076466_1874_2134 | 85 |
| 336 | 3300048915 | Ga0496112_0005494 | Ga0496112_0005494_2676_2936 | 85 |
| 337 | 3300048915 | Ga0496112_0019235 | Ga0496112_0019235_456_716 | 85 |
| 338 | 3300048915 | Ga0496112_1452597 | Ga0496112_1452597_214_474 | 85 |
| 339 | 3300048916 | Ga0496113_0401120 | Ga0496113_0401120_289_549 | 85 |
| 340 | 3300048917 | Ga0496114_0013724 | Ga0496114_0013724_2373_2633 | 85 |
| 341 | 3300048917 | Ga0496114_0407185 | Ga0496114_0407185_705_965 | 85 |
| 342 | 3300048918 | Ga0496115_0373431 | Ga0496115_0373431_659_919 | 85 |
| 343 | 3300049568 | Ga0501031_0050411 | Ga0501031_0050411_314_574 | 85 |
| 344 | 3300049570 | Ga0501033_0014998 | Ga0501033_0014998_3896_4156 | 85 |
| 345 | 3300049571 | Ga0501034_1060006 | Ga0501034_1060006_24_284 | 85 |
| 346 | 3300049572 | Ga0501036_0085493 | Ga0501036_0085493_659_919 | 85 |
| 347 | 3300049574 | Ga0501038_0031685 | Ga0501038_0031685_1245_1505 | 85 |
| 348 | 3300049575 | Ga0501039_0480789 | Ga0501039_0480789_679_939 | 85 |
| 349 | 3300049576 | Ga0501040_0079685 | Ga0501040_0079685_1293_1553 | 85 |
| 350 | 3300049577 | Ga0501041_0002085 | Ga0501041_0002085_521_781 | 85 |
| 351 | 3300049578 | Ga0501042_0004777 | Ga0501042_0004777_931_1191 | 85 |
| 352 | 3300049580 | Ga0501046_0024882 | Ga0501046_0024882_1019_1279 | 85 |
| 353 | 3300049584 | Ga0501068_0007079 | Ga0501068_0007079_609_869 | 85 |
| 354 | 3300049586 | Ga0501070_0348556 | Ga0501070_0348556_847_1107 | 85 |
| 355 | 3300049587 | Ga0501071_0028308 | Ga0501071_0028308_1423_1683 | 85 |
| 356 | 3300049587 | Ga0501071_1482828 | Ga0501071_1482828_14_274 | 85 |
| 357 | 3300049588 | Ga0501072_0206376 | Ga0501072_0206376_901_1161 | 85 |
| 358 | 3300049588 | Ga0501072_1519070 | Ga0501072_1519070_31_291 | 85 |
| 359 | 3300049589 | Ga0501073_0437155 | Ga0501073_0437155_465_725 | 85 |
| 360 | 3300049590 | Ga0501074_0752737 | Ga0501074_0752737_379_639 | 85 |
| 361 | 3300049591 | Ga0501075_0030036 | Ga0501075_0030036_610_870 | 85 |
| 362 | 3300049592 | Ga0501076_0135072 | Ga0501076_0135072_568_828 | 85 |
| 363 | 3300049593 | Ga0501077_0004246 | Ga0501077_0004246_458_718 | 85 |
| 364 | 3300049741 | Ga0501079_0004267 | Ga0501079_0004267_1324_1584 | 85 |
| 365 | 3300049743 | Ga0501081_0031968 | Ga0501081_0031968_2039_2299 | 85 |
| 366 | 3300049822 | Ga0501035_0149732 | Ga0501035_0149732_518_778 | 85 |
| 367 | 3300049824 | Ga0501045_0045517 | Ga0501045_0045517_916_1176 | 85 |
| 368 | 3300050494 | nmdc:mga06z11_233389_c1 | nmdc:mga06z11_233389_c1_460_720 | 85 |
| 369 | 3300050512 | nmdc:mga0n895_634780_c1 | nmdc:mga0n895_634780_c1_753_1013 | 85 |
| 370 | 3300050512 | nmdc:mga0n895_77090_c1 | nmdc:mga0n895_77090_c1_29_289 | 85 |
| 371 | 3300050513 | nmdc:mga0rr50_284254_c1 | nmdc:mga0rr50_284254_c1_101_361 | 85 |
| 372 | 3300050513 | nmdc:mga0rr50_413698_c1 | nmdc:mga0rr50_413698_c1_790_1050 | 85 |
| 373 | 3300050513 | nmdc:mga0rr50_804432_c1 | nmdc:mga0rr50_804432_c1_364_624 | 85 |
| 374 | 3300050514 | nmdc:mga08x19_238877_c1 | nmdc:mga08x19_238877_c1_161_421 | 85 |
