F452159

General Info

Members Datasets Scaffolds Average Seq Length
480 288 480 88

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100131565|Ga0070683_1001315653
Length 105
Sequence MPAQLSPEAAAVVRVLVPSPLRSYTGSAETDVAVPVLAPELPPTLGGVLAALNSKYPGIRFRIIDEQGQVRRHIKLFVGTTLARDLSAPIPSGHDVMIVAALSGG

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
188 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
191 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 5
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000036 3300003214 Bacteria 286380
2 Ga0065715_10040593 3300005293 Unclassified 1499
3 Ga0070676_10725705 3300005328 Unclassified 727
4 Ga0070683_100131565 3300005329 Bacteria 2368
5 Ga0070690_100013069 3300005330 Bacteria 4899
6 Ga0070670_100035630 3300005331 Bacteria 4283
7 Ga0070670_100544817 3300005331 Bacteria 1035
8 Ga0068869_101325210 3300005334 Unclassified 636
9 Ga0070666_10141667 3300005335 Bacteria 1675
10 Ga0070680_100219841 3300005336 Bacteria 1603
11 Ga0070680_101035800 3300005336 Bacteria 709
12 Ga0070680_101525829 3300005336 Bacteria 579
13 Ga0068868_100143000 3300005338 Bacteria 1965
14 Ga0068868_101163032 3300005338 Unclassified 712
15 Ga0068868_101478115 3300005338 Unclassified 636
16 Ga0070660_100030160 3300005339 Bacteria 4067
17 Ga0070660_100528736 3300005339 Bacteria 983
18 Ga0070689_100006129 3300005340 Bacteria 8285
19 Ga0070661_100844017 3300005344 Unclassified 754
20 Ga0070692_10535817 3300005345 Bacteria 765
21 Ga0070675_100069340 3300005354 Bacteria 2921
22 Ga0070671_100001056 3300005355 Bacteria 20295
23 Ga0070674_100178247 3300005356 Bacteria 1625
24 Ga0070674_100322274 3300005356 Bacteria 1239
25 Ga0070673_100000288 3300005364 Bacteria 26193
26 Ga0070688_100000246 3300005365 Bacteria 28716
27 Ga0070659_101149173 3300005366 Unclassified 685
28 Ga0070659_101750380 3300005366 Bacteria 556
29 Ga0070667_100293427 3300005367 Bacteria 1463
30 Ga0070667_100445767 3300005367 Unclassified 1182
31 Ga0070709_10352404 3300005434 Bacteria 1088
32 Ga0070713_100009493 3300005436 Bacteria 6968
33 Ga0070710_10052426 3300005437 Bacteria 2294
34 Ga0070701_10231570 3300005438 Bacteria 1107
35 Ga0070701_11181850 3300005438 Bacteria 542
36 Ga0070711_100006708 3300005439 Bacteria 6964
37 Ga0070705_100452146 3300005440 Unclassified 964
38 Ga0070694_100751084 3300005444 Bacteria 797
39 Ga0070663_100254862 3300005455 Bacteria 1390
40 Ga0070663_101303313 3300005455 Unclassified 641
41 Ga0070678_100053633 3300005456 Bacteria 2933
42 Ga0070662_100034357 3300005457 Bacteria 3575
43 Ga0070662_100174522 3300005457 Bacteria 1690
44 Ga0070662_101139184 3300005457 Unclassified 670
45 Ga0070681_10040567 3300005458 Bacteria 4663
46 Ga0070681_10384058 3300005458 Bacteria 1315
47 Ga0068867_100232980 3300005459 Bacteria 1489
48 Ga0068867_101864885 3300005459 Bacteria 566
49 Ga0070685_10001919 3300005466 Bacteria 10785
50 Ga0070706_100021407 3300005467 Bacteria 5956
51 Ga0070706_101006648 3300005467 Unclassified 768
52 Ga0070706_101192679 3300005467 Unclassified 699
53 Ga0070707_100021703 3300005468 Bacteria 6068
54 Ga0070707_101009851 3300005468 Unclassified 797
55 Ga0070679_100492662 3300005530 Bacteria 1170
56 Ga0070684_100242561 3300005535 Bacteria 1647
57 Ga0070684_102048648 3300005535 Bacteria 540
58 Ga0068853_100587707 3300005539 Unclassified 1057
59 Ga0068853_100846628 3300005539 Bacteria 877
60 Ga0068853_100967507 3300005539 Bacteria 819
61 Ga0068853_102225262 3300005539 Unclassified 531
62 Ga0070672_100013631 3300005543 Bacteria 5748
63 Ga0070686_100204693 3300005544 Bacteria 1417
64 Ga0070686_100562328 3300005544 Bacteria 894
65 Ga0070696_100160412 3300005546 Bacteria 1656
66 Ga0070696_100855068 3300005546 Bacteria 752
67 Ga0070693_100022360 3300005547 Bacteria 3361
68 Ga0070693_100345282 3300005547 Bacteria 1017
69 Ga0070665_100030951 3300005548 Bacteria 5385
70 Ga0070665_100108181 3300005548 Bacteria 2783
71 Ga0070665_101852402 3300005548 Unclassified 609
72 Ga0070704_100926981 3300005549 Unclassified 785
73 Ga0070704_101434033 3300005549 Unclassified 634
74 Ga0068855_100011712 3300005563 Bacteria 10599
75 Ga0068855_100311371 3300005563 Bacteria 1742
76 Ga0070664_100129014 3300005564 Bacteria 2220
77 Ga0068854_100592397 3300005578 Unclassified 945
78 Ga0068856_100278784 3300005614 Bacteria 1688
79 Ga0070702_100150660 3300005615 Bacteria 1492
80 Ga0068852_100036754 3300005616 Bacteria 4101
81 Ga0068852_101346602 3300005616 Unclassified 736
82 Ga0068859_100000740 3300005617 Bacteria 32876
83 Ga0068864_100000422 3300005618 Bacteria 36527
84 Ga0068866_10003735 3300005718 Bacteria 6244
85 Ga0068861_100201866 3300005719 Bacteria 1669
86 Ga0068851_10054065 3300005834 Bacteria 2045
87 Ga0068851_10378607 3300005834 Unclassified 829
88 Ga0068863_100009662 3300005841 Bacteria 9411
89 Ga0068863_101953531 3300005841 Unclassified 597
90 Ga0068858_100005858 3300005842 Bacteria 12008
91 Ga0068860_100322453 3300005843 Bacteria 1516
92 Ga0068860_100885954 3300005843 Unclassified 908
93 Ga0081455_10012453 3300005937 Bacteria 8487
94 Ga0070717_11271764 3300006028 Unclassified 669
95 Ga0070715_10008490 3300006163 Bacteria 3583
96 Ga0070716_100100308 3300006173 Bacteria 1773
97 Ga0070716_100206575 3300006173 Bacteria 1309
98 Ga0070712_100004526 3300006175 Bacteria 8585
99 Ga0075367_10159581 3300006178 Bacteria 1402
100 Ga0097621_100160323 3300006237 Bacteria 1933
101 Ga0097621_100175330 3300006237 Bacteria 1850
102 Ga0075370_10333530 3300006353 Bacteria 905
103 Ga0068871_100204649 3300006358 Bacteria 1705
104 Ga0075433_10856731 3300006852 Unclassified 793
105 Ga0075434_100056706 3300006871 Bacteria 3894
106 Ga0075434_101805039 3300006871 Unclassified 618
107 Ga0068865_100052968 3300006881 Bacteria 2814
108 Ga0075436_100298027 3300006914 Bacteria 1155
109 Ga0075436_101500754 3300006914 Viruses 512
110 Ga0097620_100000740 3300006931 Bacteria 32876
111 Ga0075435_100308459 3300007076 Bacteria 1354
112 Ga0075435_100316333 3300007076 Bacteria 1336
113 Ga0075435_100418971 3300007076 Viruses 1153
114 Ga0099795_10010136 3300007788 Bacteria 2762
115 Ga0105240_10068859 3300009093 Bacteria 4382
116 Ga0105240_11580880 3300009093 Bacteria 686
117 Ga0105245_10011848 3300009098 Bacteria 7585
118 Ga0105245_10219881 3300009098 Bacteria 1832
119 Ga0105245_10219883 3300009098 Bacteria 1832
120 Ga0105245_10842897 3300009098 Bacteria 956
121 Ga0105245_11702011 3300009098 Bacteria 683
122 Ga0105243_10123618 3300009148 Bacteria 2186
123 Ga0105243_10226206 3300009148 Bacteria 1657
124 Ga0105243_10716163 3300009148 Unclassified 977
125 Ga0105241_10132806 3300009174 Bacteria 2017
126 Ga0105241_10415148 3300009174 Bacteria 1183
127 Ga0105241_10863236 3300009174 Bacteria 838
