F452164

General Info

Members Datasets Scaffolds Average Seq Length
480 159 480 465

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100102824|Ga0070670_1001028241
Length 470
Sequence MTDFASLLVADRGQKARLIHLVDKGSFAAWAKGRSAEDRALLDAHRFDGKTGFAFVLLPRGNEFEVVSAVKNAAELSPWCLARLGESLPDGSYKLAEGEPGLAALGWMLAQYRFTAYRSTPDEPERGARVLVSGDAARVDEFVRLAEATALVRDLVNTPAADLGPAELEAAVKAEASRAGARLKVTAGDDLTKGYPLIAAVGGAATPERAPRLIELEWGDTRHPRIAIVGKGVCFDSGGLDLKPAAGMRIMKKDMGGAAHALALARLITLGKLPVRLHLLIPAVENAVSGAAYRPGDIVRSRKGLTVEIDNTDAEGRLILADALDKAVEGGGKDNPPELIIDFATLTGAARVALGPDLPAAFANQDDLAAELEAASRAVEDPLWRMPLWDPYNDLFKSDVADFANASSSPMAGCITAALFLKRFVPDAIPWAHLDTWAWRDPGKPGRPKGGDALGLRAVFAVLERRYPPR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 3.75
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004201 3300001989 Bacteria 5512
2 JGI24737J22298_10002032 3300001990 Bacteria 7235
3 JGI24737J22298_10006819 3300001990 Bacteria 3881
4 JGI24737J22298_10007596 3300001990 Bacteria 3654
5 JGI24735J21928_10001805 3300002067 Bacteria 7515
6 JGI24738J21930_10001744 3300002075 Bacteria 5940
7 Ga0070658_10000205 3300005327 Bacteria 52211
8 Ga0070658_10020680 3300005327 Bacteria 5272
9 Ga0070658_10039574 3300005327 Bacteria 3803
10 Ga0070658_10064458 3300005327 Bacteria 2988
11 Ga0070658_10099858 3300005327 Bacteria 2398
12 Ga0070658_10103671 3300005327 Bacteria 2353
13 Ga0070658_10122666 3300005327 Bacteria 2160
14 Ga0070658_10140439 3300005327 Bacteria 2018
15 Ga0070676_10011061 3300005328 Bacteria 4902
16 Ga0070683_100000969 3300005329 Bacteria 21372
17 Ga0070683_100018994 3300005329 Bacteria 6098
18 Ga0070683_100081770 3300005329 Bacteria 3025
19 Ga0070683_100202366 3300005329 Bacteria 1886
20 Ga0070683_100230123 3300005329 Bacteria 1762
21 Ga0070670_100000504 3300005331 Bacteria 31371
22 Ga0070670_100010495 3300005331 Bacteria 7907
23 Ga0070670_100032951 3300005331 Bacteria 4465
24 Ga0070670_100102824 3300005331 Bacteria 2461
25 Ga0070666_10000435 3300005335 Bacteria 25552
26 Ga0070666_10000838 3300005335 Bacteria 18641
27 Ga0070666_10020715 3300005335 Bacteria 4254
28 Ga0070666_10040756 3300005335 Bacteria 3101
29 Ga0070680_100000991 3300005336 Bacteria 20159
30 Ga0070680_100008685 3300005336 Bacteria 7788
31 Ga0070680_100015200 3300005336 Bacteria 6030
32 Ga0070680_100058866 3300005336 Bacteria 3142
33 Ga0068868_100031256 3300005338 Bacteria 4088
34 Ga0070660_100000009 3300005339 Bacteria 145691
35 Ga0070660_100003291 3300005339 Bacteria 11105
36 Ga0070660_100016422 3300005339 Bacteria 5372
37 Ga0070660_100035557 3300005339 Bacteria 3771
38 Ga0070660_100147625 3300005339 Bacteria 1889
39 Ga0070691_10021727 3300005341 Bacteria 2971
40 Ga0070661_100000100 3300005344 Bacteria 70585
41 Ga0070661_100003146 3300005344 Bacteria 11354
42 Ga0070661_100028278 3300005344 Bacteria 4043
43 Ga0070661_100033294 3300005344 Bacteria 3732
44 Ga0070661_100034112 3300005344 Bacteria 3690
45 Ga0070661_100067736 3300005344 Bacteria 2623
46 Ga0070661_100074594 3300005344 Bacteria 2498
47 Ga0070692_10003865 3300005345 Bacteria 6170
48 Ga0070668_100000311 3300005347 Bacteria 32092
49 Ga0070668_100052251 3300005347 Bacteria 3150
50 Ga0070669_100046578 3300005353 Bacteria 3162
51 Ga0070669_100163945 3300005353 Bacteria 1729
52 Ga0070671_100002820 3300005355 Bacteria 13508
53 Ga0070671_100007173 3300005355 Bacteria 8911
54 Ga0070671_100063815 3300005355 Bacteria 3068
55 Ga0070671_100068897 3300005355 Bacteria 2950
56 Ga0070674_100040224 3300005356 Bacteria 3162
57 Ga0070673_100002844 3300005364 Bacteria 10658
58 Ga0070673_100005946 3300005364 Bacteria 7887
59 Ga0070673_100039066 3300005364 Bacteria 3629
60 Ga0070673_100051755 3300005364 Bacteria 3219
61 Ga0070659_100000048 3300005366 Bacteria 98245
62 Ga0070659_100001228 3300005366 Bacteria 18614
63 Ga0070659_100003152 3300005366 Bacteria 11748
64 Ga0070659_100003697 3300005366 Bacteria 10913
65 Ga0070659_100005008 3300005366 Bacteria 9494
66 Ga0070659_100008557 3300005366 Bacteria 7481