| 375 | 3300053077 | Ga0495601_0123483 | Ga0495601_0123483_1260_1520 | 85 |
| 376 | 3300053078 | Ga0495612_0019390 | Ga0495612_0019390_2231_2491 | 85 |
| 377 | 3300053078 | Ga0495612_0085565 | Ga0495612_0085565_26_286 | 85 |
| 378 | 3300053085 | Ga0495619_0004675 | Ga0495619_0004675_3143_3403 | 85 |
| 379 | 3300053085 | Ga0495619_0122294 | Ga0495619_0122294_643_903 | 85 |
| 380 | 3300053094 | Ga0500566_0176463 | Ga0500566_0176463_818_1084 | 85 |
| 381 | 3300054114 | Ga0501084_1051638 | Ga0501084_1051638_322_582 | 85 |
| 382 | 3300060353 | Ga0501082_0015246 | Ga0501082_0015246_1900_2160 | 85 |
| 383 | 3300061734 | Ga0530510_0047448 | Ga0530510_0047448_2242_2502 | 85 |
| 384 | 3300005336 | Ga0070680_100219841 | Ga0070680_1002198412 | 86 |
| 385 | 3300005336 | Ga0070680_101035800 | Ga0070680_1010358001 | 86 |
| 386 | 3300005336 | Ga0070680_101525829 | Ga0070680_1015258292 | 86 |
| 387 | 3300005458 | Ga0070681_10040567 | Ga0070681_100405673 | 86 |
| 388 | 3300005530 | Ga0070679_100492662 | Ga0070679_1004926621 | 86 |
| 389 | 3300005539 | Ga0068853_100846628 | Ga0068853_1008466282 | 86 |
| 390 | 3300005539 | Ga0068853_102225262 | Ga0068853_1022252622 | 86 |
| 391 | 3300005548 | Ga0070665_100108181 | Ga0070665_1001081813 | 86 |
| 392 | 3300005548 | Ga0070665_101852402 | Ga0070665_1018524022 | 86 |
| 393 | 3300005563 | Ga0068855_100011712 | Ga0068855_1000117125 | 86 |
| 394 | 3300005563 | Ga0068855_100311371 | Ga0068855_1003113713 | 86 |
| 395 | 3300006353 | Ga0075370_10333530 | Ga0075370_103335302 | 86 |
| 396 | 3300006881 | Ga0068865_100052968 | Ga0068865_1000529683 | 86 |
| 397 | 3300009093 | Ga0105240_10068859 | Ga0105240_100688592 | 86 |
| 398 | 3300009093 | Ga0105240_11580880 | Ga0105240_115808802 | 86 |
| 399 | 3300013104 | Ga0157370_10892880 | Ga0157370_108928802 | 86 |
| 400 | 3300013104 | Ga0157370_11060560 | Ga0157370_110605602 | 86 |
| 401 | 3300013307 | Ga0157372_10272235 | Ga0157372_102722352 | 86 |
| 402 | 3300025261 | Ga0209233_1000982 | Ga0209233_10009824 | 86 |
| 403 | 3300025903 | Ga0207680_10698613 | Ga0207680_106986131 | 86 |
| 404 | 3300025909 | Ga0207705_10280530 | Ga0207705_102805302 | 86 |
| 405 | 3300025913 | Ga0207695_10028065 | Ga0207695_100280655 | 86 |
| 406 | 3300025917 | Ga0207660_10009355 | Ga0207660_100093554 | 86 |
| 407 | 3300025917 | Ga0207660_11637369 | Ga0207660_116373691 | 86 |
| 408 | 3300025938 | Ga0207704_10101851 | Ga0207704_101018512 | 86 |
| 409 | 3300025949 | Ga0207667_10261359 | Ga0207667_102613591 | 86 |
| 410 | 3300025949 | Ga0207667_10377571 | Ga0207667_103775712 | 86 |
| 411 | 3300025981 | Ga0207640_10244693 | Ga0207640_102446932 | 86 |
| 412 | 3300026041 | Ga0207639_10696449 | Ga0207639_106964492 | 86 |
| 413 | 3300028379 | Ga0268266_10079518 | Ga0268266_100795183 | 86 |
| 414 | 3300028379 | Ga0268266_11410160 | Ga0268266_114101601 | 86 |
| 415 | 3300028800 | Ga0265338_10620265 | Ga0265338_106202652 | 86 |
| 416 | 3300037312 | Ga0395899_0329570 | Ga0395899_0329570_695_958 | 86 |
| 417 | 3300037418 | Ga0395900_0015810 | Ga0395900_0015810_7299_7562 | 86 |