128 Ga0105242_10018207 3300009176 Bacteria 5489
129 Ga0105242_10031898 3300009176 Bacteria 4212
130 Ga0105242_10211778 3300009176 Bacteria 1728
131 Ga0105242_10640531 3300009176 Bacteria 1032
132 Ga0105248_10037006 3300009177 Bacteria 5458
133 Ga0105248_10368337 3300009177 Bacteria 1617
134 Ga0105248_11846167 3300009177 Bacteria 686
135 Ga0105237_11092702 3300009545 Bacteria 804
136 Ga0105238_10449513 3300009551 Bacteria 1285
137 Ga0105249_10296823 3300009553 Bacteria 1619
138 Ga0105249_12111934 3300009553 Bacteria 636
139 Ga0105249_13259583 3300009553 Bacteria 522
140 Ga0099796_10004216 3300010159 Bacteria 3451
141 Ga0105239_10436126 3300010375 Bacteria 1485
142 Ga0105239_10676383 3300010375 Unclassified 1179
143 Ga0105239_11589775 3300010375 Viruses 756
144 Ga0105246_10369705 3300011119 Bacteria 1181
145 Ga0105246_10849500 3300011119 Bacteria 814
146 Ga0157373_10422221 3300013100 Bacteria 957
147 Ga0157371_11157621 3300013102 Bacteria 595
148 Ga0157370_10892880 3300013104 Bacteria 807
149 Ga0157370_11060560 3300013104 Bacteria 733
150 Ga0157369_10503917 3300013105 Unclassified 1252
151 Ga0157369_11303820 3300013105 Unclassified 740
152 Ga0157374_10001706 3300013296 Bacteria 18421
153 Ga0157378_10216435 3300013297 Bacteria 1819
154 Ga0157378_10375609 3300013297 Bacteria 1395
155 Ga0157378_10870956 3300013297 Unclassified 930
156 Ga0157378_12277005 3300013297 Unclassified 593
157 Ga0157378_12670953 3300013297 Unclassified 552
158 Ga0163162_10270128 3300013306 Bacteria 1832
159 Ga0163162_10274041 3300013306 Bacteria 1819
160 Ga0163162_10695011 3300013306 Bacteria 1139
161 Ga0157372_10272235 3300013307 Bacteria 1968
162 Ga0157372_13185201 3300013307 Bacteria 523
163 Ga0157375_10001525 3300013308 Bacteria 19910
164 Ga0157375_11491364 3300013308 Bacteria 798
165 Ga0163163_10000748 3300014325 Bacteria 27686
166 Ga0163163_11870877 3300014325 Bacteria 660
167 Ga0157379_10022888 3300014968 Bacteria 5539
168 Ga0157376_10156348 3300014969 Bacteria 2062
169 Ga0157376_10177763 3300014969 Bacteria 1943
170 Ga0157376_10178971 3300014969 Bacteria 1936
171 Ga0163161_10043650 3300017792 Bacteria 3228
172 Ga0213874_10188094 3300021377 Bacteria 737
173 Ga0213871_10053114 3300021441 Bacteria 1115
174 Ga0209233_1000015 3300025261 Bacteria 980563
175 Ga0209233_1000982 3300025261 Bacteria 12227
176 Ga0207656_10268053 3300025321 Bacteria 840
177 Ga0207692_10005142 3300025898 Bacteria 5219
178 Ga0207680_10003729 3300025903 Bacteria 7166
179 Ga0207680_10698613 3300025903 Bacteria 727
180 Ga0207685_10006663 3300025905 Bacteria 3163
181 Ga0207699_10092635 3300025906 Bacteria 1900
182 Ga0207645_10037113 3300025907 Bacteria 3128
183 Ga0207643_10079373 3300025908 Bacteria 1899
184 Ga0207705_10214232 3300025909 Unclassified 1461
185 Ga0207705_10280530 3300025909 Bacteria 1275
186 Ga0207684_10015437 3300025910 Bacteria 6572
187 Ga0207684_10805790 3300025910 Unclassified 794
188 Ga0207654_10227222 3300025911 Bacteria 1241
189 Ga0207654_10464937 3300025911 Bacteria 889
190 Ga0207654_10714402 3300025911 Unclassified 720
191 Ga0207707_10330537 3300025912 Bacteria 1315
192 Ga0207695_10028065 3300025913 Bacteria 6251
193 Ga0207693_10003184 3300025915 Bacteria 14101
194 Ga0207693_10201302 3300025915 Unclassified 1566
195 Ga0207663_10000577 3300025916 Bacteria 16163
196 Ga0207663_10193963 3300025916 Bacteria 1460
197 Ga0207660_10009355 3300025917 Bacteria 6341
198 Ga0207660_11637369 3300025917 Bacteria 518
199 Ga0207694_10935643 3300025924 Bacteria 733
200 Ga0207650_10070874 3300025925 Bacteria 2621
201 Ga0207650_10701094 3300025925 Bacteria 855
202 Ga0207659_10930369 3300025926 Bacteria 748
203 Ga0207659_11164419 3300025926 Unclassified 663
204 Ga0207687_10001115 3300025927 Bacteria 18251
205 Ga0207687_10014765 3300025927 Bacteria 5115
206 Ga0207687_10512848 3300025927 Bacteria 1002
207 Ga0207700_10011158 3300025928 Bacteria 5717
208 Ga0207644_10013274 3300025931 Bacteria 5489
209 Ga0207644_10242814 3300025931 Bacteria 1434
210 Ga0207644_11745097 3300025931 Unclassified 521
211 Ga0207706_10081463 3300025933 Bacteria 2844
212 Ga0207706_10265452 3300025933 Bacteria 1498
213 Ga0207706_10682929 3300025933 Bacteria 878
214 Ga0207706_11296588 3300025933 Unclassified 602
215 Ga0207686_10001673 3300025934 Bacteria 12345
216 Ga0207686_10033406 3300025934 Bacteria 3071
217 Ga0207686_10057839 3300025934 Bacteria 2442
218 Ga0207686_10320410 3300025934 Bacteria 1158
219 Ga0207709_10425058 3300025935 Bacteria 1021
220 Ga0207709_11197466 3300025935 Bacteria 626
221 Ga0207670_10016203 3300025936 Bacteria 4473
222 Ga0207669_10091106 3300025937 Bacteria 1985
223 Ga0207669_10704372 3300025937 Bacteria 830
224 Ga0207704_10101851 3300025938 Bacteria 1916
225 Ga0207665_10010146 3300025939 Bacteria 6183
226 Ga0207665_10320237 3300025939 Bacteria 1163
227 Ga0207691_10018523 3300025940 Bacteria 6598
228 Ga0207691_10111054 3300025940 Bacteria 2438
229 Ga0207691_10365567 3300025940 Bacteria 1233
230 Ga0207711_10000495 3300025941 Bacteria 40705
231 Ga0207711_10373381 3300025941 Bacteria 1323
232 Ga0207689_10449830 3300025942 Bacteria 1077
233 Ga0207689_10468421 3300025942 Unclassified 1054
234 Ga0207661_10104077 3300025944 Bacteria 2390
235 Ga0207679_10093111 3300025945 Bacteria 2336
236 Ga0207679_10229208 3300025945 Bacteria 1567
237 Ga0207667_10261359 3300025949 Bacteria 1770
238 Ga0207667_10377571 3300025949 Bacteria 1444
239 Ga0207651_10000412 3300025960 Bacteria 18175
240 Ga0207651_10903520 3300025960 Bacteria 787
241 Ga0207712_11643977 3300025961 Bacteria 576
242 Ga0207640_10244693 3300025981 Bacteria 1388
243 Ga0207640_10454767 3300025981 Bacteria 1056
244 Ga0207658_10022073 3300025986 Bacteria 4427
245 Ga0207658_10497122 3300025986 Unclassified 1086
246 Ga0207658_10570258 3300025986 Bacteria 1014
247 Ga0207658_12187088 3300025986 Bacteria 502
248 Ga0207677_10000254 3300026023 Bacteria 41317
249 Ga0207677_11081186 3300026023 Bacteria 730
250 Ga0207703_10000640 3300026035 Bacteria 35154
251 Ga0207639_10696449 3300026041 Bacteria 942
252 Ga0207678_10098059 3300026067 Bacteria 2504
253 Ga0207678_10605725 3300026067 Bacteria 960
254 Ga0207702_10340923 3300026078 Bacteria 1432
255 Ga0207641_10001482 3300026088 Bacteria 23006
256 Ga0207648_10019985 3300026089 Bacteria 6042
257 Ga0207648_10571307 3300026089 Bacteria 1040
258 Ga0207676_10000481 3300026095 Bacteria 33594
259 Ga0207676_12498385 3300026095 Bacteria 513
260 Ga0207675_100642932 3300026118 Bacteria 1066
261 Ga0207675_100943984 3300026118 Bacteria 880
262 Ga0207683_10057110 3300026121 Bacteria 3426
263 Ga0207683_10615711 3300026121 Unclassified 1005
264 Ga0207698_10286644 3300026142 Bacteria 1526
265 Ga0207698_12351197 3300026142 Unclassified 544
266 Ga0207698_12755522 3300026142 Bacteria 500