67 Ga0070659_100049286 3300005366 Bacteria 3311
68 Ga0070667_100002041 3300005367 Bacteria 17901
69 Ga0070667_100002537 3300005367 Bacteria 15892
70 Ga0070667_100005391 3300005367 Bacteria 10683
71 Ga0070667_100027559 3300005367 Bacteria 4727
72 Ga0070667_100081330 3300005367 Bacteria 2772
73 Ga0070714_100026845 3300005435 Bacteria 4762
74 Ga0070714_100176331 3300005435 Bacteria 1942
75 Ga0070713_100029762 3300005436 Bacteria 4327
76 Ga0070694_100002933 3300005444 Bacteria 10139
77 Ga0070663_100021950 3300005455 Bacteria 4257
78 Ga0070678_100005521 3300005456 Bacteria 7324
79 Ga0070662_100000035 3300005457 Bacteria 77342
80 Ga0070662_100001109 3300005457 Bacteria 16441
81 Ga0070662_100009090 3300005457 Bacteria 6485
82 Ga0070662_100049594 3300005457 Bacteria 3028
83 Ga0068867_100016992 3300005459 Bacteria 5170
84 Ga0070679_100003857 3300005530 Bacteria 13770
85 Ga0070679_100031364 3300005530 Bacteria 5249
86 Ga0070679_100129373 3300005530 Bacteria 2506
87 Ga0070679_100138245 3300005530 Bacteria 2417
88 Ga0070684_100018452 3300005535 Bacteria 5747
89 Ga0068853_100001837 3300005539 Bacteria 15604
90 Ga0068853_100006999 3300005539 Bacteria 9013
91 Ga0068853_100032341 3300005539 Bacteria 4431
92 Ga0068853_100114591 3300005539 Bacteria 2398
93 Ga0068853_100142173 3300005539 Bacteria 2155
94 Ga0068853_100210333 3300005539 Bacteria 1773
95 Ga0070672_100002604 3300005543 Bacteria 11523
96 Ga0070672_100167058 3300005543 Bacteria 1828
97 Ga0070696_100015724 3300005546 Bacteria 5086
98 Ga0070693_100000718 3300005547 Bacteria 14586
99 Ga0070665_100005672 3300005548 Bacteria 12826
100 Ga0070665_100014071 3300005548 Bacteria 8044
101 Ga0070665_100026883 3300005548 Bacteria 5795
102 Ga0070665_100068981 3300005548 Bacteria 3544
103 Ga0068855_100008756 3300005563 Bacteria 12235
104 Ga0068855_100244120 3300005563 Bacteria 2005
105 Ga0070664_100000025 3300005564 Bacteria 93173
106 Ga0070664_100042316 3300005564 Bacteria 3846
107 Ga0070664_100059786 3300005564 Bacteria 3243
108 Ga0070664_100163406 3300005564 Bacteria 1971
109 Ga0068857_100022119 3300005577 Bacteria 5593
110 Ga0068857_100030116 3300005577 Bacteria 4789
111 Ga0068857_100058446 3300005577 Bacteria 3424
112 Ga0068854_100008500 3300005578 Bacteria 6604
113 Ga0068854_100017687 3300005578 Bacteria 4774
114 Ga0068854_100048861 3300005578 Bacteria 3020
115 Ga0068854_100067255 3300005578 Bacteria 2610
116 Ga0068854_100079728 3300005578 Bacteria 2415
117 Ga0068856_100000124 3300005614 Bacteria 77469
118 Ga0068856_100074158 3300005614 Bacteria 3369
119 Ga0068856_100088704 3300005614 Bacteria 3075
120 Ga0068856_100153620 3300005614 Bacteria 2311
121 Ga0068852_100000258 3300005616 Bacteria 35932
122 Ga0068852_100001677 3300005616 Bacteria 15079
123 Ga0068852_100018079 3300005616 Bacteria 5546
124 Ga0068852_100029111 3300005616 Bacteria 4532
125 Ga0068852_100066607 3300005616 Bacteria 3145
126 Ga0068852_100087037 3300005616 Bacteria 2786
127 Ga0068852_100090235 3300005616 Bacteria 2740
128 Ga0068859_100121237 3300005617 Bacteria 2681
129 Ga0068864_100000762 3300005618 Bacteria 27087
130 Ga0068864_100004606 3300005618 Bacteria 11313
131 Ga0068864_100084053 3300005618 Bacteria 2796
132 Ga0068864_100273241 3300005618 Bacteria 1575
133 Ga0068861_100240022 3300005719 Bacteria 1541
134 Ga0068863_100003982 3300005841 Bacteria 14586
135 Ga0068863_100006462 3300005841 Bacteria 11495
136 Ga0068863_100172789 3300005841 Bacteria 2073
137 Ga0068858_100006075 3300005842 Bacteria 11778
138 Ga0068858_100017918 3300005842 Bacteria 6632
139 Ga0068858_100064724 3300005842 Bacteria 3384
140 Ga0068860_100012609 3300005843 Bacteria 8319
141 Ga0068862_100007769 3300005844 Bacteria 8869
142 Ga0068862_100050515 3300005844 Bacteria 3554
143 Ga0081539_10037547 3300005985 Bacteria 2885
144 Ga0070717_10011680 3300006028 Bacteria 6677
145 Ga0097621_100006176 3300006237 Bacteria 8489
146 Ga0097621_100160944 3300006237 Bacteria 1930