| 418 | 3300037466 | Ga0395898_1644118 | Ga0395898_1644118_241_504 | 86 |
| 419 | 3300037471 | Ga0395905_0046098 | Ga0395905_0046098_2675_2938 | 86 |
| 420 | 3300037471 | Ga0395905_0089718 | Ga0395905_0089718_1132_1395 | 86 |
| 421 | 3300037471 | Ga0395905_0105647 | Ga0395905_0105647_892_1155 | 86 |
| 422 | 3300037471 | Ga0395905_0194838 | Ga0395905_0194838_1505_1768 | 86 |
| 423 | 3300037471 | Ga0395905_0840130 | Ga0395905_0840130_94_357 | 86 |
| 424 | 3300037471 | Ga0395905_1800288 | Ga0395905_1800288_10_273 | 86 |
| 425 | 3300050516 | nmdc:mga0sz30_454479_c1 | nmdc:mga0sz30_454479_c1_114_377 | 86 |
| 426 | 3300005467 | Ga0070706_101006648 | Ga0070706_1010066482 | 87 |
| 427 | 3300006173 | Ga0070716_100206575 | Ga0070716_1002065752 | 87 |
| 428 | 3300007788 | Ga0099795_10010136 | Ga0099795_100101363 | 87 |
| 429 | 3300010159 | Ga0099796_10004216 | Ga0099796_100042165 | 87 |
| 430 | 3300021377 | Ga0213874_10188094 | Ga0213874_101880942 | 87 |
| 431 | 3300021441 | Ga0213871_10053114 | Ga0213871_100531142 | 87 |
| 432 | 3300025910 | Ga0207684_10805790 | Ga0207684_108057902 | 87 |
| 433 | 3300025939 | Ga0207665_10320237 | Ga0207665_103202372 | 87 |
| 434 | 3300039438 | Ga0436360_0059423 | Ga0436360_0059423_57_320 | 87 |
| 435 | 3300039438 | Ga0436360_0743645 | Ga0436360_0743645_1314_1580 | 87 |
| 436 | 3300039447 | Ga0436361_1196724 | Ga0436361_1196724_61_327 | 87 |
| 437 | 3300039450 | Ga0436363_1119547 | Ga0436363_1119547_4579_4845 | 87 |
| 438 | 3300039453 | Ga0436362_1045778 | Ga0436362_1045778_848_1114 | 87 |
| 439 | 3300039453 | Ga0436362_1242066 | Ga0436362_1242066_59_322 | 87 |
| 440 | 3300044712 | Ga0453684_0042938 | Ga0453684_0042938_2426_2692 | 87 |
| 441 | 3300005329 | Ga0070683_100131565 | Ga0070683_1001315653 | 88 |
| 442 | 3300005331 | Ga0070670_100544817 | Ga0070670_1005448172 | 88 |
| 443 | 3300005338 | Ga0068868_101163032 | Ga0068868_1011630322 | 88 |
| 444 | 3300005339 | Ga0070660_100030160 | Ga0070660_1000301602 | 88 |
| 445 | 3300005339 | Ga0070660_100528736 | Ga0070660_1005287362 | 88 |
| 446 | 3300005344 | Ga0070661_100844017 | Ga0070661_1008440172 | 88 |
| 447 | 3300005354 | Ga0070675_100069340 | Ga0070675_1000693401 | 88 |
| 448 | 3300005366 | Ga0070659_101149173 | Ga0070659_1011491731 | 88 |
| 449 | 3300005367 | Ga0070667_100293427 | Ga0070667_1002934272 | 88 |
| 450 | 3300005455 | Ga0070663_101303313 | Ga0070663_1013033131 | 88 |
| 451 | 3300005457 | Ga0070662_100174522 | Ga0070662_1001745222 | 88 |
| 452 | 3300005539 | Ga0068853_100587707 | Ga0068853_1005877072 | 88 |
| 453 | 3300005564 | Ga0070664_100129014 | Ga0070664_1001290142 | 88 |
| 454 | 3300005616 | Ga0068852_101346602 | Ga0068852_1013466022 | 88 |
| 455 | 3300005834 | Ga0068851_10378607 | Ga0068851_103786072 | 88 |
| 456 | 3300009177 | Ga0105248_11846167 | Ga0105248_118461672 | 88 |
| 457 | 3300013105 | Ga0157369_10503917 | Ga0157369_105039173 | 88 |
| 458 | 3300025909 | Ga0207705_10214232 | Ga0207705_102142323 | 88 |
| 459 | 3300025925 | Ga0207650_10701094 | Ga0207650_107010942 | 88 |