267 Ga0268266_10030201 3300028379 Bacteria 4605
268 Ga0268266_10079518 3300028379 Bacteria 2855
269 Ga0268266_11410160 3300028379 Unclassified 672
270 Ga0268264_10001658 3300028381 Bacteria 20536
271 Ga0268264_10295691 3300028381 Bacteria 1522
272 Ga0268264_10784650 3300028381 Unclassified 951
273 Ga0265338_10620265 3300028800 Bacteria 752
274 Ga0307409_100793046 3300031995 Bacteria 954
275 Ga0307415_100224693 3300032126 Bacteria 1508
276 Ga0373926_0082457 3300035083 Bacteria 1190
277 Ga0373926_0087500 3300035083 Bacteria 1156
278 Ga0373928_0110823 3300035084 Unclassified 726
279 Ga0373934_0001393 3300035086 Bacteria 8817
280 Ga0373923_0000210 3300035111 Bacteria 12063
281 Ga0373936_0058841 3300035113 Bacteria 1565
282 Ga0373936_0095399 3300035113 Bacteria 1250
283 Ga0373945_0008878 3300035116 Bacteria 3284
284 Ga0373945_0059727 3300035116 Bacteria 1420
285 Ga0373945_0339375 3300035116 Bacteria 650
286 Ga0373953_0002347 3300035117 Bacteria 5699
287 Ga0373954_0002454 3300035118 Bacteria 7773
288 Ga0373956_0000920 3300035119 Bacteria 12203
289 Ga0373957_0016546 3300035120 Bacteria 2553
290 Ga0373943_0011339 3300035170 Bacteria 4009
291 Ga0373943_0052707 3300035170 Bacteria 2006
292 Ga0373943_0102812 3300035170 Bacteria 1497
293 Ga0373943_0363563 3300035170 Bacteria 831
294 Ga0373946_0142663 3300035171 Bacteria 1111
295 Ga0373946_0172238 3300035171 Bacteria 1022
296 Ga0373946_0176720 3300035171 Unclassified 1011
297 Ga0373955_0001397 3300035172 Bacteria 10273
298 Ga0373924_0042119 3300035410 Bacteria 1872
299 Ga0373931_0146510 3300035691 Bacteria 1373
300 Ga0373931_0307897 3300035691 Bacteria 980
301 Ga0373935_0047165 3300035692 Bacteria 2723
302 Ga0373935_0149787 3300035692 Bacteria 1582
303 Ga0373935_0160871 3300035692 Bacteria 1530
304 Ga0373935_0892106 3300035692 Unclassified 658
305 Ga0373927_0049957 3300035695 Bacteria 2704
306 Ga0373927_0058660 3300035695 Bacteria 2489
307 Ga0373933_0051983 3300035724 Bacteria 2450
308 Ga0373933_0057006 3300035724 Bacteria 2346
309 Ga0373933_1069745 3300035724 Unclassified 531
310 Ga0373947_0008022 3300035725 Bacteria 6090
311 Ga0373947_0026644 3300035725 Bacteria 3380
312 Ga0373947_0338964 3300035725 Bacteria 1007
313 Ga0373937_0006300 3300036401 Bacteria 10233
314 Ga0373937_0020390 3300036401 Bacteria 5944
315 Ga0373937_0786376 3300036401 Bacteria 899
316 Ga0373925_0013479 3300037068 Bacteria 5917
317 Ga0373925_0413387 3300037068 Bacteria 1101
318 Ga0373925_0485605 3300037068 Bacteria 1013
319 Ga0373925_0525142 3300037068 Bacteria 973
320 Ga0395899_0329570 3300037312 Bacteria 1026
321 Ga0395900_0015810 3300037418 Bacteria 7693
322 Ga0395898_1644118 3300037466 Bacteria 566
323 Ga0395905_0046098 3300037471 Bacteria 4088
324 Ga0395905_0089718 3300037471 Bacteria 2881
325 Ga0395905_0105647 3300037471 Bacteria 2644
326 Ga0395905_0194838 3300037471 Bacteria 1900
327 Ga0395905_0840130 3300037471 Bacteria 821
328 Ga0395905_1800288 3300037471 Bacteria 518
329 Ga0436360_0059423 3300039438 Bacteria 697
330 Ga0436360_0743645 3300039438 Bacteria 1935
331 Ga0436361_1196724 3300039447 Bacteria 1110
332 Ga0436363_1119547 3300039450 Bacteria 6556
333 Ga0436362_1045778 3300039453 Bacteria 1895
334 Ga0436362_1242066 3300039453 Bacteria 657
335 Ga0451789_0308947 3300041443 Bacteria 1104
336 Ga0451802_0959190 3300041460 Unclassified 867
337 Ga0451807_0192404 3300041486 Bacteria 1276
338 Ga0451839_0292333 3300041496 Bacteria 852
339 Ga0451845_0926531 3300041501 Unclassified 705
340 Ga0451853_1607039 3300041512 Bacteria 713
341 Ga0451853_3736650 3300041512 Bacteria 2343
342 Ga0451577_0194437 3300042876 Bacteria 1830
343 Ga0453684_0042938 3300044712 Bacteria 6086
344 Ga0453684_0056669 3300044712 Bacteria 5080
345 Ga0495603_0501779 3300046455 Unclassified 695
346 Ga0495603_0516385 3300046455 Unclassified 684
347 Ga0495629_0743771 3300046459 Unclassified 649
348 Ga0495641_0554179 3300046461 Unclassified 525
349 Ga0495653_0151317 3300046463 Unclassified 1621
350 Ga0495653_0189315 3300046463 Bacteria 1405
351 Ga0495653_0915140 3300046463 Bacteria 522
352 Ga0495580_0009062 3300046472 Bacteria 7850
353 Ga0495580_0313645 3300046472 Unclassified 1066
354 Ga0495582_0016415 3300046473 Bacteria 4057
355 Ga0495639_0162430 3300046475 Bacteria 1082
356 Ga0495662_0026964 3300046476 Bacteria 2775
357 Ga0495662_0052425 3300046476 Bacteria 1970
358 Ga0495664_0214451 3300046477 Bacteria 1166
359 Ga0495664_0295679 3300046477 Bacteria 978
360 Ga0495584_0447398 3300046491 Unclassified 657
361 Ga0495594_0130684 3300046499 Unclassified 1422
362 Ga0495608_0181078 3300046511 Bacteria 1333
363 Ga0495618_0174696 3300046514 Bacteria 1366
364 Ga0495628_0331300 3300046516 Bacteria 1122
365 Ga0495630_0058441 3300046517 Bacteria 2891
366 Ga0495630_0069934 3300046517 Bacteria 2641
367 Ga0495630_0096911 3300046517 Bacteria 2230
368 Ga0495663_0243332 3300046525 Bacteria 637
369 Ga0495666_0046885 3300046526 Bacteria 2082
370 Ga0495666_0078305 3300046526 Bacteria 1566
371 Ga0495666_0111746 3300046526 Bacteria 1283
372 Ga0495652_0249852 3300046529 Bacteria 1315
373 Ga0495665_0055603 3300046531 Bacteria 2089
374 Ga0495640_0199395 3300046533 Bacteria 1269
375 Ga0495640_0746924 3300046533 Bacteria 585
376 Ga0495586_0174591 3300046535 Bacteria 1214
377 Ga0495621_0004073 3300046539 Bacteria 4070
378 Ga0495645_0126038 3300046543 Bacteria 1799
379 Ga0495645_0471200 3300046543 Bacteria 789
380 Ga0495667_0112656 3300046559 Bacteria 1758
381 Ga0495634_0006196 3300046642 Bacteria 9115
382 Ga0495634_0276294 3300046642 Unclassified 1021
383 Ga0495635_0013358 3300046663 Bacteria 5748
384 Ga0495635_0168269 3300046663 Bacteria 1491
385 Ga0495659_0025567 3300046664 Bacteria 2022
386 Ga0495588_0041659 3300046674 Bacteria 2346
387 Ga0495657_0489922 3300046675 Unclassified 717
388 Ga0495599_0268763 3300046678 Bacteria 1035
389 Ga0495623_0008420 3300046679 Bacteria 6701
390 Ga0495646_0592170 3300046680 Unclassified 564
391 Ga0495647_0002734 3300046681 Bacteria 5596
392 Ga0495647_0308056 3300046681 Bacteria 715
393 Ga0495647_0389427 3300046681 Unclassified 639
394 Ga0495658_0012093 3300046683 Bacteria 4359
395 Ga0495613_0004932 3300046689 Bacteria 10027
396 Ga0495613_0009140 3300046689 Bacteria 7347
397 Ga0495624_0283143 3300046690 Bacteria 1001
398 Ga0495581_0000879 3300047315 Bacteria 16066
399 Ga0495581_0569471 3300047315 Bacteria 657
400 Ga0495604_0102756 3300047317 Bacteria 2098
401 Ga0495674_0329633 3300047319 Bacteria 1242
402 Ga0495674_0906711 3300047319 Bacteria 680
403 Ga0495676_0063469 3300047321 Bacteria 2879
404 Ga0495676_0563556 3300047321 Bacteria 744
405 Ga0495676_1085712 3300047321 Bacteria 509
406 Ga0495680_0018982 3300047322 Bacteria 5822
407 Ga0495680_0721395 3300047322 Bacteria 657
408 Ga0495675_0246810 3300047444 Bacteria 1073
409 Ga0495684_0009051 3300047471 Bacteria 7686
410 Ga0495684_0370270 3300047471 Bacteria 1013
411 Ga0495593_0172782 3300047673 Bacteria 1089
412 Ga0495614_0054877 3300048089 Bacteria 1709
413 Ga0496100_0101876 3300048903 Bacteria 1980
414 Ga0496101_1155165 3300048904 Bacteria 607
415 Ga0496104_0003090 3300048907 Bacteria 14349
416 Ga0496105_0008052 3300048908 Bacteria 8191
417 Ga0496105_0602059 3300048908 Bacteria 853
418 Ga0496107_0029893 3300048910 Bacteria 3880
419 Ga0496108_0015347 3300048911 Bacteria 6248
420 Ga0496108_0016049 3300048911 Bacteria 6107
421 Ga0496109_0014974 3300048912 Bacteria 6750
422 Ga0496109_0031869 3300048912 Bacteria 4735
423 Ga0496109_0399314 3300048912 Unclassified 1299
424 Ga0496110_0073594 3300048913 Bacteria 3032
425 Ga0496110_0363128 3300048913 Bacteria 1319
426 Ga0496111_0076466 3300048914 Bacteria 2440
427 Ga0496112_0005494 3300048915 Bacteria 10973
428 Ga0496112_0019235 3300048915 Bacteria 6441
429 Ga0496112_1452597 3300048915 Bacteria 600
430 Ga0496113_0401120 3300048916 Bacteria 1101
431 Ga0496114_0013724 3300048917 Bacteria 6494
432 Ga0496114_0407185 3300048917 Bacteria 1204
433 Ga0496115_0373431 3300048918 Bacteria 1161
434 Ga0501031_0050411 3300049568 Bacteria 2712
435 Ga0501033_0014998 3300049570 Bacteria 5881
436 Ga0501034_1060006 3300049571 Bacteria 693
437 Ga0501036_0085493 3300049572 Bacteria 2666
438 Ga0501038_0031685 3300049574 Bacteria 4670
439 Ga0501039_0480789 3300049575 Bacteria 975
440 Ga0501040_0079685 3300049576 Bacteria 2267
441 Ga0501041_0002085 3300049577 Bacteria 11251
442 Ga0501042_0004777 3300049578 Bacteria 8654
443 Ga0501042_0580053 3300049578 Unclassified 815
444 Ga0501046_0024882 3300049580 Bacteria 4905
445 Ga0501068_0007079 3300049584 Bacteria 6211
446 Ga0501070_0348556 3300049586 Bacteria 1202
447 Ga0501071_0028308 3300049587 Bacteria 3948
448 Ga0501071_0826234 3300049587 Unclassified 715
449 Ga0501071_1482828 3300049587 Bacteria 524
450 Ga0501072_0206376 3300049588 Bacteria 1566
451 Ga0501072_1112070 3300049588 Bacteria 615
452 Ga0501072_1519070 3300049588 Bacteria 517
453 Ga0501073_0437155 3300049589 Bacteria 904
454 Ga0501074_0380733 3300049590 Bacteria 1001
455 Ga0501074_0752737 3300049590 Bacteria 687
456 Ga0501075_0030036 3300049591 Bacteria 4022
457 Ga0501076_0135072 3300049592 Bacteria 2002
458 Ga0501077_0004246 3300049593 Bacteria 8659
459 Ga0501079_0004267 3300049741 Bacteria 10607
460 Ga0501081_0031968 3300049743 Bacteria 3568
461 Ga0501035_0149732 3300049822 Bacteria 2026
462 Ga0501045_0045517 3300049824 Bacteria 3194
463 nmdc:mga0k408_857181_c1 3300050493 Unclassified 528
464 nmdc:mga06z11_233389_c1 3300050494 Bacteria 1078
465 nmdc:mga0n895_634780_c1 3300050512 Bacteria 1068
466 nmdc:mga0n895_77090_c1 3300050512 Bacteria 3315
467 nmdc:mga0rr50_284254_c1 3300050513 Bacteria 1381
468 nmdc:mga0rr50_413698_c1 3300050513 Bacteria 1140
469 nmdc:mga0rr50_804432_c1 3300050513 Viruses 802
470 nmdc:mga08x19_238877_c1 3300050514 Bacteria 1252
471 nmdc:mga0sz30_454479_c1 3300050516 Bacteria 575
472 Ga0495601_0123483 3300053077 Bacteria 1683
473 Ga0495612_0019390 3300053078 Bacteria 2724
474 Ga0495612_0085565 3300053078 Bacteria 1329
475 Ga0495619_0004675 3300053085 Bacteria 8724
476 Ga0495619_0122294 3300053085 Bacteria 1785
477 Ga0500566_0176463 3300053094 Bacteria 1100
478 Ga0501084_1051638 3300054114 Bacteria 684
479 Ga0501082_0015246 3300060353 Bacteria 6620
480 Ga0530510_0047448 3300061734 Bacteria 3103

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10201302 Ga0207693_102013023 77
2 3300035116 Ga0373945_0339375 Ga0373945_0339375_366_602 77
3 3300035692 Ga0373935_0160871 Ga0373935_0160871_119_355 77
4 3300046477 Ga0495664_0295679 Ga0495664_0295679_379_615 77
5 3300047321 Ga0495676_0063469 Ga0495676_0063469_1401_1637 77
6 3300025907 Ga0207645_10037113 Ga0207645_100371133 83
7 3300049590 Ga0501074_0380733 Ga0501074_0380733_119_376 83
8 3300025960 Ga0207651_10903520 Ga0207651_109035201 84
9 3300042876 Ga0451577_0194437 Ga0451577_0194437_1235_1492 84
10 3300044712 Ga0453684_0056669 Ga0453684_0056669_1967_2224 84
11 3300050493 nmdc:mga0k408_857181_c1 nmdc:mga0k408_857181_c1_92_349 84
12 3300005293 Ga0065715_10040593 Ga0065715_100405933 85
13 3300005328 Ga0070676_10725705 Ga0070676_107257052 85
14 3300005330 Ga0070690_100013069 Ga0070690_1000130691 85
15 3300005331 Ga0070670_100035630 Ga0070670_1000356303 85
16 3300005334 Ga0068869_101325210 Ga0068869_1013252102 85
17 3300005335 Ga0070666_10141667 Ga0070666_101416672 85
18 3300005338 Ga0068868_100143000 Ga0068868_1001430002 85
19 3300005338 Ga0068868_101478115 Ga0068868_1014781151 85
20 3300005340 Ga0070689_100006129 Ga0070689_10000612911 85
21 3300005345 Ga0070692_10535817 Ga0070692_105358172 85
22 3300005355 Ga0070671_100001056 Ga0070671_1000010568 85
23 3300005356 Ga0070674_100178247 Ga0070674_1001782473 85
24 3300005356 Ga0070674_100322274 Ga0070674_1003222742 85
25 3300005364 Ga0070673_100000288 Ga0070673_10000028816 85
26 3300005365 Ga0070688_100000246 Ga0070688_1000002468 85
27 3300005366 Ga0070659_101750380 Ga0070659_1017503802 85
28 3300005367 Ga0070667_100445767 Ga0070667_1004457672 85
29 3300005434 Ga0070709_10352404 Ga0070709_103524041 85
30 3300005436 Ga0070713_100009493 Ga0070713_1000094938 85
31 3300005437 Ga0070710_10052426 Ga0070710_100524261 85
32 3300005438 Ga0070701_10231570 Ga0070701_102315702 85
33 3300005438 Ga0070701_11181850 Ga0070701_111818502 85
34 3300005439 Ga0070711_100006708 Ga0070711_1000067087 85
35 3300005440 Ga0070705_100452146 Ga0070705_1004521462 85
36 3300005444 Ga0070694_100751084 Ga0070694_1007510842 85
37 3300005455 Ga0070663_100254862 Ga0070663_1002548622 85
38 3300005456 Ga0070678_100053633 Ga0070678_1000536334 85
39 3300005457 Ga0070662_100034357 Ga0070662_1000343571 85
40 3300005457 Ga0070662_101139184 Ga0070662_1011391842 85
41 3300005458 Ga0070681_10384058 Ga0070681_103840582 85
42 3300005459 Ga0068867_100232980 Ga0068867_1002329801 85
43 3300005459 Ga0068867_101864885 Ga0068867_1018648852 85
44 3300005466 Ga0070685_10001919 Ga0070685_100019198 85
45 3300005467 Ga0070706_100021407 Ga0070706_1000214073 85
46 3300005467 Ga0070706_101192679 Ga0070706_1011926791 85
47 3300005468 Ga0070707_100021703 Ga0070707_1000217034 85
48 3300005468 Ga0070707_101009851 Ga0070707_1010098512 85
49 3300005535 Ga0070684_100242561 Ga0070684_1002425612 85
50 3300005535 Ga0070684_102048648 Ga0070684_1020486481 85
51 3300005539 Ga0068853_100967507 Ga0068853_1009675072 85
52 3300005543 Ga0070672_100013631 Ga0070672_1000136317 85
53 3300005544 Ga0070686_100204693 Ga0070686_1002046932 85
54 3300005544 Ga0070686_100562328 Ga0070686_1005623281 85