147 Ga0068871_100093161 3300006358 Bacteria 2513
148 Ga0097620_100121233 3300006931 Bacteria 2681
149 Ga0105240_10015147 3300009093 Bacteria 10494
150 Ga0105245_10010277 3300009098 Bacteria 8147
151 Ga0105248_10000163 3300009177 Bacteria 77658
152 Ga0105248_10001027 3300009177 Bacteria 30888
153 Ga0105248_10003789 3300009177 Bacteria 16749
154 Ga0105248_10012356 3300009177 Bacteria 9422
155 Ga0105248_10017489 3300009177 Bacteria 7906
156 Ga0105237_10171433 3300009545 Bacteria 2170
157 Ga0105237_10192655 3300009545 Bacteria 2038
158 Ga0105238_10014401 3300009551 Bacteria 7994
159 Ga0105238_10019299 3300009551 Bacteria 6945
160 Ga0105238_10043309 3300009551 Bacteria 4555
161 Ga0105238_10184586 3300009551 Bacteria 2062
162 Ga0105238_10294685 3300009551 Bacteria 1605
163 Ga0105249_10009991 3300009553 Bacteria 8325
164 Ga0105239_10138658 3300010375 Bacteria 2709
165 Ga0157373_10008016 3300013100 Bacteria 7851
166 Ga0157373_10023886 3300013100 Bacteria 4430
167 Ga0157373_10031653 3300013100 Bacteria 3807
168 Ga0157373_10048833 3300013100 Bacteria 3017
169 Ga0157373_10054340 3300013100 Bacteria 2846
170 Ga0157371_10000722 3300013102 Bacteria 38724
171 Ga0157371_10012406 3300013102 Bacteria 6516
172 Ga0157371_10075429 3300013102 Bacteria 2388
173 Ga0157371_10093071 3300013102 Bacteria 2136
174 Ga0157370_10030708 3300013104 Bacteria 5263
175 Ga0157370_10121600 3300013104 Bacteria 2437
176 Ga0157369_10002441 3300013105 Bacteria 22331
177 Ga0157369_10009078 3300013105 Bacteria 11382
178 Ga0157369_10143094 3300013105 Bacteria 2529
179 Ga0157374_10001518 3300013296 Bacteria 19561
180 Ga0157374_10010533 3300013296 Bacteria 7956
181 Ga0157374_10059326 3300013296 Bacteria 3577
182 Ga0163162_10001258 3300013306 Bacteria 23693
183 Ga0163162_10015095 3300013306 Bacteria 7544
184 Ga0157372_10012201 3300013307 Bacteria 9153
185 Ga0157372_10049605 3300013307 Bacteria 4668
186 Ga0157372_10072635 3300013307 Bacteria 3877
187 Ga0157372_10346669 3300013307 Bacteria 1730
188 Ga0157375_10000994 3300013308 Bacteria 24466
189 Ga0163163_10000173 3300014325 Bacteria 67717
190 Ga0163163_10006707 3300014325 Bacteria 10089
191 Ga0163163_10018399 3300014325 Bacteria 6539
192 Ga0207656_10037058 3300025321 Bacteria 2050
193 Ga0207688_10021432 3300025901 Bacteria 3530
194 Ga0207680_10004951 3300025903 Bacteria 6344
195 Ga0207680_10008904 3300025903 Bacteria 4950
196 Ga0207680_10043888 3300025903 Bacteria 2625
197 Ga0207647_10000439 3300025904 Bacteria 34042
198 Ga0207647_10014577 3300025904 Bacteria 5416
199 Ga0207647_10015334 3300025904 Bacteria 5258
200 Ga0207647_10018127 3300025904 Bacteria 4771
201 Ga0207647_10044816 3300025904 Bacteria 2762
202 Ga0207647_10048460 3300025904 Bacteria 2638
203 Ga0207647_10050737 3300025904 Bacteria 2567
204 Ga0207645_10003349 3300025907 Bacteria 12219
205 Ga0207705_10000114 3300025909 Bacteria 90132
206 Ga0207705_10001046 3300025909 Bacteria 22488
207 Ga0207705_10002166 3300025909 Bacteria 15203
208 Ga0207705_10010067 3300025909 Bacteria 6882
209 Ga0207705_10016703 3300025909 Bacteria 5257
210 Ga0207705_10044634 3300025909 Bacteria 3185
211 Ga0207705_10081921 3300025909 Bacteria 2352
212 Ga0207707_10095953 3300025912 Bacteria 2591
213 Ga0207695_10074903 3300025913 Bacteria 3445
214 Ga0207695_10251393 3300025913 Bacteria 1667
215 Ga0207671_10062638 3300025914 Bacteria 2762
216 Ga0207660_10000480 3300025917 Bacteria 26573
217 Ga0207660_10017160 3300025917 Bacteria 4804
218 Ga0207660_10069389 3300025917 Bacteria 2559
219 Ga0207660_10201024 3300025917 Bacteria 1556
220 Ga0207657_10000071 3300025919 Bacteria 93725
221 Ga0207657_10000969 3300025919 Bacteria 30447
222 Ga0207657_10001850 3300025919 Bacteria 22857
223 Ga0207657_10003486 3300025919 Bacteria 16785
224 Ga0207657_10006355 3300025919 Bacteria 12274
225 Ga0207657_10006447 3300025919 Bacteria 12159
226 Ga0207657_10014323 3300025919 Bacteria 7746
227 Ga0207649_10010422 3300025920 Bacteria 5107
228 Ga0207649_10014042 3300025920 Bacteria 4482
229 Ga0207649_10030760 3300025920 Bacteria 3183
230 Ga0207652_10032675 3300025921 Bacteria 4377
231 Ga0207652_10047780 3300025921 Bacteria 3656
232 Ga0207652_10231380 3300025921 Bacteria 1666
233 Ga0207652_10231736 3300025921 Bacteria 1664
234 Ga0207681_10004417 3300025923 Bacteria 8665
235 Ga0207694_10001010 3300025924 Bacteria 24549
236 Ga0207694_10053966 3300025924 Bacteria 3117
237 Ga0207650_10009501 3300025925 Bacteria 6646
238 Ga0207650_10046830 3300025925 Bacteria 3185
239 Ga0207650_10053090 3300025925 Bacteria 3004
240 Ga0207650_10076544 3300025925 Bacteria 2528
241 Ga0207687_10145484 3300025927 Bacteria 1803
242 Ga0207700_10069001 3300025928 Bacteria 2711
243 Ga0207644_10000848 3300025931 Bacteria 19364
244 Ga0207644_10000966 3300025931 Bacteria 18344
245 Ga0207644_10004061 3300025931 Bacteria 9493
246 Ga0207690_10000036 3300025932 Bacteria 143853
247 Ga0207690_10001344 3300025932 Bacteria 15448
248 Ga0207690_10002399 3300025932 Bacteria 11345
249 Ga0207690_10004900 3300025932 Bacteria 7896
250 Ga0207690_10006308 3300025932 Bacteria 7025
251 Ga0207690_10080825 3300025932 Bacteria 2269
252 Ga0207706_10000086 3300025933 Bacteria 95284
253 Ga0207706_10003663 3300025933 Bacteria 14675
254 Ga0207706_10005540 3300025933 Bacteria 11774
255 Ga0207706_10005698 3300025933 Bacteria 11605
256 Ga0207706_10007869 3300025933 Bacteria 9838
257 Ga0207706_10056689 3300025933 Bacteria 3454
258 Ga0207706_10142249 3300025933 Bacteria 2110
259 Ga0207709_10107772 3300025935 Bacteria 1856
260 Ga0207665_10029535 3300025939 Bacteria 3623
261 Ga0207691_10000780 3300025940 Bacteria 31583
262 Ga0207691_10007278 3300025940 Bacteria 10676
263 Ga0207691_10027933 3300025940 Bacteria 5285
264 Ga0207711_10002528 3300025941 Bacteria 16287
265 Ga0207711_10003705 3300025941 Bacteria 13172
266 Ga0207711_10004689 3300025941 Bacteria 11614
267 Ga0207711_10005802 3300025941 Bacteria 10432
268 Ga0207711_10022211 3300025941 Bacteria 5306
269 Ga0207711_10078493 3300025941 Bacteria 2880
270 Ga0207689_10062927 3300025942 Bacteria 3052
271 Ga0207661_10001356 3300025944 Bacteria 16422
272 Ga0207661_10051296 3300025944 Bacteria 3291
273 Ga0207661_10079506 3300025944 Bacteria 2702
274 Ga0207679_10001003 3300025945 Bacteria 18128
275 Ga0207679_10006995 3300025945 Bacteria 7152
276 Ga0207679_10027040 3300025945 Bacteria 3963
277 Ga0207679_10065822 3300025945 Bacteria 2714
278 Ga0207667_10003552 3300025949 Bacteria 19285
279 Ga0207667_10007513 3300025949 Bacteria 13084
280 Ga0207667_10010120 3300025949 Bacteria 11048
281 Ga0207667_10083122 3300025949 Bacteria 3316
282 Ga0207651_10008228 3300025960 Bacteria 5620
283 Ga0207651_10022739 3300025960 Bacteria 3841
284 Ga0207651_10040993 3300025960 Bacteria 3069
285 Ga0207712_10000474 3300025961 Bacteria 33783
286 Ga0207668_10000021 3300025972 Bacteria 137592
287 Ga0207640_10006316 3300025981 Bacteria 6498
288 Ga0207640_10023105 3300025981 Bacteria 3733
289 Ga0207640_10028998 3300025981 Bacteria 3391
290 Ga0207658_10003141 3300025986 Bacteria 11817
291 Ga0207658_10005418 3300025986 Bacteria 8750
292 Ga0207658_10040539 3300025986 Bacteria 3367
293 Ga0207658_10095398 3300025986 Bacteria 2317
294 Ga0207677_10078001 3300026023 Bacteria 2364
295 Ga0207703_10002922 3300026035 Bacteria 14543
296 Ga0207703_10019739 3300026035 Bacteria 5269
297 Ga0207703_10031558 3300026035 Bacteria 4190
298 Ga0207639_10000181 3300026041 Bacteria 49444
299 Ga0207639_10002533 3300026041 Bacteria 12261
300 Ga0207639_10028000 3300026041 Bacteria 4109
301 Ga0207639_10060029 3300026041 Bacteria 2933
302 Ga0207639_10118646 3300026041 Bacteria 2170
303 Ga0207678_10001267 3300026067 Bacteria 23344
304 Ga0207678_10013484 3300026067 Bacteria 7176
305 Ga0207678_10016501 3300026067 Bacteria 6484
306 Ga0207678_10019808 3300026067 Bacteria 5916
307 Ga0207678_10036149 3300026067 Bacteria 4300
308 Ga0207702_10000254 3300026078 Bacteria 61680
309 Ga0207702_10045877 3300026078 Bacteria 3677
310 Ga0207702_10122274 3300026078 Bacteria 2331
311 Ga0207641_10002878 3300026088 Bacteria 15597
312 Ga0207641_10009836 3300026088 Bacteria 7875
313 Ga0207641_10043924 3300026088 Bacteria 3756
314 Ga0207641_10079341 3300026088 Bacteria 2845
315 Ga0207641_10109698 3300026088 Bacteria 2444
316 Ga0207641_10166303 3300026088 Bacteria 2009
317 Ga0207648_10001456 3300026089 Bacteria 26049
318 Ga0207676_10001750 3300026095 Bacteria 15934
319 Ga0207676_10006168 3300026095 Bacteria 8464
320 Ga0207676_10008195 3300026095 Bacteria 7435
321 Ga0207676_10056198 3300026095 Bacteria 3094
322 Ga0207674_10005849 3300026116 Bacteria 14585
323 Ga0207674_10010262 3300026116 Bacteria 10627
324 Ga0207674_10015727 3300026116 Bacteria 8302
325 Ga0207674_10016271 3300026116 Bacteria 8146
326 Ga0207674_10035924 3300026116 Bacteria 5168
327 Ga0207674_10094309 3300026116 Bacteria 2979
328 Ga0207683_10000430 3300026121 Bacteria 38851
329 Ga0207683_10023224 3300026121 Bacteria 5331
330 Ga0207698_10002083 3300026142 Bacteria 11797
331 Ga0207698_10003489 3300026142 Bacteria 9482
332 Ga0207698_10006944 3300026142 Bacteria 7085
333 Ga0207698_10027766 3300026142 Bacteria 4024
334 Ga0207698_10043719 3300026142 Bacteria 3359
335 Ga0207698_10189227 3300026142 Bacteria 1831
336 Ga0268266_10000318 3300028379 Bacteria 76400
337 Ga0268266_10031406 3300028379 Bacteria 4510
338 Ga0268266_10035679 3300028379 Bacteria 4230
339 Ga0268265_10004300 3300028380 Bacteria 9937
340 Ga0268265_10005129 3300028380 Bacteria 8968
341 Ga0268265_10021934 3300028380 Bacteria 4481
342 Ga0268265_10040095 3300028380 Bacteria 3456
343 Ga0268264_10012695 3300028381 Bacteria 6934
344 Ga0307513_10223999 3300031456 Bacteria 1699
345 Ga0307405_10041740 3300031731 Bacteria 2787
346 Ga0307405_10088820 3300031731 Bacteria 2040
347 Ga0307413_10029190 3300031824 Bacteria 3082
348 Ga0307410_10016519 3300031852 Bacteria 4405
349 Ga0307410_10072329 3300031852 Bacteria 2394
350 Ga0307410_10135390 3300031852 Bacteria 1815
351 Ga0307406_10022473 3300031901 Bacteria 3742
352 Ga0307407_10003183 3300031903 Bacteria 6654
353 Ga0307407_10078505 3300031903 Bacteria 1989
354 Ga0307409_100009254 3300031995 Bacteria 6041
355 Ga0307409_100115957 3300031995 Bacteria 2256
356 Ga0307409_100232153 3300031995 Bacteria 1673
357 Ga0307416_100030889 3300032002 Bacteria 4026
358 Ga0307414_10013917 3300032004 Bacteria 4803
359 Ga0307414_10026075 3300032004 Bacteria 3756
360 Ga0307414_10204326 3300032004 Bacteria 1609
361 Ga0307411_10004282 3300032005 Bacteria 6808
362 Ga0307411_10036096 3300032005 Bacteria 3093
363 Ga0307411_10048786 3300032005 Bacteria 2747
364 Ga0307411_10084810 3300032005 Bacteria 2192
365 Ga0307411_10096558 3300032005 Bacteria 2077
366 Ga0307415_100003507 3300032126 Bacteria 7995
367 Ga0307415_100004482 3300032126 Bacteria 7253
368 Ga0395899_0001755 3300037312 Bacteria 18000
369 Ga0395899_0015845 3300037312 Bacteria 5747
370 Ga0395899_0021978 3300037312 Bacteria 4838
371 Ga0395899_0024244 3300037312 Bacteria 4588
372 Ga0395899_0029005 3300037312 Bacteria 4163
373 Ga0395899_0043711 3300037312 Bacteria 3340
374 Ga0395899_0077725 3300037312 Bacteria 2420
375 Ga0395899_0088685 3300037312 Bacteria 2243
376 Ga0395899_0150180 3300037312 Bacteria 1652
377 Ga0395900_0001160 3300037418 Bacteria 32963
378 Ga0395900_0001294 3300037418 Bacteria 30486
379 Ga0395900_0002862 3300037418 Bacteria 18816
380 Ga0395900_0002924 3300037418 Bacteria 18608
381 Ga0395900_0014026 3300037418 Bacteria 8183
382 Ga0395900_0024736 3300037418 Bacteria 6146
383 Ga0395900_0047444 3300037418 Bacteria 4422
384 Ga0395900_0052467 3300037418 Bacteria 4197
385 Ga0395900_0060925 3300037418 Bacteria 3882
386 Ga0395900_0062672 3300037418 Bacteria 3822
387 Ga0395900_0074303 3300037418 Bacteria 3495
388 Ga0395900_0095723 3300037418 Bacteria 3050
389 Ga0395900_0181571 3300037418 Bacteria 2138
390 Ga0395900_0245268 3300037418 Bacteria 1795
391 Ga0395898_0003838 3300037466 Bacteria 16653
392 Ga0395898_0009643 3300037466 Bacteria 10136
393 Ga0395898_0025373 3300037466 Bacteria 5973
394 Ga0395898_0033483 3300037466 Bacteria 5127
395 Ga0395898_0039337 3300037466 Bacteria 4681
396 Ga0395898_0060688 3300037466 Bacteria 3674
397 Ga0395905_0002083 3300037471 Bacteria 22749
398 Ga0395905_0003105 3300037471 Bacteria 17939
399 Ga0395905_0005327 3300037471 Bacteria 13147
400 Ga0395905_0006273 3300037471 Bacteria 11999
401 Ga0395905_0009943 3300037471 Bacteria 9269
402 Ga0395905_0010357 3300037471 Bacteria 9078
403 Ga0395905_0018669 3300037471 Bacteria 6577
404 Ga0395905_0019640 3300037471 Bacteria 6404
405 Ga0395905_0021348 3300037471 Bacteria 6124
406 Ga0395905_0035506 3300037471 Bacteria 4681
407 Ga0395905_0056025 3300037471 Bacteria 3689
408 Ga0395905_0058895 3300037471 Bacteria 3591
409 Ga0395905_0061535 3300037471 Bacteria 3512
410 Ga0395905_0061905 3300037471 Bacteria 3500
411 Ga0395905_0108282 3300037471 Bacteria 2608
412 Ga0395905_0131722 3300037471 Bacteria 2351
413 Ga0395901_0003671 3300038443 Bacteria 15477
414 Ga0395901_0004243 3300038443 Bacteria 14457
415 Ga0395901_0006960 3300038443 Bacteria 11425
416 Ga0395901_0022491 3300038443 Bacteria 6463
417 Ga0395901_0032257 3300038443 Bacteria 5405
418 Ga0395901_0033324 3300038443 Bacteria 5318
419 Ga0395901_0034316 3300038443 Bacteria 5239
420 Ga0395901_0043535 3300038443 Bacteria 4657
421 Ga0395901_0060625 3300038443 Bacteria 3937
422 Ga0395901_0086110 3300038443 Bacteria 3285
423 Ga0395901_0086482 3300038443 Bacteria 3278
424 Ga0395901_0088845 3300038443 Bacteria 3233
425 Ga0395901_0094834 3300038443 Bacteria 3126
426 Ga0395901_0097261 3300038443 Bacteria 3085
427 Ga0395901_0190573 3300038443 Bacteria 2150
428 Ga0395901_0210265 3300038443 Bacteria 2036
429 Ga0439455_0006912 3300042012 Bacteria 2378
430 Ga0439458_0001603 3300042157 Bacteria 5653
431 Ga0439458_0003722 3300042157 Bacteria 3535
432 Ga0466969_0008330 3300044656 Bacteria 5499
433 Ga0466966_0004129 3300044684 Bacteria 9588
434 Ga0466966_0048464 3300044684 Bacteria 2706
435 Ga0466966_0049385 3300044684 Bacteria 2680
436 Ga0466961_0002424 3300044693 Bacteria 11575
437 Ga0466961_0022371 3300044693 Bacteria 4066
438 Ga0466961_0041537 3300044693 Bacteria 2949
439 Ga0466963_0008434 3300044694 Bacteria 6173
440 Ga0466963_0020722 3300044694 Bacteria 4137
441 Ga0466963_0020936 3300044694 Bacteria 4120
442 Ga0466963_0023436 3300044694 Bacteria 3921
443 Ga0466963_0043221 3300044694 Bacteria 2961
444 Ga0466971_0020132 3300044719 Bacteria 2965
445 Ga0466971_0021817 3300044719 Bacteria 2850
446 Ga0466957_0003787 3300044842 Bacteria 8359
447 Ga0466957_0046594 3300044842 Bacteria 2632
448 Ga0466957_0077953 3300044842 Bacteria 2059
449 Ga0466960_0039264 3300044901 Bacteria 2232
450 Ga0466959_0128468 3300045049 Bacteria 1797
451 Ga0466959_0135723 3300045049 Bacteria 1741
452 Ga0466959_0157786 3300045049 Bacteria 1596
453 Ga0466958_0001810 3300045836 Bacteria 10372
454 Ga0466967_0010486 3300045976 Bacteria 6956
455 Ga0466967_0069810 3300045976 Bacteria 3141
456 Ga0466967_0206986 3300045976 Bacteria 1860
457 Ga0496101_0036899 3300048904 Bacteria 3464
458 Ga0496101_0041652 3300048904 Bacteria 3275
459 Ga0496106_0003705 3300048909 Bacteria 11403
460 Ga0496107_0008249 3300048910 Bacteria 7209
461 Ga0496107_0031300 3300048910 Bacteria 3796
462 Ga0496108_0003999 3300048911 Bacteria 11826
463 Ga0496108_0028436 3300048911 Bacteria 4626
464 Ga0496108_0053933 3300048911 Bacteria 3373
465 Ga0496109_0002175 3300048912 Bacteria 16290
466 Ga0496109_0088703 3300048912 Bacteria 2858
467 Ga0496110_0001640 3300048913 Bacteria 16421
468 Ga0496110_0018858 3300048913 Bacteria 5795
469 Ga0496111_0000805 3300048914 Bacteria 16836
470 Ga0496111_0011651 3300048914 Bacteria 5933
471 Ga0496112_0053771 3300048915 Bacteria 3955
472 Ga0496112_0084776 3300048915 Bacteria 3134
473 Ga0496113_0002011 3300048916 Bacteria 11667
474 Ga0496113_0074995 3300048916 Bacteria 2580
475 nmdc:mga08y16_30937_c1 3300050511 Bacteria 5628
476 nmdc:mga0a205_248_c1 3300050515 Bacteria 38486
477 Ga0500573_0000042 3300053140 Bacteria 103567
478 Ga0466962_0006842 3300061719 Bacteria 5471
479 Ga0466962_0008622 3300061719 Bacteria 4887
480 Ga0466962_0053479 3300061719 Bacteria 1930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042012 Ga0439455_0006912 Ga0439455_0006912_42_1244 400
2 3300025935 Ga0207709_10107772 Ga0207709_101077721 425
3 3300005327 Ga0070658_10064458 Ga0070658_100644582 446
4 3300005435 Ga0070714_100026845 Ga0070714_1000268454 447
5 3300042157 Ga0439458_0003722 Ga0439458_0003722_1409_2803 453
6 3300037418 Ga0395900_0060925 Ga0395900_0060925_1591_2988 456
7 3300037471 Ga0395905_0058895 Ga0395905_0058895_1156_2553 456
8 3300005356 Ga0070674_100040224 Ga0070674_1000402243 457
9 3300005546 Ga0070696_100015724 Ga0070696_1000157247 457
10 3300005985 Ga0081539_10037547 Ga0081539_100375473 457
11 3300050511 nmdc:mga08y16_30937_c1 nmdc:mga08y16_30937_c1_1384_2781 457
12 3300053140 Ga0500573_0000042 Ga0500573_0000042_54378_55766 460
13 3300005327 Ga0070658_10020680 Ga0070658_100206805 462
14 3300005329 Ga0070683_100081770 Ga0070683_1000817702 462
15 3300005331 Ga0070670_100010495 Ga0070670_1000104952 462
16 3300005339 Ga0070660_100147625 Ga0070660_1001476252 462
17 3300005344 Ga0070661_100033294 Ga0070661_1000332942 462
18 3300005364 Ga0070673_100005946 Ga0070673_1000059468 462
19 3300005367 Ga0070667_100002537 Ga0070667_10000253713 462
20 3300005548 Ga0070665_100005672 Ga0070665_1000056728 462
21 3300005578 Ga0068854_100017687 Ga0068854_1000176873 462
22 3300005616 Ga0068852_100090235 Ga0068852_1000902352 462
23 3300025919 Ga0207657_10000969 Ga0207657_1000096924 462
24 3300025925 Ga0207650_10046830 Ga0207650_100468302 462
25 3300025932 Ga0207690_10080825 Ga0207690_100808252 462
26 3300025933 Ga0207706_10005698 Ga0207706_100056988 462
27 3300025960 Ga0207651_10022739 Ga0207651_100227392 462
28 3300025986 Ga0207658_10003141 Ga0207658_100031415 462
29 3300026067 Ga0207678_10001267 Ga0207678_1000126710 462
30 3300028379 Ga0268266_10031406 Ga0268266_100314062 462
31 3300048910 Ga0496107_0031300 Ga0496107_0031300_1194_2582 462
32 3300005329 Ga0070683_100202366 Ga0070683_1002023662 463
33 3300005344 Ga0070661_100028278 Ga0070661_1000282783 463
34 3300005366 Ga0070659_100008557 Ga0070659_1000085573 463
35 3300005578 Ga0068854_100079728 Ga0068854_1000797284 463
36 3300005616 Ga0068852_100087037 Ga0068852_1000870373 463
37 3300013296 Ga0157374_10059326 Ga0157374_100593262 463
38 3300025909 Ga0207705_10001046 Ga0207705_100010465 463
39 3300025920 Ga0207649_10014042 Ga0207649_100140423 463
40 3300025921 Ga0207652_10231380 Ga0207652_102313802 463
41 3300026067 Ga0207678_10016501 Ga0207678_100165014 463
42 3300031903 Ga0307407_10078505 Ga0307407_100785053 463
43 3300032005 Ga0307411_10048786 Ga0307411_100487862 463
44 3300002067 JGI24735J21928_10001805 JGI24735J21928_100018053 464
45 3300005327 Ga0070658_10099858 Ga0070658_100998582 464
46 3300005327 Ga0070658_10140439 Ga0070658_101404392 464
47 3300005336 Ga0070680_100008685 Ga0070680_1000086856 464
48 3300005339 Ga0070660_100003291 Ga0070660_1000032919 464
49 3300005339 Ga0070660_100035557 Ga0070660_1000355572 464
50 3300005344 Ga0070661_100034112 Ga0070661_1000341121 464
51 3300005344 Ga0070661_100074594 Ga0070661_1000745942 464
52 3300005366 Ga0070659_100003697 Ga0070659_1000036977 464
53 3300005366 Ga0070659_100005008 Ga0070659_1000050086 464
54 3300005459 Ga0068867_100016992 Ga0068867_1000169926 464
55 3300005539 Ga0068853_100006999 Ga0068853_1000069996 464
56 3300005539 Ga0068853_100114591 Ga0068853_1001145912 464
57 3300005539 Ga0068853_100210333 Ga0068853_1002103332 464
58 3300005564 Ga0070664_100163406 Ga0070664_1001634062 464
59 3300005616 Ga0068852_100001677 Ga0068852_10000167719 464
60 3300005616 Ga0068852_100018079 Ga0068852_1000180797 464
61 3300009093 Ga0105240_10015147 Ga0105240_100151474 464