| 460 | 3300025931 | Ga0207644_11745097 | Ga0207644_117450971 | 88 |
| 461 | 3300025933 | Ga0207706_10265452 | Ga0207706_102654522 | 88 |
| 462 | 3300025940 | Ga0207691_10111054 | Ga0207691_101110542 | 88 |
| 463 | 3300025944 | Ga0207661_10104077 | Ga0207661_101040772 | 88 |
| 464 | 3300025945 | Ga0207679_10229208 | Ga0207679_102292082 | 88 |
| 465 | 3300025981 | Ga0207640_10454767 | Ga0207640_104547672 | 88 |
| 466 | 3300025986 | Ga0207658_10497122 | Ga0207658_104971222 | 88 |
| 467 | 3300026067 | Ga0207678_10098059 | Ga0207678_100980592 | 88 |
| 468 | 3300026089 | Ga0207648_10571307 | Ga0207648_105713072 | 88 |
| 469 | 3300026121 | Ga0207683_10615711 | Ga0207683_106157112 | 88 |
| 470 | 3300026142 | Ga0207698_12351197 | Ga0207698_123511971 | 88 |
| 471 | 3300031995 | Ga0307409_100793046 | Ga0307409_1007930462 | 88 |
| 472 | 3300032126 | Ga0307415_100224693 | Ga0307415_1002246932 | 88 |
| 473 | 3300035691 | Ga0373931_0307897 | Ga0373931_0307897_400_717 | 88 |
| 474 | 3300048912 | Ga0496109_0399314 | Ga0496109_0399314_165_482 | 88 |
| 475 | 3300003214 | JGI25165J46597_1000036 | JGI25165J46597_1000036257 | 89 |
| 476 | 3300025261 | Ga0209233_1000015 | Ga0209233_10000151034 | 89 |
| 477 | 3300046463 | Ga0495653_0189315 | Ga0495653_0189315_470_748 | 89 |
| 478 | 3300049578 | Ga0501042_0580053 | Ga0501042_0580053_241_558 | 89 |
| 479 | 3300049587 | Ga0501071_0826234 | Ga0501071_0826234_278_595 | 89 |
| 480 | 3300049588 | Ga0501072_1112070 | Ga0501072_1112070_192_509 | 89 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dwm-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis cyso, an antigen | 0.9397 | 5 | 86 |
| 4n6e-assembly1.cif.gz_B-2 | crystal structure of amycolatopsis orientalis bexx/cyso complex | 0.9223 | 5 | 89 |
| 4hro-assembly1.cif.gz_A | crystal structure of h. volcanii small archaeal modifier protein 1 | 0.8483 | 3 | 86 |
| 1v8c-assembly3.cif.gz_B | crystal structure of moad related protein from thermus thermophilus hb8 | 0.8476 | 6 | 84 |
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.8279 | 3 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n6eB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9223 | 5 | 89 | 3.10.20.30 |
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8483 | 3 | 86 | 3.10.20.30 |
| 1v8cB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8476 | 6 | 84 | 3.10.20.30 |
| 2l52A00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8245 | 1 | 89 | 3.10.20.30 |
| 2l52A00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8163 | 1 | 89 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E0UYM1-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.973 | 6 | 89 |
|
| AF-A0A521WBJ4-F1-model_v4 | MoaD/ThiS family protein | 0.9697 | 6 | 89 |
|
| AF-A0A1E4QTN8-F1-model_v4 | deleted | 0.9675 | 6 | 89 |
|
| AF-A0A1Q7B304-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9673 | 5 | 85 |
|
| AF-A0A3N5KSZ2-F1-model_v4 | MoaD/ThiS family protein | 0.9653 | 6 | 89 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar