F452161

General Info

Members Datasets Scaffolds Average Seq Length
480 274 480 116

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_101082867|Ga0070690_1010828672
Length 122
Sequence MSKIAQARRNGRIRRHRRVRKKIHGTALRPRLAVFRSNKHLSVQLIDDDAGNTLAAASTNEADLRAAGSGASVEAATRVGTLIAERAKAAGIDKVVFDRGGFAYHGRIAAVATAAREAGLEF

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
103 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
104 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
123 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
124 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
149 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
150 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
151 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
152 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
158 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
161 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
162 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
163 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
164 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
165 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
166 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
167 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
168 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
169 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
170 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
175 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
179 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
180 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
181 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
271 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 2.5
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_101082867 3300005330 Bacteria 635
2 Ga0070677_10017280 3300005333 Bacteria 2581
3 Ga0068869_100737229 3300005334 Bacteria 843
4 Ga0068869_101346307 3300005334 Bacteria 631
5 Ga0070680_101140876 3300005336 Bacteria 674
6 Ga0070687_100516491 3300005343 Bacteria 807
7 Ga0070661_101729381 3300005344 Bacteria 530
8 Ga0070668_100034448 3300005347 Bacteria 3858
9 Ga0070671_102090375 3300005355 Bacteria 504
10 Ga0070688_100029257 3300005365 Bacteria 3298
11 Ga0070659_100522188 3300005366 Bacteria 1014
12 Ga0070713_100297697 3300005436 Bacteria 1485
13 Ga0070701_10727758 3300005438 Bacteria 670
14 Ga0070705_101482941 3300005440 Bacteria 568
15 Ga0070700_100303158 3300005441 Bacteria 1167
16 Ga0070700_101675170 3300005441 Bacteria 545
17 Ga0070708_100054472 3300005445 Bacteria 3552
18 Ga0070708_100227087 3300005445 Bacteria 1752
19 Ga0070678_100158897 3300005456 Bacteria 1829
20 Ga0070662_100050032 3300005457 Bacteria 3014
21 Ga0068867_100272727 3300005459 Bacteria 1384
22 Ga0070685_10072811 3300005466 Bacteria 2041
23 Ga0070685_11264548 3300005466 Bacteria 563
24 Ga0070706_100075943 3300005467 Bacteria 3110
25 Ga0070706_100434539 3300005467 Bacteria 1222
26 Ga0070706_100508198 3300005467 Bacteria 1121
27 Ga0070706_100779249 3300005467 Bacteria 886
28 Ga0070706_101896081 3300005467 Bacteria 541
29 Ga0070707_100134447 3300005468 Bacteria 2405
30 Ga0070707_100338225 3300005468 Bacteria 1462
31 Ga0070698_100045833 3300005471 Bacteria 4474
32 Ga0070698_100801926 3300005471 Bacteria 886
33 Ga0070698_100946516 3300005471 Bacteria 808
34 Ga0070699_100059059 3300005518 Bacteria 3323
35 Ga0070699_100069820 3300005518 Bacteria 3053
36 Ga0070699_100729757 3300005518 Bacteria 906
37 Ga0070697_100325162 3300005536 Bacteria 1325
38 Ga0070672_101092814 3300005543 Bacteria 708
39 Ga0070695_100099797 3300005545 Bacteria 1953
40 Ga0070695_100958125 3300005545 Bacteria 694
41 Ga0070696_101740019 3300005546 Bacteria 538
42 Ga0070704_100383889 3300005549 Bacteria 1194
43 Ga0070704_100663381 3300005549 Bacteria 922
44 Ga0068857_102382810 3300005577 Bacteria 520
45 Ga0068854_101858767 3300005578 Bacteria 553
46 Ga0070702_100052749 3300005615 Bacteria 2333
47 Ga0068864_100177022 3300005618 Bacteria 1948
48 Ga0068864_100657747 3300005618 Bacteria 1021
49 Ga0068866_10387398 3300005718 Bacteria 898
50 Ga0068861_100019757 3300005719 Bacteria 4814
51 Ga0068861_100138719 3300005719 Bacteria 1982
52 Ga0068870_10520622 3300005840 Bacteria 796
53 Ga0068863_100678709 3300005841 Bacteria 1023
54 Ga0068863_100770082 3300005841 Bacteria 959
55 Ga0068860_100858074 3300005843 Bacteria 923
56 Ga0081455_10010736 3300005937 Bacteria 9264
57 Ga0081455_10461515 3300005937 Bacteria 865
58 Ga0081538_10021744 3300005981 Bacteria 4669
59 Ga0081538_10029009 3300005981 Bacteria 3791
60 Ga0081538_10142268 3300005981 Bacteria 1103
61 Ga0081540_1012620 3300005983 Bacteria 5544
62 Ga0081539_10053292 3300005985 Bacteria 2266
63 Ga0075365_10362620 3300006038 Bacteria 1022
64 Ga0075363_100876507 3300006048 Bacteria 549
65 Ga0075367_10920435 3300006178 Bacteria 558
66 Ga0097621_100727750 3300006237 Bacteria 915
67 Ga0068871_100603842 3300006358 Bacteria 998
68 Ga0075428_100034071 3300006844 Bacteria 5618
69 Ga0075428_100176389 3300006844 Bacteria 2314
70 Ga0075430_100118912 3300006846 Bacteria 2203
71 Ga0075430_100304416 3300006846 Bacteria 1318
72 Ga0075431_100112956 3300006847 Bacteria 2804
73 Ga0075431_100116745 3300006847 Bacteria 2754
74 Ga0075431_100371791 3300006847 Bacteria 1434
75 Ga0075433_10002059 3300006852 Bacteria 15203
76 Ga0075434_100004000 3300006871 Bacteria 13201
77 Ga0075429_100035358 3300006880 Bacteria 4345
78 Ga0075429_100405807 3300006880 Bacteria 1193
79 Ga0068865_100122924 3300006881 Bacteria 1933
80 Ga0075436_100325750 3300006914 Bacteria 1104
81 Ga0075435_100050728 3300007076 Bacteria 3340
82 Ga0075435_100419305 3300007076 Bacteria 1153
83 Ga0105245_11453637 3300009098 Bacteria 736
84 Ga0105245_12325046 3300009098 Bacteria 590
85 Ga0114129_10045478 3300009147 Bacteria 6171
86 Ga0114129_10311248 3300009147 Bacteria 2096
87 Ga0114129_11844951 3300009147 Bacteria 734
88 Ga0114129_12977809 3300009147 Bacteria 558
89 Ga0105243_10006064 3300009148 Bacteria 9346
90 Ga0105243_11211826 3300009148 Bacteria 768
91 Ga0105242_11532771 3300009176 Bacteria 698
92 Ga0105248_10124853 3300009177 Bacteria 2903
93 Ga0105248_10890587 3300009177 Bacteria 1005
94 Ga0105249_10014593 3300009553 Bacteria 6944
95 Ga0105249_10031383 3300009553 Bacteria 4805
96 Ga0105249_11234776 3300009553 Bacteria 819
97 Ga0099796_10292553 3300010159 Bacteria 688
98 Ga0157378_12011306 3300013297 Bacteria 628
99 Ga0163162_10111590 3300013306 Bacteria 2832
100 Ga0163162_11715724 3300013306 Bacteria 717
101 Ga0157375_10008438 3300013308 Bacteria 9023
102 Ga0163163_10031271 3300014325 Bacteria 5137
103 Ga0157380_11050344 3300014326 Bacteria 851
104 Ga0157380_11880069 3300014326 Bacteria 659
105 Ga0157379_10473983 3300014968 Bacteria 1158
106 Ga0157376_12736581 3300014969 Bacteria 533
107 Ga0182005_1212835 3300015265 Bacteria 585
108 Ga0163161_10016026 3300017792 Bacteria 5231
109 Ga0163161_10126258 3300017792 Bacteria 1926
110 Ga0197907_11474341 3300020069 Bacteria 909
111 Ga0206356_10409578 3300020070 Bacteria 680
112 Ga0213876_10003226 3300021384 Bacteria 9358
113 Ga0207642_10440016 3300025899 Bacteria 788
114 Ga0207685_10798612 3300025905 Bacteria 520
115 Ga0207643_10280921 3300025908 Bacteria 1032
116 Ga0207684_10067749 3300025910 Bacteria 3033
117 Ga0207684_10161879 3300025910 Bacteria 1927
118 Ga0207662_10317457 3300025918 Bacteria 1039
119 Ga0207646_10133546 3300025922 Bacteria 2234
120 Ga0207646_10253092 3300025922 Bacteria 1591
121 Ga0207646_10598774 3300025922 Bacteria 990
122 Ga0207681_10441993 3300025923 Bacteria 1057
123 Ga0207650_10084041 3300025925 Bacteria 2419
124 Ga0207644_10524528 3300025931 Bacteria 979
125 Ga0207690_11131867 3300025932 Bacteria 653
126 Ga0207706_10004872 3300025933 Bacteria 12567
127 Ga0207709_10091647 3300025935 Bacteria 1988
128 Ga0207669_10485277 3300025937 Bacteria 986
129 Ga0207704_10781118 3300025938 Bacteria 796
130 Ga0207691_10007702 3300025940 Bacteria 10364
131 Ga0207712_10013482 3300025961 Bacteria 5242
132 Ga0207712_10087345 3300025961 Bacteria 2287
133 Ga0207668_11193634 3300025972 Bacteria 684
134 Ga0207640_10317468 3300025981 Bacteria 1239
135 Ga0207658_11570931 3300025986 Bacteria 602
136 Ga0207658_11637665 3300025986 Bacteria 588
137 Ga0207639_10688228 3300026041 Bacteria 948
138 Ga0207708_10257890 3300026075 Bacteria 1407
139 Ga0207641_10566931 3300026088 Bacteria 1109
140 Ga0207648_10071203 3300026089 Bacteria 3030
141 Ga0207676_10203669 3300026095 Bacteria 1750
142 Ga0207676_10384930 3300026095 Bacteria 1307
143 Ga0207675_100005964 3300026118 Bacteria 11609
144 Ga0207675_100018499 3300026118 Bacteria 6498
145 Ga0268265_10247143 3300028380 Bacteria 1578
146 Ga0268264_10934912 3300028381 Bacteria 872
147 Ga0316176_1183772 3300030732 Bacteria 778
148 Ga0314311_1041759 3300030733 Bacteria 643
149 Ga0316179_1118811 3300030734 Bacteria 1212
150 Ga0307408_100023235 3300031548 Bacteria 4221
151 Ga0307408_100293637 3300031548 Bacteria 1358
152 Ga0307408_102254499 3300031548 Bacteria 527
153 Ga0316575_10023255 3300031665 Bacteria 2395
154 Ga0316575_10187826 3300031665 Bacteria 859
155 Ga0316575_10278568 3300031665 Bacteria 705
156 Ga0316579_10044489 3300031691 Bacteria 2068
157 Ga0316579_10053468 3300031691 Bacteria 1892
158 Ga0316579_10065250 3300031691 Bacteria 1718
159 Ga0316579_10115095 3300031691 Bacteria 1291
160 Ga0316576_10000459 3300031727 Bacteria 19104
161 Ga0316576_10037669 3300031727 Bacteria 3463
162 Ga0316576_10208461 3300031727 Bacteria 1471
163 Ga0316576_10456889 3300031727 Bacteria 943
164 Ga0316576_10539661 3300031727 Bacteria 855
165 Ga0316578_10000790 3300031728 Bacteria 11689
166 Ga0316578_10004574 3300031728 Bacteria 6556
167 Ga0316578_10007920 3300031728 Bacteria 5368
168 Ga0316578_10036090 3300031728 Bacteria 2845
169 Ga0307405_10200923 3300031731 Bacteria 1447
170 Ga0307405_10229101 3300031731 Bacteria 1368
171 Ga0307405_11197782 3300031731 Bacteria 657
172 Ga0316577_10050872 3300031733 Bacteria 2313
173 Ga0316577_10066828 3300031733 Bacteria 2007
174 Ga0307413_10121666 3300031824 Bacteria 1769
175 Ga0307413_10239181 3300031824 Bacteria 1339
176 Ga0307413_10705886 3300031824 Bacteria 838
177 Ga0307410_10022122 3300031852 Bacteria 3924
178 Ga0307410_10038255 3300031852 Bacteria 3141
179 Ga0307410_10126792 3300031852 Bacteria 1869
180 Ga0307410_10429220 3300031852 Bacteria 1074
181 Ga0307410_11805843 3300031852 Bacteria 543
182 Ga0307406_10017666 3300031901 Bacteria 4156
183 Ga0307406_10099325 3300031901 Bacteria 1978
184 Ga0307406_10403728 3300031901 Bacteria 1084
185 Ga0307406_10825145 3300031901 Bacteria 784
186 Ga0307407_10013620 3300031903 Bacteria 3954
187 Ga0307407_10238807 3300031903 Bacteria 1238
188 Ga0307407_10436206 3300031903 Bacteria 947
189 Ga0307412_10082457 3300031911 Bacteria 2227
190 Ga0307412_10710869 3300031911 Bacteria 863
191 Ga0307409_100041374 3300031995 Bacteria 3441
192 Ga0307409_100042742 3300031995 Bacteria 3396
193 Ga0307409_100052343 3300031995 Bacteria 3129
194 Ga0307409_100097825 3300031995 Bacteria 2425
195 Ga0307409_100122345 3300031995 Bacteria 2206
196 Ga0307409_100199032 3300031995 Bacteria 1790
197 Ga0307409_101397326 3300031995 Bacteria 726
198 Ga0307409_101591409 3300031995 Bacteria 681
199 Ga0307416_100026709 3300032002 Bacteria 4259
200 Ga0307416_100167903 3300032002 Bacteria 2038
201 Ga0307416_100308939 3300032002 Bacteria 1576
202 Ga0307416_100410066 3300032002 Bacteria 1395
203 Ga0307416_100818162 3300032002 Bacteria 1028
204 Ga0307416_100886629 3300032002 Bacteria 991
205 Ga0307416_101866300 3300032002 Bacteria 704
206 Ga0307416_103687541 3300032002 Bacteria 513
207 Ga0307414_10199720 3300032004 Bacteria 1625
208 Ga0307414_10219239 3300032004 Bacteria 1561
209 Ga0307414_10577955 3300032004 Bacteria 1005
210 Ga0307414_11257542 3300032004 Bacteria 686
211 Ga0307411_10560161 3300032005 Bacteria 976
212 Ga0307411_10710532 3300032005 Bacteria 876
213 Ga0307415_100008299 3300032126 Bacteria 5750
214 Ga0307415_100033010 3300032126 Bacteria 3356
215 Ga0307415_100071121 3300032126 Bacteria 2445
216 Ga0307415_100140343 3300032126 Bacteria 1844
217 Ga0307415_100278774 3300032126 Bacteria 1373
218 Ga0307415_101668591 3300032126 Bacteria 614
219 Ga0316585_10224060 3300032137 Bacteria 622
220 Ga0316585_10231901 3300032137 Bacteria 611
221 Ga0316580_10007998 3300032139 Bacteria 3161
222 Ga0316593_10000037 3300032168 Bacteria 14308
223 Ga0316593_10004257 3300032168 Bacteria 3657
224 Ga0316593_10127041 3300032168 Bacteria 918
225 Ga0316596_1002269 3300033541 Bacteria 4079
226 Ga0316596_1005873 3300033541 Bacteria 2827
227 Ga0316596_1029284 3300033541 Bacteria 1425
228 Ga0373950_0009989 3300034818 Bacteria 1525
229 Ga0373944_0086488 3300035089 Bacteria 1043
230 Ga0373945_0106973 3300035116 Bacteria 1100
231 Ga0373943_0323572 3300035170 Bacteria 879
232 Ga0316574_0010480 3300035398 Bacteria 5242
233 Ga0316574_0029464 3300035398 Bacteria 3316
234 Ga0316574_0034363 3300035398 Bacteria 3091
235 Ga0316574_0089305 3300035398 Bacteria 1963
236 Ga0316574_0222491 3300035398 Bacteria 1209
237 Ga0316574_0330784 3300035398 Bacteria 966
238 Ga0316574_0343144 3300035398 Bacteria 946
239 Ga0316574_0390652 3300035398 Bacteria 877
240 Ga0316574_0743686 3300035398 Bacteria 599
241 Ga0373924_0173196 3300035410 Bacteria 949
242 Ga0373931_0591930 3300035691 Bacteria 724
243 Ga0373935_0459856 3300035692 Bacteria 920
244 Ga0373927_0202074 3300035695 Bacteria 1305
245 Ga0373947_0006076 3300035725 Bacteria 7037
246 Ga0373947_0541141 3300035725 Bacteria 792
247 Ga0316582_0068021 3300036647 Bacteria 2299
248 Ga0316582_0113115 3300036647 Bacteria 1809
249 Ga0316582_0789135 3300036647 Bacteria 651
250 Ga0316584_0004117 3300036712 Bacteria 9591
251 Ga0316584_0039289 3300036712 Bacteria 3523
252 Ga0316584_0117311 3300036712 Bacteria 1990
253 Ga0373925_0079947 3300037068 Bacteria 2485
254 Ga0373925_0806311 3300037068 Bacteria 774
255 Ga0395900_0048766 3300037418 Bacteria 4362
256 Ga0395898_0071157 3300037466 Bacteria 3361
257 Ga0395901_0390736 3300038443 Bacteria 1430
258 Ga0436365_0253748 3300039437 Bacteria 911
259 Ga0436365_1349538 3300039437 Bacteria 11547
260 Ga0436360_1189079 3300039438 Bacteria 525
261 Ga0436360_1245037 3300039438 Unclassified 763
262 Ga0439466_0096184 3300041411 Bacteria 926
263 Ga0439465_0255814 3300041413 Bacteria 648
264 Ga0451791_1338045 3300041451 Bacteria 1120
265 Ga0451793_1082305 3300041452 Bacteria 644
266 Ga0451797_0350092 3300041453 Bacteria 533
267 Ga0451804_0416655 3300041463 Bacteria 637
268 Ga0451837_0071548 3300041494 Bacteria 1420
269 Ga0451837_0714092 3300041494 Bacteria 1561
270 Ga0451851_0610797 3300041507 Bacteria 637
271 Ga0451843_1656561 3300041509 Bacteria 760
272 Ga0451853_0075311 3300041512 Bacteria 738
273 Ga0451853_0672581 3300041512 Bacteria 798
274 Ga0439433_0059314 3300041999 Bacteria 911
275 Ga0439443_068404 3300042003 Bacteria 645
276 Ga0439448_0002852 3300042005 Bacteria 4731
277 Ga0439448_0072461 3300042005 Bacteria 1148
278 Ga0439450_007161 3300042008 Bacteria 2034
279 Ga0439454_003312 3300042011 Bacteria 1782
280 Ga0439454_032330 3300042011 Bacteria 825
281 Ga0439455_0005315 3300042012 Bacteria 2608
282 Ga0439455_0110873 3300042012 Bacteria 763
283 Ga0439463_002436 3300042016 Bacteria 4738
284 Ga0439463_010766 3300042016 Bacteria 2248
285 Ga0450912_010597 3300042116 Bacteria 792
286 Ga0450914_031359 3300042118 Bacteria 641
287 Ga0450915_000551 3300042119 Bacteria 1418
288 Ga0450923_004570 3300042125 Bacteria 2178
289 Ga0450923_012341 3300042125 Bacteria 1554
290 Ga0450890_056119 3300042127 Bacteria 609
291 Ga0450891_009503 3300042129 Bacteria 896
292 Ga0450900_001003 3300042136 Bacteria 2570
293 Ga0450903_006071 3300042138 Bacteria 2016
294 Ga0450904_010170 3300042139 Bacteria 928
295 Ga0450905_078533 3300042142 Bacteria 571
296 Ga0439446_0269432 3300042156 Bacteria 591
297 Ga0450908_038975 3300042184 Bacteria 823
298 Ga0450908_070376 3300042184 Bacteria 621
299 Ga0439434_0005020 3300042435 Bacteria 3867
300 Ga0439434_0153997 3300042435 Bacteria 762
301 Ga0439444_0007487 3300042437 Bacteria 1678
302 Ga0439459_0042417 3300042438 Bacteria 972
303 Ga0439459_0074901 3300042438 Bacteria 789
304 Ga0439459_0132293 3300042438 Bacteria 638
305 Ga0439464_0047730 3300042439 Bacteria 1232
306 Ga0439464_0050295 3300042439 Bacteria 1203
307 Ga0439460_0007380 3300042461 Bacteria 2746
308 Ga0450916_001438 3300042530 Bacteria 2387
309 Ga0450893_0011831 3300042532 Bacteria 1445
310 Ga0450901_006505 3300042533 Bacteria 1202
311 Ga0439440_0002475 3300042993 Bacteria 3496
312 Ga0439440_0118580 3300042993 Bacteria 734
313 Ga0495603_0033810 3300046455 Bacteria 3076
314 Ga0495603_0059488 3300046455 Bacteria 2259
315 Ga0495603_0075258 3300046455 Bacteria 1982
316 Ga0495603_0084466 3300046455 Bacteria 1859
317 Ga0495603_0667915 3300046455 Bacteria 594
318 Ga0495629_0010441 3300046459 Bacteria 6755
319 Ga0495641_0218302 3300046461 Bacteria 855
320 Ga0495580_0117679 3300046472 Bacteria 1845
321 Ga0495582_0000026 3300046473 Bacteria 81238
322 Ga0495582_0680419 3300046473 Bacteria 595
323 Ga0495605_0074242 3300046474 Bacteria 1601
324 Ga0495639_0022476 3300046475 Bacteria 2767
325 Ga0495664_0546048 3300046477 Bacteria 691
326 Ga0495584_0279382 3300046491 Bacteria 848
327 Ga0495585_0370455 3300046492 Bacteria 693
328 Ga0495594_0687285 3300046499 Bacteria 579
329 Ga0495596_0101695 3300046500 Bacteria 1116
330 Ga0495596_0170936 3300046500 Bacteria 845
331 Ga0495607_0066850 3300046501 Bacteria 2021
332 Ga0495607_0307005 3300046501 Bacteria 745
333 Ga0495620_0244216 3300046515 Bacteria 685
334 Ga0495630_0226533 3300046517 Bacteria 1428
335 Ga0495630_0441694 3300046517 Bacteria 997
336 Ga0495644_0007364 3300046523 Bacteria 4249
337 Ga0495663_0070448 3300046525 Bacteria 1112
338 Ga0495666_0069954 3300046526 Bacteria 1669
339 Ga0495666_0188114 3300046526 Bacteria 952
340 Ga0495654_0285955 3300046530 Bacteria 677
341 Ga0495598_0020364 3300046537 Bacteria 1750
342 Ga0495609_0009315 3300046538 Bacteria 4757
343 Ga0495609_0130264 3300046538 Bacteria 1078
344 Ga0495621_0054520 3300046539 Bacteria 1437
345 Ga0495597_0033072 3300046542 Bacteria 2344
346 Ga0495622_0325231 3300046557 Bacteria 668
347 Ga0495633_0556738 3300046558 Bacteria 516
348 Ga0495656_0001111 3300046615 Bacteria 8749
349 Ga0495668_0250897 3300046616 Bacteria 969
350 Ga0495611_0045640 3300046648 Bacteria 1963
351 Ga0495588_0046907 3300046674 Bacteria 2217
352 Ga0495647_0005065 3300046681 Bacteria 4314
353 Ga0495647_0092033 3300046681 Bacteria 1245
354 Ga0495647_0616661 3300046681 Bacteria 510
355 Ga0495669_0032976 3300046684 Bacteria 2279
356 Ga0495613_0001744 3300046689 Bacteria 16553
357 Ga0495613_0028211 3300046689 Bacteria 4176
358 Ga0495624_0178205 3300046690 Bacteria 1296
359 Ga0495670_0160898 3300046691 Bacteria 1179
360 Ga0495671_0101155 3300046692 Bacteria 1409
361 Ga0495581_0021863 3300047315 Bacteria 3708
362 Ga0495636_0041687 3300047318 Bacteria 1906
363 Ga0495676_0055381 3300047321 Bacteria 3145
364 Ga0495676_0068054 3300047321 Bacteria 2753
365 Ga0495677_0061130 3300047445 Bacteria 1397
366 Ga0495593_0223587 3300047673 Bacteria 944
367 Ga0495614_0014788 3300048089 Bacteria 3414
368 Ga0495614_0454189 3300048089 Bacteria 606
369 Ga0496101_0362790 3300048904 Bacteria 1139
370 Ga0496101_0511407 3300048904 Bacteria 949
371 Ga0496109_0706841 3300048912 Bacteria 945
372 Ga0496109_1812953 3300048912 Bacteria 543
373 Ga0496110_1216527 3300048913 Bacteria 662
374 Ga0496110_1318642 3300048913 Bacteria 631
375 Ga0496114_0042364 3300048917 Bacteria 3774
376 Ga0496114_0329143 3300048917 Bacteria 1350
377 Ga0501031_0012568 3300049568 Bacteria 5530
378 Ga0501032_0131679 3300049569 Bacteria 1650
379 Ga0501033_0109219 3300049570 Bacteria 2014
380 Ga0501033_0183685 3300049570 Bacteria 1498
381 Ga0501034_0003206 3300049571 Bacteria 18765
382 Ga0501034_0030403 3300049571 Bacteria 5490
383 Ga0501034_0528433 3300049571 Bacteria 1091
384 Ga0501036_0005127 3300049572 Bacteria 10584
385 Ga0501036_0013875 3300049572 Bacteria 6701
386 Ga0501036_0928596 3300049572 Bacteria 714
387 Ga0501037_0039130 3300049573 Bacteria 3492
388 Ga0501038_0078669 3300049574 Bacteria 2782
389 Ga0501038_0157611 3300049574 Bacteria 1847
390 Ga0501039_0000514 3300049575 Bacteria 27982
391 Ga0501039_0011307 3300049575 Bacteria 6798
392 Ga0501039_1256716 3300049575 Bacteria 572
393 Ga0501040_0002257 3300049576 Bacteria 12378
394 Ga0501040_0005394 3300049576 Bacteria 8273
395 Ga0501040_0292975 3300049576 Bacteria 1163
396 Ga0501041_0003867 3300049577 Bacteria 8617
397 Ga0501041_0005256 3300049577 Bacteria 7565
398 Ga0501042_0002549 3300049578 Bacteria 11209
399 Ga0501042_0041935 3300049578 Bacteria 3255
400 Ga0501043_0068501 3300049579 Bacteria 2786
401 Ga0501043_0524440 3300049579 Bacteria 883
402 Ga0501046_0005923 3300049580 Bacteria 10889
403 Ga0501046_0044791 3300049580 Bacteria 3518
404 Ga0501047_0531320 3300049581 Bacteria 1001
405 Ga0501048_0014462 3300049582 Bacteria 5843
406 Ga0501048_0024853 3300049582 Bacteria 4369
407 Ga0501048_1103635 3300049582 Bacteria 571
408 Ga0501067_0074999 3300049583 Bacteria 1874
409 Ga0501067_0122890 3300049583 Bacteria 1445
410 Ga0501068_0202053 3300049584 Bacteria 1260
411 Ga0501068_0653361 3300049584 Bacteria 686
412 Ga0501069_0056488 3300049585 Bacteria 2187
413 Ga0501069_0232158 3300049585 Bacteria 1074
414 Ga0501069_0240904 3300049585 Bacteria 1054
415 Ga0501070_0553791 3300049586 Bacteria 920
416 Ga0501071_0028940 3300049587 Bacteria 3907
417 Ga0501071_0060242 3300049587 Bacteria 2747
418 Ga0501072_0000401 3300049588 Bacteria 31057
419 Ga0501072_0049787 3300049588 Bacteria 3298
420 Ga0501072_0084080 3300049588 Bacteria 2523
421 Ga0501072_0359664 3300049588 Bacteria 1155
422 Ga0501072_0475010 3300049588 Bacteria 989
423 Ga0501073_0020544 3300049589 Bacteria 4762
424 Ga0501073_0321569 3300049589 Bacteria 1068
425 Ga0501074_0016401 3300049590 Bacteria 5380
426 Ga0501074_0076363 3300049590 Bacteria 2404
427 Ga0501074_0103947 3300049590 Bacteria 2033
428 Ga0501074_0792538 3300049590 Bacteria 668
429 Ga0501075_0002542 3300049591 Bacteria 12148
430 Ga0501075_0028361 3300049591 Bacteria 4132
431 Ga0501076_0013940 3300049592 Bacteria 6037
432 Ga0501076_0083283 3300049592 Bacteria 2568
433 Ga0501077_0002626 3300049593 Bacteria 10761
434 Ga0501077_0044150 3300049593 Bacteria 2832
435 Ga0501077_0452065 3300049593 Bacteria 823
436 Ga0501079_0004169 3300049741 Bacteria 10711
437 Ga0501079_0012575 3300049741 Bacteria 6464
438 Ga0501079_0467074 3300049741 Bacteria 991
439 Ga0501080_0090956 3300049742 Bacteria 2834
440 Ga0501080_0200562 3300049742 Bacteria 1832
441 Ga0501080_0287243 3300049742 Bacteria 1494
442 Ga0501080_1078394 3300049742 Bacteria 694
443 Ga0501081_0007816 3300049743 Bacteria 6932
444 Ga0501081_0021152 3300049743 Bacteria 4341
445 Ga0501083_0013069 3300049744 Bacteria 5801
446 Ga0501083_0400277 3300049744 Bacteria 893
447 Ga0501035_0148057 3300049822 Bacteria 2038
448 Ga0501044_0060680 3300049823 Bacteria 3871
449 Ga0501045_0059016 3300049824 Bacteria 2811
450 nmdc:mga0yw44_638753_c1 3300050492 Bacteria 723
451 nmdc:mga05p37_1123257_c1 3300050507 Bacteria 821
452 nmdc:mga05p37_1522043_c1 3300050507 Bacteria 665
453 nmdc:mga05p37_836048_c1 3300050507 Bacteria 1002
454 nmdc:mga05p37_88211_c1 3300050507 Bacteria 3824
455 nmdc:mga09592_23438_c1 3300050508 Bacteria 5099
456 nmdc:mga09592_986574_c1 3300050508 Bacteria 705
457 nmdc:mga0qj67_300316_c1 3300050509 Bacteria 1301
458 nmdc:mga06r32_116197_c1 3300050510 Bacteria 2636
459 nmdc:mga06r32_158317_c1 3300050510 Bacteria 2247
460 nmdc:mga06r32_509667_c1 3300050510 Bacteria 1180
461 nmdc:mga0n895_115481_c1 3300050512 Bacteria 2703
462 nmdc:mga0rr50_1745_c1 3300050513 Bacteria 11991
463 nmdc:mga0rr50_403636_c1 3300050513 Bacteria 1155
464 nmdc:mga08x19_4128_c1 3300050514 Bacteria 8615
465 nmdc:mga0a205_1545786_c1 3300050515 Bacteria 512
466 nmdc:mga0a205_25778_c1 3300050515 Bacteria 5602
467 nmdc:mga0a205_868091_c1 3300050515 Bacteria 749
468 Ga0500643_039933 3300053087 Bacteria 1384
469 Ga0500628_063005 3300053129 Bacteria 910
470 Ga0500628_187477 3300053129 Bacteria 593
471 Ga0500627_0082169 3300053158 Bacteria 1437
472 Ga0501084_0001563 3300054114 Bacteria 18161
473 Ga0501084_0020183 3300054114 Bacteria 5554
474 Ga0501084_0735868 3300054114 Bacteria 831
475 Ga0501084_1023391 3300054114 Bacteria 694
476 Ga0501082_0013019 3300060353 Bacteria 7150
477 Ga0501082_0013928 3300060353 Bacteria 6915
478 Ga0501082_0363401 3300060353 Bacteria 1262
479 Ga0530510_0005467 3300061734 Bacteria 8793
480 Ga0530510_0005917 3300061734 Bacteria 8476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0400277 Ga0501083_0400277_592_882 96
2 3300049588 Ga0501072_0359664 Ga0501072_0359664_806_1132 99
3 3300042142 Ga0450905_078533 Ga0450905_078533_20_322 100
4 3300049590 Ga0501074_0792538 Ga0501074_0792538_329_640 103
5 3300005467 Ga0070706_100508198 Ga0070706_1005081982 105
6 3300005471 Ga0070698_100946516 Ga0070698_1009465162 105
7 3300050513 nmdc:mga0rr50_403636_c1 nmdc:mga0rr50_403636_c1_751_1068 105
8 3300005549 Ga0070704_100383889 Ga0070704_1003838892 106
9 3300031852 Ga0307410_10126792 Ga0307410_101267923 106
10 3300031995 Ga0307409_100042742 Ga0307409_1000427423 106
11 3300032126 Ga0307415_100140343 Ga0307415_1001403433 106
12 3300005937 Ga0081455_10010736 Ga0081455_100107368 107
13 3300005981 Ga0081538_10021744 Ga0081538_100217447 107
14 3300031548 Ga0307408_100023235 Ga0307408_1000232356 107
15 3300031731 Ga0307405_10200923 Ga0307405_102009232 107
16 3300031731 Ga0307405_10229101 Ga0307405_102291013 107
17 3300031824 Ga0307413_10705886 Ga0307413_107058862 107
18 3300031901 Ga0307406_10017666 Ga0307406_100176667 107
19 3300031901 Ga0307406_10825145 Ga0307406_108251452 107
20 3300031903 Ga0307407_10238807 Ga0307407_102388072 107
21 3300031903 Ga0307407_10436206 Ga0307407_104362062 107
22 3300031995 Ga0307409_100052343 Ga0307409_1000523435 107
23 3300031995 Ga0307409_100199032 Ga0307409_1001990322 107
24 3300032002 Ga0307416_100410066 Ga0307416_1004100662 107
25 3300032002 Ga0307416_100886629 Ga0307416_1008866292 107
26 3300032004 Ga0307414_10199720 Ga0307414_101997202 107
27 3300032004 Ga0307414_11257542 Ga0307414_112575422 107
28 3300032005 Ga0307411_10710532 Ga0307411_107105322 107
29 3300032126 Ga0307415_100033010 Ga0307415_1000330102 107
30 3300032126 Ga0307415_100071121 Ga0307415_1000711215 107
31 3300042005 Ga0439448_0072461 Ga0439448_0072461_289_642 107
32 3300042439 Ga0439464_0050295 Ga0439464_0050295_595_948 107
33 3300049568 Ga0501031_0012568 Ga0501031_0012568_2911_3264 107
34 3300049572 Ga0501036_0013875 Ga0501036_0013875_2805_3158 107
35 3300049574 Ga0501038_0078669 Ga0501038_0078669_2407_2760 107
36 3300049575 Ga0501039_0011307 Ga0501039_0011307_3375_3728 107
37 3300049576 Ga0501040_0005394 Ga0501040_0005394_2800_3153 107
38 3300049577 Ga0501041_0005256 Ga0501041_0005256_5606_5959 107
39 3300049578 Ga0501042_0041935 Ga0501042_0041935_352_705 107
40 3300049580 Ga0501046_0044791 Ga0501046_0044791_2781_3134 107
41 3300049582 Ga0501048_0014462 Ga0501048_0014462_2109_2462 107
42 3300049583 Ga0501067_0122890 Ga0501067_0122890_633_986 107
43 3300049584 Ga0501068_0653361 Ga0501068_0653361_132_485 107
44 3300049585 Ga0501069_0232158 Ga0501069_0232158_125_478 107
45 3300049587 Ga0501071_0060242 Ga0501071_0060242_2212_2565 107
46 3300049588 Ga0501072_0000401 Ga0501072_0000401_3776_4129 107
47 3300049589 Ga0501073_0020544 Ga0501073_0020544_2275_2628 107
48 3300049590 Ga0501074_0016401 Ga0501074_0016401_155_508 107
49 3300049591 Ga0501075_0002542 Ga0501075_0002542_6508_6861 107
50 3300049592 Ga0501076_0083283 Ga0501076_0083283_2047_2400 107
51 3300049593 Ga0501077_0002626 Ga0501077_0002626_535_888 107
52 3300049741 Ga0501079_0012575 Ga0501079_0012575_2791_3144 107
53 3300049742 Ga0501080_0090956 Ga0501080_0090956_2336_2689 107
54 3300049743 Ga0501081_0021152 Ga0501081_0021152_2416_2769 107
55 3300049823 Ga0501044_0060680 Ga0501044_0060680_1858_2211 107
56 3300050515 nmdc:mga0a205_868091_c1 nmdc:mga0a205_868091_c1_59_421 107
57 3300054114 Ga0501084_0020183 Ga0501084_0020183_2799_3152 107
58 3300060353 Ga0501082_0013928 Ga0501082_0013928_3531_3884 107
59 3300061734 Ga0530510_0005467 Ga0530510_0005467_2789_3142 107
60 3300005981 Ga0081538_10029009 Ga0081538_100290092 108
61 3300005983 Ga0081540_1012620 Ga0081540_10126205 108
62 3300007076 Ga0075435_100419305 Ga0075435_1004193053 108
63 3300030732 Ga0316176_1183772 Ga0316176_11837722 108
64 3300030733 Ga0314311_1041759 Ga0314311_10417592 108
65 3300030734 Ga0316179_1118811 Ga0316179_11188112 108
66 3300031824 Ga0307413_10239181 Ga0307413_102391812 108
67 3300031995 Ga0307409_101591409 Ga0307409_1015914092 108
68 3300032002 Ga0307416_101866300 Ga0307416_1018663002 108
69 3300041413 Ga0439465_0255814 Ga0439465_0255814_129_482 108
70 3300042003 Ga0439443_068404 Ga0439443_068404_172_525 108
71 3300042005 Ga0439448_0002852 Ga0439448_0002852_2772_3125 108
72 3300042008 Ga0439450_007161 Ga0439450_007161_333_686 108
73 3300042011 Ga0439454_003312 Ga0439454_003312_335_688 108
74 3300042011 Ga0439454_032330 Ga0439454_032330_311_664 108
75 3300042012 Ga0439455_0005315 Ga0439455_0005315_2004_2357 108
76 3300042016 Ga0439463_002436 Ga0439463_002436_2779_3132 108
77 3300042016 Ga0439463_010766 Ga0439463_010766_295_648 108
78 3300042118 Ga0450914_031359 Ga0450914_031359_208_561 108
79 3300042119 Ga0450915_000551 Ga0450915_000551_756_1109 108
80 3300042125 Ga0450923_012341 Ga0450923_012341_912_1265 108
81 3300042127 Ga0450890_056119 Ga0450890_056119_10_363 108
82 3300042129 Ga0450891_009503 Ga0450891_009503_55_408 108
83 3300042136 Ga0450900_001003 Ga0450900_001003_1744_2097 108
84 3300042138 Ga0450903_006071 Ga0450903_006071_415_768 108
85 3300042139 Ga0450904_010170 Ga0450904_010170_32_385 108
86 3300042184 Ga0450908_070376 Ga0450908_070376_103_456 108
87 3300042437 Ga0439444_0007487 Ga0439444_0007487_250_603 108
88 3300042438 Ga0439459_0074901 Ga0439459_0074901_121_474 108
89 3300042438 Ga0439459_0132293 Ga0439459_0132293_272_625 108
90 3300042439 Ga0439464_0047730 Ga0439464_0047730_616_969 108
91 3300042461 Ga0439460_0007380 Ga0439460_0007380_77_430 108
92 3300042530 Ga0450916_001438 Ga0450916_001438_203_556 108
93 3300042533 Ga0450901_006505 Ga0450901_006505_237_590 108
94 3300042993 Ga0439440_0002475 Ga0439440_0002475_1760_2113 108
95 3300042993 Ga0439440_0118580 Ga0439440_0118580_30_383 108
96 3300049569 Ga0501032_0131679 Ga0501032_0131679_1158_1511 108
97 3300049570 Ga0501033_0109219 Ga0501033_0109219_1595_1948 108
98 3300049570 Ga0501033_0183685 Ga0501033_0183685_170_523 108
99 3300049571 Ga0501034_0003206 Ga0501034_0003206_12830_13192 108
100 3300049571 Ga0501034_0528433 Ga0501034_0528433_706_1059 108
101 3300049572 Ga0501036_0005127 Ga0501036_0005127_2558_2911 108
102 3300049573 Ga0501037_0039130 Ga0501037_0039130_2659_3012 108
103 3300049574 Ga0501038_0157611 Ga0501038_0157611_1413_1766 108
104 3300049575 Ga0501039_0000514 Ga0501039_0000514_24898_25251 108
105 3300049576 Ga0501040_0002257 Ga0501040_0002257_9262_9615 108
106 3300049577 Ga0501041_0003867 Ga0501041_0003867_6402_6755 108
107 3300049578 Ga0501042_0002549 Ga0501042_0002549_8477_8830 108
108 3300049579 Ga0501043_0068501 Ga0501043_0068501_2160_2513 108
109 3300049580 Ga0501046_0005923 Ga0501046_0005923_2240_2593 108
110 3300049581 Ga0501047_0531320 Ga0501047_0531320_499_852 108
111 3300049582 Ga0501048_0024853 Ga0501048_0024853_883_1236 108
112 3300049584 Ga0501068_0202053 Ga0501068_0202053_26_379 108
113 3300049585 Ga0501069_0056488 Ga0501069_0056488_1027_1380 108
114 3300049587 Ga0501071_0028940 Ga0501071_0028940_756_1109 108
115 3300049588 Ga0501072_0475010 Ga0501072_0475010_299_652 108
116 3300049590 Ga0501074_0076363 Ga0501074_0076363_203_556 108
117 3300049591 Ga0501075_0028361 Ga0501075_0028361_2201_2554 108
118 3300049592 Ga0501076_0013940 Ga0501076_0013940_2212_2565 108
119 3300049593 Ga0501077_0044150 Ga0501077_0044150_266_619 108
120 3300049741 Ga0501079_0004169 Ga0501079_0004169_8119_8472 108
121 3300049743 Ga0501081_0007816 Ga0501081_0007816_70_423 108
122 3300049822 Ga0501035_0148057 Ga0501035_0148057_267_620 108
123 3300049824 Ga0501045_0059016 Ga0501045_0059016_148_501 108
124 3300054114 Ga0501084_0001563 Ga0501084_0001563_3082_3435 108
125 3300060353 Ga0501082_0013019 Ga0501082_0013019_4536_4889 108
126 3300061734 Ga0530510_0005917 Ga0530510_0005917_1680_2033 108
127 3300005336 Ga0070680_101140876 Ga0070680_1011408761 110
128 3300005344 Ga0070661_101729381 Ga0070661_1017293811 110
129 3300005545 Ga0070695_100958125 Ga0070695_1009581252 110
130 3300005549 Ga0070704_100663381 Ga0070704_1006633811 110
131 3300009148 Ga0105243_11211826 Ga0105243_112118262 110
132 3300013297 Ga0157378_12011306 Ga0157378_120113061 110
133 3300050515 nmdc:mga0a205_1545786_c1 nmdc:mga0a205_1545786_c1_127_486 110
134 3300005457 Ga0070662_100050032 Ga0070662_1000500325 111
135 3300005545 Ga0070695_100099797 Ga0070695_1000997974 111
136 3300005719 Ga0068861_100019757 Ga0068861_1000197572 111
137 3300005843 Ga0068860_100858074 Ga0068860_1008580742 111
138 3300009553 Ga0105249_10014593 Ga0105249_100145937 111
139 3300013306 Ga0163162_10111590 Ga0163162_101115905 111
140 3300017792 Ga0163161_10126258 Ga0163161_101262582 111
141 3300025923 Ga0207681_10441993 Ga0207681_104419932 111
142 3300025933 Ga0207706_10004872 Ga0207706_1000487219 111
143 3300025961 Ga0207712_10013482 Ga0207712_1001348211 111
144 3300026118 Ga0207675_100005964 Ga0207675_1000059646 111
145 3300028380 Ga0268265_10247143 Ga0268265_102471433 111
146 3300028381 Ga0268264_10934912 Ga0268264_109349122 111
147 3300031548 Ga0307408_100293637 Ga0307408_1002936372 111
148 3300031824 Ga0307413_10121666 Ga0307413_101216662 111
149 3300031852 Ga0307410_10022122 Ga0307410_100221223 111
150 3300031901 Ga0307406_10099325 Ga0307406_100993253 111
151 3300031911 Ga0307412_10710869 Ga0307412_107108691 111
152 3300031995 Ga0307409_100122345 Ga0307409_1001223452 111
153 3300032002 Ga0307416_100026709 Ga0307416_1000267092 111
154 3300032002 Ga0307416_100308939 Ga0307416_1003089392 111
155 3300032005 Ga0307411_10560161 Ga0307411_105601612 111
156 3300032126 Ga0307415_100278774 Ga0307415_1002787742 111
157 3300035691 Ga0373931_0591930 Ga0373931_0591930_288_641 111
158 3300037418 Ga0395900_0048766 Ga0395900_0048766_3479_3832 111
159 3300037466 Ga0395898_0071157 Ga0395898_0071157_2423_2776 111
160 3300038443 Ga0395901_0390736 Ga0395901_0390736_212_565 111
161 3300042012 Ga0439455_0110873 Ga0439455_0110873_74_427 111
162 3300042116 Ga0450912_010597 Ga0450912_010597_192_545 111
163 3300042532 Ga0450893_0011831 Ga0450893_0011831_940_1293 111
164 3300046474 Ga0495605_0074242 Ga0495605_0074242_396_749 111
165 3300046491 Ga0495584_0279382 Ga0495584_0279382_188_541 111
166 3300046492 Ga0495585_0370455 Ga0495585_0370455_129_482 111
167 3300046501 Ga0495607_0066850 Ga0495607_0066850_1288_1641 111
168 3300046515 Ga0495620_0244216 Ga0495620_0244216_223_576 111
169 3300046523 Ga0495644_0007364 Ga0495644_0007364_3500_3853 111
170 3300046525 Ga0495663_0070448 Ga0495663_0070448_176_529 111
171 3300046530 Ga0495654_0285955 Ga0495654_0285955_65_418 111
172 3300046537 Ga0495598_0020364 Ga0495598_0020364_328_681 111
173 3300046538 Ga0495609_0009315 Ga0495609_0009315_2096_2449 111
174 3300046539 Ga0495621_0054520 Ga0495621_0054520_531_884 111
175 3300046542 Ga0495597_0033072 Ga0495597_0033072_429_782 111
176 3300046615 Ga0495656_0001111 Ga0495656_0001111_5891_6244 111
177 3300046616 Ga0495668_0250897 Ga0495668_0250897_482_835 111
178 3300046648 Ga0495611_0045640 Ga0495611_0045640_1360_1713 111
179 3300046684 Ga0495669_0032976 Ga0495669_0032976_1068_1421 111
180 3300046691 Ga0495670_0160898 Ga0495670_0160898_418_771 111
181 3300046692 Ga0495671_0101155 Ga0495671_0101155_539_892 111
182 3300047318 Ga0495636_0041687 Ga0495636_0041687_344_697 111
183 3300047445 Ga0495677_0061130 Ga0495677_0061130_674_1027 111
184 3300049583 Ga0501067_0074999 Ga0501067_0074999_775_1137 111
185 3300049590 Ga0501074_0103947 Ga0501074_0103947_851_1213 111
186 3300005985 Ga0081539_10053292 Ga0081539_100532925 112
187 3300035398 Ga0316574_0390652 Ga0316574_0390652_77_445 113
188 3300049582 Ga0501048_1103635 Ga0501048_1103635_35_400 113
189 3300026041 Ga0207639_10688228 Ga0207639_106882282 114
190 3300035116 Ga0373945_0106973 Ga0373945_0106973_639_986 114
191 3300035725 Ga0373947_0006076 Ga0373947_0006076_1365_1712 114
192 3300037068 Ga0373925_0079947 Ga0373925_0079947_1185_1532 114
193 3300046455 Ga0495603_0075258 Ga0495603_0075258_1474_1821 114
194 3300046459 Ga0495629_0010441 Ga0495629_0010441_6315_6662 114
195 3300046472 Ga0495580_0117679 Ga0495580_0117679_106_453 114
196 3300046473 Ga0495582_0000026 Ga0495582_0000026_11359_11706 114
197 3300046475 Ga0495639_0022476 Ga0495639_0022476_378_725 114
198 3300046499 Ga0495594_0687285 Ga0495594_0687285_180_527 114
199 3300046517 Ga0495630_0226533 Ga0495630_0226533_738_1085 114
200 3300046526 Ga0495666_0069954 Ga0495666_0069954_330_677 114
201 3300046674 Ga0495588_0046907 Ga0495588_0046907_1751_2098 114
202 3300046681 Ga0495647_0005065 Ga0495647_0005065_2172_2519 114
203 3300046689 Ga0495613_0001744 Ga0495613_0001744_2135_2482 114
204 3300047315 Ga0495581_0021863 Ga0495581_0021863_1426_1773 114
205 3300047321 Ga0495676_0055381 Ga0495676_0055381_176_523 114
206 3300047673 Ga0495593_0223587 Ga0495593_0223587_43_390 114
207 3300048089 Ga0495614_0014788 Ga0495614_0014788_1444_1791 114
208 3300031665 Ga0316575_10187826 Ga0316575_101878262 116
209 3300032168 Ga0316593_10000037 Ga0316593_1000003719 116
210 3300033541 Ga0316596_1005873 Ga0316596_10058735 116
211 3300005546 Ga0070696_101740019 Ga0070696_1017400191 117
212 3300032004 Ga0307414_10219239 Ga0307414_102192393 117
213 3300042125 Ga0450923_004570 Ga0450923_004570_1424_1780 117
214 3300042184 Ga0450908_038975 Ga0450908_038975_208_564 117
215 3300049572 Ga0501036_0928596 Ga0501036_0928596_211_567 117
216 3300049576 Ga0501040_0292975 Ga0501040_0292975_484_840 117
217 3300053087 Ga0500643_039933 Ga0500643_039933_759_1115 117
218 3300053158 Ga0500627_0082169 Ga0500627_0082169_752_1108 117
219 3300005334 Ga0068869_100737229 Ga0068869_1007372292 118
220 3300005436 Ga0070713_100297697 Ga0070713_1002976973 118
221 3300005445 Ga0070708_100054472 Ga0070708_1000544725 118
222 3300005467 Ga0070706_100075943 Ga0070706_1000759434 118
223 3300005467 Ga0070706_100779249 Ga0070706_1007792491 118
224 3300005467 Ga0070706_101896081 Ga0070706_1018960812 118
225 3300005468 Ga0070707_100338225 Ga0070707_1003382251 118
226 3300005471 Ga0070698_100045833 Ga0070698_10004583311 118
227 3300005471 Ga0070698_100801926 Ga0070698_1008019261 118
228 3300005518 Ga0070699_100059059 Ga0070699_1000590594 118
229 3300005536 Ga0070697_100325162 Ga0070697_1003251622 118
230 3300005577 Ga0068857_102382810 Ga0068857_1023828102 118
231 3300005937 Ga0081455_10461515 Ga0081455_104615152 118
232 3300005981 Ga0081538_10142268 Ga0081538_101422682 118
233 3300006844 Ga0075428_100034071 Ga0075428_1000340714 118
234 3300006844 Ga0075428_100176389 Ga0075428_1001763895 118
235 3300006846 Ga0075430_100118912 Ga0075430_1001189123 118
236 3300006846 Ga0075430_100304416 Ga0075430_1003044162 118
237 3300006847 Ga0075431_100112956 Ga0075431_1001129561 118
238 3300006847 Ga0075431_100116745 Ga0075431_1001167453 118
239 3300006847 Ga0075431_100371791 Ga0075431_1003717912 118
240 3300006852 Ga0075433_10002059 Ga0075433_1000205917 118
241 3300006871 Ga0075434_100004000 Ga0075434_10000400020 118
242 3300006880 Ga0075429_100035358 Ga0075429_1000353585 118
243 3300006880 Ga0075429_100405807 Ga0075429_1004058072 118
244 3300006914 Ga0075436_100325750 Ga0075436_1003257502 118
245 3300007076 Ga0075435_100050728 Ga0075435_1000507285 118
246 3300009147 Ga0114129_10045478 Ga0114129_100454785 118
247 3300009147 Ga0114129_10311248 Ga0114129_103112485 118
248 3300009147 Ga0114129_11844951 Ga0114129_118449511 118
249 3300009147 Ga0114129_12977809 Ga0114129_129778092 118
250 3300010159 Ga0099796_10292553 Ga0099796_102925531 118
251 3300020069 Ga0197907_11474341 Ga0197907_114743412 118
252 3300020070 Ga0206356_10409578 Ga0206356_104095782 118
253 3300025910 Ga0207684_10067749 Ga0207684_100677492 118
254 3300025910 Ga0207684_10161879 Ga0207684_101618795 118
255 3300025922 Ga0207646_10133546 Ga0207646_101335462 118
256 3300025922 Ga0207646_10598774 Ga0207646_105987742 118
257 3300031548 Ga0307408_102254499 Ga0307408_1022544992 118
258 3300035089 Ga0373944_0086488 Ga0373944_0086488_168_524 118
259 3300035170 Ga0373943_0323572 Ga0373943_0323572_409_765 118
260 3300035692 Ga0373935_0459856 Ga0373935_0459856_540_896 118
261 3300035695 Ga0373927_0202074 Ga0373927_0202074_865_1221 118
262 3300035725 Ga0373947_0541141 Ga0373947_0541141_221_577 118
263 3300037068 Ga0373925_0806311 Ga0373925_0806311_266_622 118
264 3300039438 Ga0436360_1189079 Ga0436360_1189079_77_433 118
265 3300039438 Ga0436360_1245037 Ga0436360_1245037_79_435 118
266 3300046455 Ga0495603_0084466 Ga0495603_0084466_19_375 118
267 3300046473 Ga0495582_0680419 Ga0495582_0680419_169_525 118
268 3300046500 Ga0495596_0101695 Ga0495596_0101695_457_813 118
269 3300046501 Ga0495607_0307005 Ga0495607_0307005_157_513 118
270 3300046517 Ga0495630_0441694 Ga0495630_0441694_264_620 118
271 3300046526 Ga0495666_0188114 Ga0495666_0188114_410_766 118
272 3300046538 Ga0495609_0130264 Ga0495609_0130264_355_711 118
273 3300046681 Ga0495647_0092033 Ga0495647_0092033_266_622 118
274 3300046689 Ga0495613_0028211 Ga0495613_0028211_2990_3346 118
275 3300047321 Ga0495676_0068054 Ga0495676_0068054_243_599 118
276 3300048089 Ga0495614_0454189 Ga0495614_0454189_191_547 118
277 3300048912 Ga0496109_1812953 Ga0496109_1812953_164_520 118
278 3300050507 nmdc:mga05p37_1123257_c1 nmdc:mga05p37_1123257_c1_351_707 118
279 3300050507 nmdc:mga05p37_1522043_c1 nmdc:mga05p37_1522043_c1_126_482 118
280 3300050507 nmdc:mga05p37_836048_c1 nmdc:mga05p37_836048_c1_446_802 118
281 3300050507 nmdc:mga05p37_88211_c1 nmdc:mga05p37_88211_c1_2611_2967 118
282 3300050508 nmdc:mga09592_23438_c1 nmdc:mga09592_23438_c1_3677_4033 118
283 3300050508 nmdc:mga09592_986574_c1 nmdc:mga09592_986574_c1_135_491 118