55 3300005546 Ga0070696_100160412 Ga0070696_1001604122 85
56 3300005546 Ga0070696_100855068 Ga0070696_1008550681 85
57 3300005547 Ga0070693_100022360 Ga0070693_1000223604 85
58 3300005547 Ga0070693_100345282 Ga0070693_1003452822 85
59 3300005548 Ga0070665_100030951 Ga0070665_1000309517 85
60 3300005549 Ga0070704_100926981 Ga0070704_1009269812 85
61 3300005549 Ga0070704_101434033 Ga0070704_1014340332 85
62 3300005578 Ga0068854_100592397 Ga0068854_1005923972 85
63 3300005614 Ga0068856_100278784 Ga0068856_1002787842 85
64 3300005615 Ga0070702_100150660 Ga0070702_1001506601 85
65 3300005616 Ga0068852_100036754 Ga0068852_1000367542 85
66 3300005617 Ga0068859_100000740 Ga0068859_10000074016 85
67 3300005618 Ga0068864_100000422 Ga0068864_10000042219 85
68 3300005718 Ga0068866_10003735 Ga0068866_100037353 85
69 3300005719 Ga0068861_100201866 Ga0068861_1002018663 85
70 3300005834 Ga0068851_10054065 Ga0068851_100540651 85
71 3300005841 Ga0068863_100009662 Ga0068863_1000096627 85
72 3300005841 Ga0068863_101953531 Ga0068863_1019535312 85
73 3300005842 Ga0068858_100005858 Ga0068858_10000585811 85
74 3300005843 Ga0068860_100322453 Ga0068860_1003224531 85
75 3300005843 Ga0068860_100885954 Ga0068860_1008859542 85
76 3300005937 Ga0081455_10012453 Ga0081455_1001245310 85
77 3300006028 Ga0070717_11271764 Ga0070717_112717642 85
78 3300006163 Ga0070715_10008490 Ga0070715_100084901 85
79 3300006173 Ga0070716_100100308 Ga0070716_1001003082 85
80 3300006175 Ga0070712_100004526 Ga0070712_1000045267 85
81 3300006178 Ga0075367_10159581 Ga0075367_101595812 85
82 3300006237 Ga0097621_100160323 Ga0097621_1001603232 85
83 3300006237 Ga0097621_100175330 Ga0097621_1001753302 85
84 3300006358 Ga0068871_100204649 Ga0068871_1002046492 85
85 3300006852 Ga0075433_10856731 Ga0075433_108567312 85
86 3300006871 Ga0075434_100056706 Ga0075434_1000567064 85
87 3300006871 Ga0075434_101805039 Ga0075434_1018050391 85
88 3300006914 Ga0075436_100298027 Ga0075436_1002980272 85
89 3300006914 Ga0075436_101500754 Ga0075436_1015007542 85
90 3300006931 Ga0097620_100000740 Ga0097620_10000074017 85
91 3300007076 Ga0075435_100308459 Ga0075435_1003084591 85
92 3300007076 Ga0075435_100316333 Ga0075435_1003163332 85
93 3300007076 Ga0075435_100418971 Ga0075435_1004189712 85
94 3300009098 Ga0105245_10011848 Ga0105245_100118486 85
95 3300009098 Ga0105245_10219881 Ga0105245_102198812 85
96 3300009098 Ga0105245_10219883 Ga0105245_102198832 85
97 3300009098 Ga0105245_10842897 Ga0105245_108428972 85
98 3300009098 Ga0105245_11702011 Ga0105245_117020111 85
99 3300009148 Ga0105243_10123618 Ga0105243_101236182 85
100 3300009148 Ga0105243_10226206 Ga0105243_102262062 85
101 3300009148 Ga0105243_10716163 Ga0105243_107161632 85
102 3300009174 Ga0105241_10132806 Ga0105241_101328062 85
103 3300009174 Ga0105241_10415148 Ga0105241_104151482 85
104 3300009174 Ga0105241_10863236 Ga0105241_108632362 85
105 3300009176 Ga0105242_10018207 Ga0105242_100182075 85
106 3300009176 Ga0105242_10031898 Ga0105242_100318984 85
107 3300009176 Ga0105242_10211778 Ga0105242_102117782 85
108 3300009176 Ga0105242_10640531 Ga0105242_106405312 85
109 3300009177 Ga0105248_10037006 Ga0105248_100370067 85
110 3300009177 Ga0105248_10368337 Ga0105248_103683372 85
111 3300009545 Ga0105237_11092702 Ga0105237_110927021 85
112 3300009551 Ga0105238_10449513 Ga0105238_104495131 85
113 3300009553 Ga0105249_10296823 Ga0105249_102968232 85
114 3300009553 Ga0105249_12111934 Ga0105249_121119342 85
115 3300009553 Ga0105249_13259583 Ga0105249_132595832 85
116 3300010375 Ga0105239_10436126 Ga0105239_104361262 85
117 3300010375 Ga0105239_10676383 Ga0105239_106763833 85
118 3300010375 Ga0105239_11589775 Ga0105239_115897752 85
119 3300011119 Ga0105246_10369705 Ga0105246_103697052 85
120 3300011119 Ga0105246_10849500 Ga0105246_108495002 85
121 3300013100 Ga0157373_10422221 Ga0157373_104222212 85
122 3300013102 Ga0157371_11157621 Ga0157371_111576211 85
123 3300013105 Ga0157369_11303820 Ga0157369_113038201 85
124 3300013296 Ga0157374_10001706 Ga0157374_1000170614 85
125 3300013297 Ga0157378_10216435 Ga0157378_102164352 85
126 3300013297 Ga0157378_10375609 Ga0157378_103756092 85
127 3300013297 Ga0157378_10870956 Ga0157378_108709562 85
128 3300013297 Ga0157378_12277005 Ga0157378_122770052 85
129 3300013297 Ga0157378_12670953 Ga0157378_126709531 85
130 3300013306 Ga0163162_10270128 Ga0163162_102701282 85
131 3300013306 Ga0163162_10274041 Ga0163162_102740412 85
132 3300013306 Ga0163162_10695011 Ga0163162_106950112 85
133 3300013307 Ga0157372_13185201 Ga0157372_131852012 85
134 3300013308 Ga0157375_10001525 Ga0157375_100015257 85
135 3300013308 Ga0157375_11491364 Ga0157375_114913641 85
136 3300014325 Ga0163163_10000748 Ga0163163_100007487 85
137 3300014325 Ga0163163_11870877 Ga0163163_118708772 85
138 3300014968 Ga0157379_10022888 Ga0157379_100228881 85
139 3300014969 Ga0157376_10156348 Ga0157376_101563482 85
140 3300014969 Ga0157376_10177763 Ga0157376_101777632 85
141 3300014969 Ga0157376_10178971 Ga0157376_101789712 85
142 3300017792 Ga0163161_10043650 Ga0163161_100436503 85
143 3300025321 Ga0207656_10268053 Ga0207656_102680531 85
144 3300025898 Ga0207692_10005142 Ga0207692_100051421 85
145 3300025903 Ga0207680_10003729 Ga0207680_100037299 85
146 3300025905 Ga0207685_10006663 Ga0207685_100066632 85
147 3300025906 Ga0207699_10092635 Ga0207699_100926353 85
148 3300025908 Ga0207643_10079373 Ga0207643_100793733 85
149 3300025910 Ga0207684_10015437 Ga0207684_100154376 85
150 3300025911 Ga0207654_10227222 Ga0207654_102272223 85
151 3300025911 Ga0207654_10464937 Ga0207654_104649372 85
152 3300025911 Ga0207654_10714402 Ga0207654_107144021 85
153 3300025912 Ga0207707_10330537 Ga0207707_103305372 85
154 3300025915 Ga0207693_10003184 Ga0207693_1000318414 85
155 3300025916 Ga0207663_10000577 Ga0207663_100005777 85
156 3300025916 Ga0207663_10193963 Ga0207663_101939632 85
157 3300025924 Ga0207694_10935643 Ga0207694_109356432 85
158 3300025925 Ga0207650_10070874 Ga0207650_100708743 85
159 3300025926 Ga0207659_10930369 Ga0207659_109303692 85
160 3300025926 Ga0207659_11164419 Ga0207659_111644191 85
161 3300025927 Ga0207687_10001115 Ga0207687_100011153 85
162 3300025927 Ga0207687_10014765 Ga0207687_100147654 85
163 3300025927 Ga0207687_10512848 Ga0207687_105128482 85
164 3300025928 Ga0207700_10011158 Ga0207700_100111587 85
165 3300025931 Ga0207644_10013274 Ga0207644_100132743 85
166 3300025931 Ga0207644_10242814 Ga0207644_102428141 85
167 3300025933 Ga0207706_10081463 Ga0207706_100814634 85
168 3300025933 Ga0207706_10682929 Ga0207706_106829292 85
169 3300025933 Ga0207706_11296588 Ga0207706_112965882 85
170 3300025934 Ga0207686_10001673 Ga0207686_100016736 85
171 3300025934 Ga0207686_10033406 Ga0207686_100334062 85
172 3300025934 Ga0207686_10057839 Ga0207686_100578393 85
173 3300025934 Ga0207686_10320410 Ga0207686_103204102 85
174 3300025935 Ga0207709_10425058 Ga0207709_104250582 85
175 3300025935 Ga0207709_11197466 Ga0207709_111974662 85
176 3300025936 Ga0207670_10016203 Ga0207670_100162032 85
177 3300025937 Ga0207669_10091106 Ga0207669_100911062 85
178 3300025937 Ga0207669_10704372 Ga0207669_107043721 85
179 3300025939 Ga0207665_10010146 Ga0207665_100101467 85
180 3300025940 Ga0207691_10018523 Ga0207691_100185237 85
181 3300025940 Ga0207691_10365567 Ga0207691_103655672 85
182 3300025941 Ga0207711_10000495 Ga0207711_1000049532 85
183 3300025941 Ga0207711_10373381 Ga0207711_103733812 85
184 3300025942 Ga0207689_10449830 Ga0207689_104498302 85
185 3300025942 Ga0207689_10468421 Ga0207689_104684212 85
186 3300025945 Ga0207679_10093111 Ga0207679_100931113 85
187 3300025960 Ga0207651_10000412 Ga0207651_100004127 85
188 3300025961 Ga0207712_11643977 Ga0207712_116439772 85
189 3300025986 Ga0207658_10022073 Ga0207658_100220733 85
190 3300025986 Ga0207658_10570258 Ga0207658_105702582 85
191 3300025986 Ga0207658_12187088 Ga0207658_121870881 85
192 3300026023 Ga0207677_10000254 Ga0207677_1000025422 85
193 3300026023 Ga0207677_11081186 Ga0207677_110811862 85
194 3300026035 Ga0207703_10000640 Ga0207703_1000064020 85
195 3300026067 Ga0207678_10605725 Ga0207678_106057252 85
196 3300026078 Ga0207702_10340923 Ga0207702_103409232 85
197 3300026088 Ga0207641_10001482 Ga0207641_1000148224 85
198 3300026089 Ga0207648_10019985 Ga0207648_100199856 85
199 3300026095 Ga0207676_10000481 Ga0207676_1000048127 85
200 3300026095 Ga0207676_12498385 Ga0207676_124983852 85
201 3300026118 Ga0207675_100642932 Ga0207675_1006429321 85
202 3300026118 Ga0207675_100943984 Ga0207675_1009439842 85
203 3300026121 Ga0207683_10057110 Ga0207683_100571102 85
204 3300026142 Ga0207698_10286644 Ga0207698_102866441 85
205 3300026142 Ga0207698_12755522 Ga0207698_127555221 85
206 3300028379 Ga0268266_10030201 Ga0268266_100302013 85
207 3300028381 Ga0268264_10001658 Ga0268264_1000165811 85
208 3300028381 Ga0268264_10295691 Ga0268264_102956912 85
209 3300028381 Ga0268264_10784650 Ga0268264_107846502 85
210 3300035083 Ga0373926_0082457 Ga0373926_0082457_368_628 85
211 3300035083 Ga0373926_0087500 Ga0373926_0087500_234_494 85
212 3300035084 Ga0373928_0110823 Ga0373928_0110823_139_399 85
213 3300035086 Ga0373934_0001393 Ga0373934_0001393_6431_6691 85
214 3300035111 Ga0373923_0000210 Ga0373923_0000210_5129_5389 85
215 3300035113 Ga0373936_0058841 Ga0373936_0058841_1079_1339 85
216 3300035113 Ga0373936_0095399 Ga0373936_0095399_547_807 85
217 3300035116 Ga0373945_0008878 Ga0373945_0008878_2973_3233 85
218 3300035116 Ga0373945_0059727 Ga0373945_0059727_378_638 85
219 3300035117 Ga0373953_0002347 Ga0373953_0002347_4303_4563 85
220 3300035118 Ga0373954_0002454 Ga0373954_0002454_4223_4483 85
221 3300035119 Ga0373956_0000920 Ga0373956_0000920_5288_5548 85
222 3300035120 Ga0373957_0016546 Ga0373957_0016546_1436_1696 85
223 3300035170 Ga0373943_0011339 Ga0373943_0011339_3532_3792 85
224 3300035170 Ga0373943_0052707 Ga0373943_0052707_800_1060 85
225 3300035170 Ga0373943_0102812 Ga0373943_0102812_726_986 85
226 3300035170 Ga0373943_0363563 Ga0373943_0363563_367_627 85
227 3300035171 Ga0373946_0142663 Ga0373946_0142663_139_399 85
228 3300035171 Ga0373946_0172238 Ga0373946_0172238_155_415 85
229 3300035171 Ga0373946_0176720 Ga0373946_0176720_318_578 85
230 3300035172 Ga0373955_0001397 Ga0373955_0001397_4616_4876 85
231 3300035410 Ga0373924_0042119 Ga0373924_0042119_928_1188 85
232 3300035691 Ga0373931_0146510 Ga0373931_0146510_895_1155 85
233 3300035692 Ga0373935_0047165 Ga0373935_0047165_2051_2311 85
234 3300035692 Ga0373935_0149787 Ga0373935_0149787_1183_1443 85
235 3300035692 Ga0373935_0892106 Ga0373935_0892106_141_401 85
236 3300035695 Ga0373927_0049957 Ga0373927_0049957_104_364 85
237 3300035695 Ga0373927_0058660 Ga0373927_0058660_1437_1697 85
238 3300035724 Ga0373933_0051983 Ga0373933_0051983_2053_2313 85
239 3300035724 Ga0373933_0057006 Ga0373933_0057006_574_834 85
240 3300035724 Ga0373933_1069745 Ga0373933_1069745_216_476 85
241 3300035725 Ga0373947_0008022 Ga0373947_0008022_4722_4982 85
242 3300035725 Ga0373947_0026644 Ga0373947_0026644_1612_1872 85
243 3300035725 Ga0373947_0338964 Ga0373947_0338964_622_882 85
244 3300036401 Ga0373937_0006300 Ga0373937_0006300_3725_3985 85
245 3300036401 Ga0373937_0020390 Ga0373937_0020390_4262_4522 85
246 3300036401 Ga0373937_0786376 Ga0373937_0786376_508_768 85
247 3300037068 Ga0373925_0013479 Ga0373925_0013479_3329_3589 85
248 3300037068 Ga0373925_0413387 Ga0373925_0413387_244_504 85
249 3300037068 Ga0373925_0485605 Ga0373925_0485605_154_414 85
250 3300037068 Ga0373925_0525142 Ga0373925_0525142_225_485 85
251 3300041443 Ga0451789_0308947 Ga0451789_0308947_282_542 85
252 3300041460 Ga0451802_0959190 Ga0451802_0959190_359_619 85
253 3300041486 Ga0451807_0192404 Ga0451807_0192404_733_993 85
254 3300041496 Ga0451839_0292333 Ga0451839_0292333_529_789 85
255 3300041501 Ga0451845_0926531 Ga0451845_0926531_259_519 85
256 3300041512 Ga0451853_1607039 Ga0451853_1607039_310_576 85
257 3300041512 Ga0451853_3736650 Ga0451853_3736650_1628_1888 85
258 3300046455 Ga0495603_0501779 Ga0495603_0501779_24_284 85
259 3300046455 Ga0495603_0516385 Ga0495603_0516385_39_299 85
260 3300046459 Ga0495629_0743771 Ga0495629_0743771_310_570 85
261 3300046461 Ga0495641_0554179 Ga0495641_0554179_173_433 85
262 3300046463 Ga0495653_0151317 Ga0495653_0151317_1152_1412 85
263 3300046463 Ga0495653_0915140 Ga0495653_0915140_91_351 85
264 3300046472 Ga0495580_0009062 Ga0495580_0009062_4876_5136 85
265 3300046472 Ga0495580_0313645 Ga0495580_0313645_401_661 85
266 3300046473 Ga0495582_0016415 Ga0495582_0016415_2515_2775 85
267 3300046475 Ga0495639_0162430 Ga0495639_0162430_342_602 85
268 3300046476 Ga0495662_0026964 Ga0495662_0026964_2485_2745 85
269 3300046476 Ga0495662_0052425 Ga0495662_0052425_832_1098 85
270 3300046477 Ga0495664_0214451 Ga0495664_0214451_91_351 85
271 3300046491 Ga0495584_0447398 Ga0495584_0447398_229_489 85
272 3300046499 Ga0495594_0130684 Ga0495594_0130684_989_1249 85
273 3300046511 Ga0495608_0181078 Ga0495608_0181078_582_842 85
274 3300046514 Ga0495618_0174696 Ga0495618_0174696_177_443 85
275 3300046516 Ga0495628_0331300 Ga0495628_0331300_93_353 85
276 3300046517 Ga0495630_0058441 Ga0495630_0058441_2073_2339 85
277 3300046517 Ga0495630_0069934 Ga0495630_0069934_763_1023 85
278 3300046517 Ga0495630_0096911 Ga0495630_0096911_262_522 85
279 3300046525 Ga0495663_0243332 Ga0495663_0243332_86_346 85
280 3300046526 Ga0495666_0046885 Ga0495666_0046885_185_445 85
281 3300046526 Ga0495666_0078305 Ga0495666_0078305_764_1024 85
282 3300046526 Ga0495666_0111746 Ga0495666_0111746_53_319 85
283 3300046529 Ga0495652_0249852 Ga0495652_0249852_674_934 85
284 3300046531 Ga0495665_0055603 Ga0495665_0055603_1371_1631 85
285 3300046533 Ga0495640_0199395 Ga0495640_0199395_586_846 85
286 3300046533 Ga0495640_0746924 Ga0495640_0746924_23_289 85
287 3300046535 Ga0495586_0174591 Ga0495586_0174591_152_418 85
288 3300046539 Ga0495621_0004073 Ga0495621_0004073_2247_2507 85
289 3300046543 Ga0495645_0126038 Ga0495645_0126038_1488_1748 85
290 3300046543 Ga0495645_0471200 Ga0495645_0471200_139_399 85
291 3300046559 Ga0495667_0112656 Ga0495667_0112656_608_868 85
292 3300046642 Ga0495634_0006196 Ga0495634_0006196_8772_9038 85
293 3300046642 Ga0495634_0276294 Ga0495634_0276294_713_973 85
294 3300046663 Ga0495635_0013358 Ga0495635_0013358_5328_5588 85
295 3300046663 Ga0495635_0168269 Ga0495635_0168269_145_405 85
296 3300046664 Ga0495659_0025567 Ga0495659_0025567_154_414 85
297 3300046674 Ga0495588_0041659 Ga0495588_0041659_137_397 85
298 3300046675 Ga0495657_0489922 Ga0495657_0489922_26_286 85
299 3300046678 Ga0495599_0268763 Ga0495599_0268763_141_401 85
300 3300046679 Ga0495623_0008420 Ga0495623_0008420_357_617 85
301 3300046680 Ga0495646_0592170 Ga0495646_0592170_97_357 85
302 3300046681 Ga0495647_0002734 Ga0495647_0002734_2644_2904 85
303 3300046681 Ga0495647_0308056 Ga0495647_0308056_140_400 85
304 3300046681 Ga0495647_0389427 Ga0495647_0389427_262_522 85
305 3300046683 Ga0495658_0012093 Ga0495658_0012093_2441_2701 85
306 3300046689 Ga0495613_0004932 Ga0495613_0004932_4271_4531 85
307 3300046689 Ga0495613_0009140 Ga0495613_0009140_5571_5837 85
308 3300046690 Ga0495624_0283143 Ga0495624_0283143_541_801 85
309 3300047315 Ga0495581_0000879 Ga0495581_0000879_10731_10991 85
310 3300047315 Ga0495581_0569471 Ga0495581_0569471_190_456 85
311 3300047317 Ga0495604_0102756 Ga0495604_0102756_1014_1274 85
312 3300047319 Ga0495674_0329633 Ga0495674_0329633_140_400 85
313 3300047319 Ga0495674_0906711 Ga0495674_0906711_292_552 85
314 3300047321 Ga0495676_0563556 Ga0495676_0563556_14_280 85
315 3300047321 Ga0495676_1085712 Ga0495676_1085712_191_451 85
316 3300047322 Ga0495680_0018982 Ga0495680_0018982_858_1118 85
317 3300047322 Ga0495680_0721395 Ga0495680_0721395_209_469 85
318 3300047444 Ga0495675_0246810 Ga0495675_0246810_376_636 85
319 3300047471 Ga0495684_0009051 Ga0495684_0009051_3829_4089 85
320 3300047471 Ga0495684_0370270 Ga0495684_0370270_325_585 85
321 3300047673 Ga0495593_0172782 Ga0495593_0172782_32_292 85
322 3300048089 Ga0495614_0054877 Ga0495614_0054877_1425_1685 85
323 3300048903 Ga0496100_0101876 Ga0496100_0101876_1548_1808 85
324 3300048904 Ga0496101_1155165 Ga0496101_1155165_175_435 85
325 3300048907 Ga0496104_0003090 Ga0496104_0003090_11593_11853 85
326 3300048908 Ga0496105_0008052 Ga0496105_0008052_4146_4406 85
327 3300048908 Ga0496105_0602059 Ga0496105_0602059_376_636 85
328 3300048910 Ga0496107_0029893 Ga0496107_0029893_583_843 85
329 3300048911 Ga0496108_0015347 Ga0496108_0015347_1725_1985 85
330 3300048911 Ga0496108_0016049 Ga0496108_0016049_2690_2950 85
331 3300048912 Ga0496109_0014974 Ga0496109_0014974_6037_6297 85
332 3300048912 Ga0496109_0031869 Ga0496109_0031869_2111_2371 85
333 3300048913 Ga0496110_0073594 Ga0496110_0073594_202_462 85
334 3300048913 Ga0496110_0363128 Ga0496110_0363128_750_1010 85
335 3300048914 Ga0496111_0076466 Ga0496111_0076466_1874_2134 85
336 3300048915 Ga0496112_0005494 Ga0496112_0005494_2676_2936 85
337 3300048915 Ga0496112_0019235 Ga0496112_0019235_456_716 85
338 3300048915 Ga0496112_1452597 Ga0496112_1452597_214_474 85
339 3300048916 Ga0496113_0401120 Ga0496113_0401120_289_549 85
340 3300048917 Ga0496114_0013724 Ga0496114_0013724_2373_2633 85
341 3300048917 Ga0496114_0407185 Ga0496114_0407185_705_965 85
342 3300048918 Ga0496115_0373431 Ga0496115_0373431_659_919 85
343 3300049568 Ga0501031_0050411 Ga0501031_0050411_314_574 85
344 3300049570 Ga0501033_0014998 Ga0501033_0014998_3896_4156 85
345 3300049571 Ga0501034_1060006 Ga0501034_1060006_24_284 85
346 3300049572 Ga0501036_0085493 Ga0501036_0085493_659_919 85
347 3300049574 Ga0501038_0031685 Ga0501038_0031685_1245_1505 85
348 3300049575 Ga0501039_0480789 Ga0501039_0480789_679_939 85
349 3300049576 Ga0501040_0079685 Ga0501040_0079685_1293_1553 85
350 3300049577 Ga0501041_0002085 Ga0501041_0002085_521_781 85
351 3300049578 Ga0501042_0004777 Ga0501042_0004777_931_1191 85
352 3300049580 Ga0501046_0024882 Ga0501046_0024882_1019_1279 85
353 3300049584 Ga0501068_0007079 Ga0501068_0007079_609_869 85
354 3300049586 Ga0501070_0348556 Ga0501070_0348556_847_1107 85
355 3300049587 Ga0501071_0028308 Ga0501071_0028308_1423_1683 85
356 3300049587 Ga0501071_1482828 Ga0501071_1482828_14_274 85
357 3300049588 Ga0501072_0206376 Ga0501072_0206376_901_1161 85
358 3300049588 Ga0501072_1519070 Ga0501072_1519070_31_291 85
359 3300049589 Ga0501073_0437155 Ga0501073_0437155_465_725 85
360 3300049590 Ga0501074_0752737 Ga0501074_0752737_379_639 85
361 3300049591 Ga0501075_0030036 Ga0501075_0030036_610_870 85
362 3300049592 Ga0501076_0135072 Ga0501076_0135072_568_828 85
363 3300049593 Ga0501077_0004246 Ga0501077_0004246_458_718 85
364 3300049741 Ga0501079_0004267 Ga0501079_0004267_1324_1584 85
365 3300049743 Ga0501081_0031968 Ga0501081_0031968_2039_2299 85
366 3300049822 Ga0501035_0149732 Ga0501035_0149732_518_778 85
367 3300049824 Ga0501045_0045517 Ga0501045_0045517_916_1176 85
368 3300050494 nmdc:mga06z11_233389_c1 nmdc:mga06z11_233389_c1_460_720 85
369 3300050512 nmdc:mga0n895_634780_c1 nmdc:mga0n895_634780_c1_753_1013 85
370 3300050512 nmdc:mga0n895_77090_c1 nmdc:mga0n895_77090_c1_29_289 85
371 3300050513 nmdc:mga0rr50_284254_c1 nmdc:mga0rr50_284254_c1_101_361 85
372 3300050513 nmdc:mga0rr50_413698_c1 nmdc:mga0rr50_413698_c1_790_1050 85
373 3300050513 nmdc:mga0rr50_804432_c1 nmdc:mga0rr50_804432_c1_364_624 85
374 3300050514 nmdc:mga08x19_238877_c1 nmdc:mga08x19_238877_c1_161_421 85
375 3300053077 Ga0495601_0123483 Ga0495601_0123483_1260_1520 85
376 3300053078 Ga0495612_0019390 Ga0495612_0019390_2231_2491 85
377 3300053078 Ga0495612_0085565 Ga0495612_0085565_26_286 85
378 3300053085 Ga0495619_0004675 Ga0495619_0004675_3143_3403 85
379 3300053085 Ga0495619_0122294 Ga0495619_0122294_643_903 85
380 3300053094 Ga0500566_0176463 Ga0500566_0176463_818_1084 85
381 3300054114 Ga0501084_1051638 Ga0501084_1051638_322_582 85
382 3300060353 Ga0501082_0015246 Ga0501082_0015246_1900_2160 85
383 3300061734 Ga0530510_0047448 Ga0530510_0047448_2242_2502 85
384 3300005336 Ga0070680_100219841 Ga0070680_1002198412 86
385 3300005336 Ga0070680_101035800 Ga0070680_1010358001 86
386 3300005336 Ga0070680_101525829 Ga0070680_1015258292 86
387 3300005458 Ga0070681_10040567 Ga0070681_100405673 86
388 3300005530 Ga0070679_100492662 Ga0070679_1004926621 86
389 3300005539 Ga0068853_100846628 Ga0068853_1008466282 86
390 3300005539 Ga0068853_102225262 Ga0068853_1022252622 86
391 3300005548 Ga0070665_100108181 Ga0070665_1001081813 86
392 3300005548 Ga0070665_101852402 Ga0070665_1018524022 86
393 3300005563 Ga0068855_100011712 Ga0068855_1000117125 86
394 3300005563 Ga0068855_100311371 Ga0068855_1003113713 86
395 3300006353 Ga0075370_10333530 Ga0075370_103335302 86
396 3300006881 Ga0068865_100052968 Ga0068865_1000529683 86
397 3300009093 Ga0105240_10068859 Ga0105240_100688592 86
398 3300009093 Ga0105240_11580880 Ga0105240_115808802 86
399 3300013104 Ga0157370_10892880 Ga0157370_108928802 86
400 3300013104 Ga0157370_11060560 Ga0157370_110605602 86
401 3300013307 Ga0157372_10272235 Ga0157372_102722352 86
402 3300025261 Ga0209233_1000982 Ga0209233_10009824 86
403 3300025903 Ga0207680_10698613 Ga0207680_106986131 86
404 3300025909 Ga0207705_10280530 Ga0207705_102805302 86
405 3300025913 Ga0207695_10028065 Ga0207695_100280655 86
406 3300025917 Ga0207660_10009355 Ga0207660_100093554 86
407 3300025917 Ga0207660_11637369 Ga0207660_116373691 86
408 3300025938 Ga0207704_10101851 Ga0207704_101018512 86
409 3300025949 Ga0207667_10261359 Ga0207667_102613591 86
410 3300025949 Ga0207667_10377571 Ga0207667_103775712 86
411 3300025981 Ga0207640_10244693 Ga0207640_102446932 86
412 3300026041 Ga0207639_10696449 Ga0207639_106964492 86
413 3300028379 Ga0268266_10079518 Ga0268266_100795183 86
414 3300028379 Ga0268266_11410160 Ga0268266_114101601 86
415 3300028800 Ga0265338_10620265 Ga0265338_106202652 86
416 3300037312 Ga0395899_0329570 Ga0395899_0329570_695_958 86
417 3300037418 Ga0395900_0015810 Ga0395900_0015810_7299_7562 86
418 3300037466 Ga0395898_1644118 Ga0395898_1644118_241_504 86
419 3300037471 Ga0395905_0046098 Ga0395905_0046098_2675_2938 86
420 3300037471 Ga0395905_0089718 Ga0395905_0089718_1132_1395 86
421 3300037471 Ga0395905_0105647 Ga0395905_0105647_892_1155 86
422 3300037471 Ga0395905_0194838 Ga0395905_0194838_1505_1768 86
423 3300037471 Ga0395905_0840130 Ga0395905_0840130_94_357 86
424 3300037471 Ga0395905_1800288 Ga0395905_1800288_10_273 86
425 3300050516 nmdc:mga0sz30_454479_c1 nmdc:mga0sz30_454479_c1_114_377 86
426 3300005467 Ga0070706_101006648 Ga0070706_1010066482 87
427 3300006173 Ga0070716_100206575 Ga0070716_1002065752 87
428 3300007788 Ga0099795_10010136 Ga0099795_100101363 87
429 3300010159 Ga0099796_10004216 Ga0099796_100042165 87
430 3300021377 Ga0213874_10188094 Ga0213874_101880942 87
431 3300021441 Ga0213871_10053114 Ga0213871_100531142 87
432 3300025910 Ga0207684_10805790 Ga0207684_108057902 87
433 3300025939 Ga0207665_10320237 Ga0207665_103202372 87
434 3300039438 Ga0436360_0059423 Ga0436360_0059423_57_320 87
435 3300039438 Ga0436360_0743645 Ga0436360_0743645_1314_1580 87
436 3300039447 Ga0436361_1196724 Ga0436361_1196724_61_327 87
437 3300039450 Ga0436363_1119547 Ga0436363_1119547_4579_4845 87
438 3300039453 Ga0436362_1045778 Ga0436362_1045778_848_1114 87
439 3300039453 Ga0436362_1242066 Ga0436362_1242066_59_322 87
440 3300044712 Ga0453684_0042938 Ga0453684_0042938_2426_2692 87
441 3300005329 Ga0070683_100131565 Ga0070683_1001315653 88
442 3300005331 Ga0070670_100544817 Ga0070670_1005448172 88
443 3300005338 Ga0068868_101163032 Ga0068868_1011630322 88
444 3300005339 Ga0070660_100030160 Ga0070660_1000301602 88
445 3300005339 Ga0070660_100528736 Ga0070660_1005287362 88
446 3300005344 Ga0070661_100844017 Ga0070661_1008440172 88
447 3300005354 Ga0070675_100069340 Ga0070675_1000693401 88
448 3300005366 Ga0070659_101149173 Ga0070659_1011491731 88
449 3300005367 Ga0070667_100293427 Ga0070667_1002934272 88
450 3300005455 Ga0070663_101303313 Ga0070663_1013033131 88
451 3300005457 Ga0070662_100174522 Ga0070662_1001745222 88
452 3300005539 Ga0068853_100587707 Ga0068853_1005877072 88
453 3300005564 Ga0070664_100129014 Ga0070664_1001290142 88
454 3300005616 Ga0068852_101346602 Ga0068852_1013466022 88
455 3300005834 Ga0068851_10378607 Ga0068851_103786072 88
456 3300009177 Ga0105248_11846167 Ga0105248_118461672 88
457 3300013105 Ga0157369_10503917 Ga0157369_105039173 88
458 3300025909 Ga0207705_10214232 Ga0207705_102142323 88
459 3300025925 Ga0207650_10701094 Ga0207650_107010942 88
460 3300025931 Ga0207644_11745097 Ga0207644_117450971 88
461 3300025933 Ga0207706_10265452 Ga0207706_102654522 88
462 3300025940 Ga0207691_10111054 Ga0207691_101110542 88
463 3300025944 Ga0207661_10104077 Ga0207661_101040772 88
464 3300025945 Ga0207679_10229208 Ga0207679_102292082 88
465 3300025981 Ga0207640_10454767 Ga0207640_104547672 88
466 3300025986 Ga0207658_10497122 Ga0207658_104971222 88
467 3300026067 Ga0207678_10098059 Ga0207678_100980592 88
468 3300026089 Ga0207648_10571307 Ga0207648_105713072 88
469 3300026121 Ga0207683_10615711 Ga0207683_106157112 88
470 3300026142 Ga0207698_12351197 Ga0207698_123511971 88
471 3300031995 Ga0307409_100793046 Ga0307409_1007930462 88
472 3300032126 Ga0307415_100224693 Ga0307415_1002246932 88
473 3300035691 Ga0373931_0307897 Ga0373931_0307897_400_717 88
474 3300048912 Ga0496109_0399314 Ga0496109_0399314_165_482 88
475 3300003214 JGI25165J46597_1000036 JGI25165J46597_1000036257 89
476 3300025261 Ga0209233_1000015 Ga0209233_10000151034 89
477 3300046463 Ga0495653_0189315 Ga0495653_0189315_470_748 89
478 3300049578 Ga0501042_0580053 Ga0501042_0580053_241_558 89
479 3300049587 Ga0501071_0826234 Ga0501071_0826234_278_595 89
480 3300049588 Ga0501072_1112070 Ga0501072_1112070_192_509 89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9397 5 86
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9223 5 89
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8483 3 86
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.8476 6 84
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8279 3 89
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9223 5 89 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8483 3 86 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8476 6 84 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8245 1 89 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8163 1 89 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2E0UYM1-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.973 6 89
AF-A0A521WBJ4-F1-model_v4 MoaD/ThiS family protein 0.9697 6 89
AF-A0A1E4QTN8-F1-model_v4 deleted 0.9675 6 89
AF-A0A1Q7B304-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9673 5 85
AF-A0A3N5KSZ2-F1-model_v4 MoaD/ThiS family protein 0.9653 6 89

Feature Viewer

pLDDT pTM Quality
92.74 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map