284 3300050509 nmdc:mga0qj67_300316_c1 nmdc:mga0qj67_300316_c1_278_634 118
285 3300050510 nmdc:mga06r32_116197_c1 nmdc:mga06r32_116197_c1_2040_2396 118
286 3300050510 nmdc:mga06r32_158317_c1 nmdc:mga06r32_158317_c1_1401_1757 118
287 3300050510 nmdc:mga06r32_509667_c1 nmdc:mga06r32_509667_c1_24_380 118
288 3300050512 nmdc:mga0n895_115481_c1 nmdc:mga0n895_115481_c1_1067_1423 118
289 3300050513 nmdc:mga0rr50_1745_c1 nmdc:mga0rr50_1745_c1_5563_5919 118
290 3300050514 nmdc:mga08x19_4128_c1 nmdc:mga08x19_4128_c1_3928_4284 118
291 3300050515 nmdc:mga0a205_25778_c1 nmdc:mga0a205_25778_c1_3676_4032 118
292 3300005441 Ga0070700_101675170 Ga0070700_1016751702 119
293 3300005445 Ga0070708_100227087 Ga0070708_1002270872 119
294 3300005467 Ga0070706_100434539 Ga0070706_1004345392 119
295 3300005468 Ga0070707_100134447 Ga0070707_1001344475 119
296 3300005518 Ga0070699_100069820 Ga0070699_1000698204 119
297 3300005518 Ga0070699_100729757 Ga0070699_1007297572 119
298 3300025922 Ga0207646_10253092 Ga0207646_102530922 119
299 3300035410 Ga0373924_0173196 Ga0373924_0173196_113_475 119
300 3300049589 Ga0501073_0321569 Ga0501073_0321569_229_588 119
301 3300049741 Ga0501079_0467074 Ga0501079_0467074_465_824 119
302 3300049742 Ga0501080_0200562 Ga0501080_0200562_270_629 119
303 3300060353 Ga0501082_0363401 Ga0501082_0363401_695_1054 119
304 3300005440 Ga0070705_101482941 Ga0070705_1014829411 120
305 3300005466 Ga0070685_11264548 Ga0070685_112645481 120
306 3300014326 Ga0157380_11880069 Ga0157380_118800692 120
307 3300015265 Ga0182005_1212835 Ga0182005_12128352 120
308 3300021384 Ga0213876_10003226 Ga0213876_100032265 120
309 3300031731 Ga0307405_11197782 Ga0307405_111977822 120
310 3300031852 Ga0307410_10038255 Ga0307410_100382552 120
311 3300031852 Ga0307410_10429220 Ga0307410_104292202 120
312 3300031901 Ga0307406_10403728 Ga0307406_104037282 120
313 3300031903 Ga0307407_10013620 Ga0307407_100136205 120
314 3300031995 Ga0307409_100041374 Ga0307409_1000413745 120
315 3300032002 Ga0307416_100167903 Ga0307416_1001679032 120
316 3300032002 Ga0307416_103687541 Ga0307416_1036875411 120
317 3300032004 Ga0307414_10577955 Ga0307414_105779552 120
318 3300032126 Ga0307415_100008299 Ga0307415_1000082999 120
319 3300032126 Ga0307415_101668591 Ga0307415_1016685911 120
320 3300034818 Ga0373950_0009989 Ga0373950_0009989_281_643 120
321 3300039437 Ga0436365_0253748 Ga0436365_0253748_339_701 120
322 3300039437 Ga0436365_1349538 Ga0436365_1349538_7580_7942 120
323 3300041494 Ga0451837_0071548 Ga0451837_0071548_669_1031 120
324 3300041494 Ga0451837_0714092 Ga0451837_0714092_212_574 120
325 3300041509 Ga0451843_1656561 Ga0451843_1656561_327_689 120
326 3300041512 Ga0451853_0672581 Ga0451853_0672581_314_676 120
327 3300049571 Ga0501034_0030403 Ga0501034_0030403_123_485 120
328 3300049575 Ga0501039_1256716 Ga0501039_1256716_32_394 120
329 3300049579 Ga0501043_0524440 Ga0501043_0524440_226_588 120
330 3300049585 Ga0501069_0240904 Ga0501069_0240904_302_664 120
331 3300049586 Ga0501070_0553791 Ga0501070_0553791_140_502 120
332 3300049588 Ga0501072_0049787 Ga0501072_0049787_804_1166 120
333 3300049742 Ga0501080_0287243 Ga0501080_0287243_431_793 120
334 3300049742 Ga0501080_1078394 Ga0501080_1078394_249_611 120
335 3300049744 Ga0501083_0013069 Ga0501083_0013069_2090_2452 120
336 3300054114 Ga0501084_0735868 Ga0501084_0735868_446_808 120
337 3300054114 Ga0501084_1023391 Ga0501084_1023391_268_630 120
338 3300006038 Ga0075365_10362620 Ga0075365_103626201 121
339 3300006048 Ga0075363_100876507 Ga0075363_1008765072 121
340 3300006178 Ga0075367_10920435 Ga0075367_109204351 121
341 3300009176 Ga0105242_11532771 Ga0105242_115327712 121
342 3300009553 Ga0105249_11234776 Ga0105249_112347762 121
343 3300014969 Ga0157376_12736581 Ga0157376_127365812 121
344 3300025986 Ga0207658_11570931 Ga0207658_115709312 121
345 3300031852 Ga0307410_11805843 Ga0307410_118058432 121
346 3300031911 Ga0307412_10082457 Ga0307412_100824573 121
347 3300031995 Ga0307409_100097825 Ga0307409_1000978252 121
348 3300031995 Ga0307409_101397326 Ga0307409_1013973262 121
349 3300032002 Ga0307416_100818162 Ga0307416_1008181621 121
350 3300035398 Ga0316574_0343144 Ga0316574_0343144_453_818 121
351 3300041411 Ga0439466_0096184 Ga0439466_0096184_48_413 121
352 3300041999 Ga0439433_0059314 Ga0439433_0059314_515_880 121
353 3300042156 Ga0439446_0269432 Ga0439446_0269432_64_429 121
354 3300042435 Ga0439434_0005020 Ga0439434_0005020_2234_2599 121
355 3300042438 Ga0439459_0042417 Ga0439459_0042417_222_587 121
356 3300046455 Ga0495603_0059488 Ga0495603_0059488_1496_1861 121
357 3300050492 nmdc:mga0yw44_638753_c1 nmdc:mga0yw44_638753_c1_252_617 121
358 3300005330 Ga0070690_101082867 Ga0070690_1010828672 122
359 3300005333 Ga0070677_10017280 Ga0070677_100172803 122
360 3300005334 Ga0068869_101346307 Ga0068869_1013463072 122
361 3300005343 Ga0070687_100516491 Ga0070687_1005164911 122
362 3300005347 Ga0070668_100034448 Ga0070668_1000344484 122
363 3300005355 Ga0070671_102090375 Ga0070671_1020903751 122
364 3300005365 Ga0070688_100029257 Ga0070688_1000292577 122
365 3300005366 Ga0070659_100522188 Ga0070659_1005221881 122
366 3300005438 Ga0070701_10727758 Ga0070701_107277581 122
367 3300005441 Ga0070700_100303158 Ga0070700_1003031582 122
368 3300005456 Ga0070678_100158897 Ga0070678_1001588973 122
369 3300005459 Ga0068867_100272727 Ga0068867_1002727272 122
370 3300005466 Ga0070685_10072811 Ga0070685_100728112 122
371 3300005543 Ga0070672_101092814 Ga0070672_1010928141 122
372 3300005578 Ga0068854_101858767 Ga0068854_1018587672 122
373 3300005615 Ga0070702_100052749 Ga0070702_1000527493 122
374 3300005618 Ga0068864_100177022 Ga0068864_1001770222 122
375 3300005618 Ga0068864_100657747 Ga0068864_1006577472 122
376 3300005718 Ga0068866_10387398 Ga0068866_103873982 122
377 3300005719 Ga0068861_100138719 Ga0068861_1001387192 122
378 3300005840 Ga0068870_10520622 Ga0068870_105206222 122
379 3300005841 Ga0068863_100678709 Ga0068863_1006787092 122
380 3300005841 Ga0068863_100770082 Ga0068863_1007700822 122
381 3300006237 Ga0097621_100727750 Ga0097621_1007277502 122
382 3300006358 Ga0068871_100603842 Ga0068871_1006038422 122
383 3300006881 Ga0068865_100122924 Ga0068865_1001229245 122
384 3300009098 Ga0105245_11453637 Ga0105245_114536372 122
385 3300009098 Ga0105245_12325046 Ga0105245_123250462 122
386 3300009148 Ga0105243_10006064 Ga0105243_1000606414 122
387 3300009177 Ga0105248_10124853 Ga0105248_101248532 122
388 3300009177 Ga0105248_10890587 Ga0105248_108905872 122
389 3300009553 Ga0105249_10031383 Ga0105249_100313832 122
390 3300013306 Ga0163162_11715724 Ga0163162_117157241 122
391 3300013308 Ga0157375_10008438 Ga0157375_100084388 122
392 3300014325 Ga0163163_10031271 Ga0163163_100312715 122
393 3300014326 Ga0157380_11050344 Ga0157380_110503442 122
394 3300014968 Ga0157379_10473983 Ga0157379_104739832 122
395 3300017792 Ga0163161_10016026 Ga0163161_1001602611 122
396 3300025899 Ga0207642_10440016 Ga0207642_104400161 122
397 3300025905 Ga0207685_10798612 Ga0207685_107986121 122
398 3300025908 Ga0207643_10280921 Ga0207643_102809212 122
399 3300025918 Ga0207662_10317457 Ga0207662_103174571 122
400 3300025925 Ga0207650_10084041 Ga0207650_100840412 122
401 3300025931 Ga0207644_10524528 Ga0207644_105245282 122
402 3300025932 Ga0207690_11131867 Ga0207690_111318672 122
403 3300025935 Ga0207709_10091647 Ga0207709_100916474 122
404 3300025937 Ga0207669_10485277 Ga0207669_104852771 122
405 3300025938 Ga0207704_10781118 Ga0207704_107811181 122
406 3300025940 Ga0207691_10007702 Ga0207691_100077025 122
407 3300025961 Ga0207712_10087345 Ga0207712_100873452 122
408 3300025972 Ga0207668_11193634 Ga0207668_111936341 122
409 3300025981 Ga0207640_10317468 Ga0207640_103174682 122
410 3300025986 Ga0207658_11637665 Ga0207658_116376652 122
411 3300026075 Ga0207708_10257890 Ga0207708_102578902 122
412 3300026088 Ga0207641_10566931 Ga0207641_105669313 122
413 3300026089 Ga0207648_10071203 Ga0207648_100712032 122
414 3300026095 Ga0207676_10203669 Ga0207676_102036692 122
415 3300026095 Ga0207676_10384930 Ga0207676_103849302 122
416 3300026118 Ga0207675_100018499 Ga0207675_1000184992 122
417 3300031665 Ga0316575_10023255 Ga0316575_100232552 122
418 3300031665 Ga0316575_10278568 Ga0316575_102785682 122
419 3300031691 Ga0316579_10044489 Ga0316579_100444894 122
420 3300031691 Ga0316579_10053468 Ga0316579_100534682 122
421 3300031691 Ga0316579_10065250 Ga0316579_100652504 122
422 3300031691 Ga0316579_10115095 Ga0316579_101150951 122
423 3300031727 Ga0316576_10000459 Ga0316576_100004596 122
424 3300031727 Ga0316576_10037669 Ga0316576_100376695 122
425 3300031727 Ga0316576_10208461 Ga0316576_102084612 122
426 3300031727 Ga0316576_10456889 Ga0316576_104568891 122
427 3300031727 Ga0316576_10539661 Ga0316576_105396611 122
428 3300031728 Ga0316578_10000790 Ga0316578_1000079016 122
429 3300031728 Ga0316578_10004574 Ga0316578_1000457411 122
430 3300031728 Ga0316578_10007920 Ga0316578_100079203 122
431 3300031728 Ga0316578_10036090 Ga0316578_100360903 122
432 3300031733 Ga0316577_10050872 Ga0316577_100508722 122
433 3300031733 Ga0316577_10066828 Ga0316577_100668282 122
434 3300032137 Ga0316585_10224060 Ga0316585_102240602 122
435 3300032137 Ga0316585_10231901 Ga0316585_102319012 122
436 3300032139 Ga0316580_10007998 Ga0316580_100079985 122
437 3300032168 Ga0316593_10004257 Ga0316593_100042573 122
438 3300032168 Ga0316593_10127041 Ga0316593_101270412 122
439 3300033541 Ga0316596_1002269 Ga0316596_10022695 122
440 3300033541 Ga0316596_1029284 Ga0316596_10292842 122
441 3300035398 Ga0316574_0010480 Ga0316574_0010480_70_438 122
442 3300035398 Ga0316574_0029464 Ga0316574_0029464_941_1309 122
443 3300035398 Ga0316574_0034363 Ga0316574_0034363_84_452 122
444 3300035398 Ga0316574_0089305 Ga0316574_0089305_205_573 122
445 3300035398 Ga0316574_0222491 Ga0316574_0222491_747_1115 122
446 3300035398 Ga0316574_0330784 Ga0316574_0330784_199_567 122
447 3300035398 Ga0316574_0743686 Ga0316574_0743686_220_588 122
448 3300036647 Ga0316582_0068021 Ga0316582_0068021_282_650 122
449 3300036647 Ga0316582_0113115 Ga0316582_0113115_491_859 122
450 3300036647 Ga0316582_0789135 Ga0316582_0789135_50_418 122
451 3300036712 Ga0316584_0004117 Ga0316584_0004117_731_1099 122
452 3300036712 Ga0316584_0039289 Ga0316584_0039289_1277_1645 122
453 3300036712 Ga0316584_0117311 Ga0316584_0117311_166_534 122
454 3300041451 Ga0451791_1338045 Ga0451791_1338045_299_667 122
455 3300041452 Ga0451793_1082305 Ga0451793_1082305_247_615 122
456 3300041453 Ga0451797_0350092 Ga0451797_0350092_50_418 122
457 3300041463 Ga0451804_0416655 Ga0451804_0416655_171_539 122
458 3300041507 Ga0451851_0610797 Ga0451851_0610797_108_476 122
459 3300041512 Ga0451853_0075311 Ga0451853_0075311_275_643 122
460 3300042435 Ga0439434_0153997 Ga0439434_0153997_197_565 122
461 3300046455 Ga0495603_0033810 Ga0495603_0033810_926_1294 122
462 3300046455 Ga0495603_0667915 Ga0495603_0667915_27_395 122
463 3300046461 Ga0495641_0218302 Ga0495641_0218302_357_725 122
464 3300046477 Ga0495664_0546048 Ga0495664_0546048_253_621 122
465 3300046500 Ga0495596_0170936 Ga0495596_0170936_435_803 122
466 3300046557 Ga0495622_0325231 Ga0495622_0325231_88_456 122
467 3300046558 Ga0495633_0556738 Ga0495633_0556738_121_489 122
468 3300046681 Ga0495647_0616661 Ga0495647_0616661_20_388 122
469 3300046690 Ga0495624_0178205 Ga0495624_0178205_399_767 122
470 3300048904 Ga0496101_0362790 Ga0496101_0362790_434_802 122
471 3300048904 Ga0496101_0511407 Ga0496101_0511407_20_388 122
472 3300048912 Ga0496109_0706841 Ga0496109_0706841_375_743 122
473 3300048913 Ga0496110_1216527 Ga0496110_1216527_21_389 122
474 3300048913 Ga0496110_1318642 Ga0496110_1318642_165_533 122
475 3300048917 Ga0496114_0042364 Ga0496114_0042364_2521_2889 122
476 3300048917 Ga0496114_0329143 Ga0496114_0329143_824_1192 122
477 3300049588 Ga0501072_0084080 Ga0501072_0084080_61_429 122
478 3300049593 Ga0501077_0452065 Ga0501077_0452065_70_438 122
479 3300053129 Ga0500628_063005 Ga0500628_063005_455_823 122
480 3300053129 Ga0500628_187477 Ga0500628_187477_116_484 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

6

122

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w2e-assembly1.cif.gz_S crystal structure of elongation factor 4 (ef4/lepa) bound to the thermus thermophilus 70s ribosome 0.9156 28 122
4v4w-assembly1.cif.gz_BM structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.9071 28 120
6gaw-assembly1.cif.gz_BS unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the complete 55s ribosome. 0.9044 31 120
5ool-assembly1.cif.gz_P structure of a native assembly intermediate of the human mitochondrial ribosome with unfolded interfacial rrna 0.898 30 120
4v6g-assembly1.cif.gz_BQ initiation complex of 70s ribosome with two trnas and mrna. 0.8961 28 122
ID Description Score Start End Superfamily
af_Q6LFD5_83_212_3.30.420.100 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9741 29 120 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.959 22 122 3.30.420.100
af_A0A0R0LFW1_76_177_3.30.420.100 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9576 29 107 3.30.420.100
af_Q9LJA1_150_297_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.955 32 121 3.30.420.80
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9484 22 122 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A7X7QQ09-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9959 25 122 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A063YYF1-F1-model_v4 deleted 0.9864 21 122
AF-A0A7J0E5R5-F1-model_v4 Large ribosomal subunit protein uL18c 0.9834 25 122 GO:0000492
GO:0003735
GO:0005840
GO:0006412
GO:0008097
GO:1990904
AF-A0A4D6WVZ9-F1-model_v4 Large ribosomal subunit protein uL18c (50S ribosomal protein L18, chloroplastic) 0.9831 22 122 GO:0003735
GO:0005840
GO:0006412
GO:0008097
GO:0009536
GO:1990904
AF-A0A3G2QZJ3-F1-model_v4 Large ribosomal subunit protein uL18c 0.981 22 122 GO:0003735
GO:0005840
GO:0006412
GO:0008097
GO:0009536
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.23 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map