62 3300009551 Ga0105238_10014401 Ga0105238_100144014 464
63 3300013100 Ga0157373_10008016 Ga0157373_100080167 464
64 3300013100 Ga0157373_10031653 Ga0157373_100316531 464
65 3300013105 Ga0157369_10002441 Ga0157369_1000244122 464
66 3300013105 Ga0157369_10143094 Ga0157369_101430942 464
67 3300013307 Ga0157372_10012201 Ga0157372_100122015 464
68 3300025321 Ga0207656_10037058 Ga0207656_100370583 464
69 3300025904 Ga0207647_10018127 Ga0207647_100181276 464
70 3300025909 Ga0207705_10016703 Ga0207705_100167037 464
71 3300025909 Ga0207705_10044634 Ga0207705_100446342 464
72 3300025917 Ga0207660_10017160 Ga0207660_100171605 464
73 3300025917 Ga0207660_10201024 Ga0207660_102010241 464
74 3300025919 Ga0207657_10003486 Ga0207657_100034867 464
75 3300025919 Ga0207657_10006447 Ga0207657_100064478 464
76 3300025920 Ga0207649_10010422 Ga0207649_100104223 464
77 3300025920 Ga0207649_10030760 Ga0207649_100307601 464
78 3300025924 Ga0207694_10001010 Ga0207694_1000101019 464
79 3300025932 Ga0207690_10004900 Ga0207690_100049002 464
80 3300025949 Ga0207667_10007513 Ga0207667_1000751310 464
81 3300025981 Ga0207640_10028998 Ga0207640_100289985 464
82 3300026023 Ga0207677_10078001 Ga0207677_100780012 464
83 3300026041 Ga0207639_10000181 Ga0207639_100001819 464
84 3300026041 Ga0207639_10028000 Ga0207639_100280005 464
85 3300026041 Ga0207639_10118646 Ga0207639_101186462 464
86 3300026116 Ga0207674_10016271 Ga0207674_100162713 464
87 3300026142 Ga0207698_10003489 Ga0207698_100034892 464
88 3300026142 Ga0207698_10189227 Ga0207698_101892271 464
89 3300028379 Ga0268266_10000318 Ga0268266_1000031856 464
90 3300031731 Ga0307405_10088820 Ga0307405_100888201 464
91 3300031824 Ga0307413_10029190 Ga0307413_100291902 464
92 3300031852 Ga0307410_10016519 Ga0307410_100165194 464
93 3300031852 Ga0307410_10072329 Ga0307410_100723291 464
94 3300031903 Ga0307407_10003183 Ga0307407_100031832 464
95 3300031995 Ga0307409_100115957 Ga0307409_1001159572 464
96 3300032004 Ga0307414_10013917 Ga0307414_100139172 464
97 3300032005 Ga0307411_10004282 Ga0307411_100042822 464
98 3300032005 Ga0307411_10084810 Ga0307411_100848103 464
99 3300032005 Ga0307411_10096558 Ga0307411_100965582 464
100 3300037312 Ga0395899_0015845 Ga0395899_0015845_1245_2639 464
101 3300037418 Ga0395900_0002924 Ga0395900_0002924_13079_14473 464
102 3300037418 Ga0395900_0014026 Ga0395900_0014026_3644_5038 464
103 3300037418 Ga0395900_0062672 Ga0395900_0062672_384_1778 464
104 3300037466 Ga0395898_0025373 Ga0395898_0025373_3413_4807 464
105 3300037466 Ga0395898_0033483 Ga0395898_0033483_2087_3481 464
106 3300037471 Ga0395905_0002083 Ga0395905_0002083_19812_21206 464
107 3300037471 Ga0395905_0005327 Ga0395905_0005327_11188_12582 464
108 3300037471 Ga0395905_0021348 Ga0395905_0021348_4118_5512 464
109 3300038443 Ga0395901_0003671 Ga0395901_0003671_5762_7156 464
110 3300038443 Ga0395901_0060625 Ga0395901_0060625_505_1899 464
111 3300038443 Ga0395901_0097261 Ga0395901_0097261_1368_2762 464
112 3300038443 Ga0395901_0190573 Ga0395901_0190573_599_1993 464
113 3300038443 Ga0395901_0210265 Ga0395901_0210265_485_1879 464
114 3300044694 Ga0466963_0020722 Ga0466963_0020722_249_1643 464
115 3300045976 Ga0466967_0010486 Ga0466967_0010486_3020_4414 464
116 3300001990 JGI24737J22298_10006819 JGI24737J22298_100068192 465
117 3300001990 JGI24737J22298_10007596 JGI24737J22298_100075965 465
118 3300005327 Ga0070658_10039574 Ga0070658_100395742 465
119 3300005327 Ga0070658_10103671 Ga0070658_101036712 465
120 3300005327 Ga0070658_10122666 Ga0070658_101226662 465
121 3300005328 Ga0070676_10011061 Ga0070676_100110615 465
122 3300005329 Ga0070683_100018994 Ga0070683_1000189944 465
123 3300005329 Ga0070683_100230123 Ga0070683_1002301231 465
124 3300005331 Ga0070670_100000504 Ga0070670_10000050426 465
125 3300005331 Ga0070670_100032951 Ga0070670_1000329513 465
126 3300005331 Ga0070670_100102824 Ga0070670_1001028241 465
127 3300005335 Ga0070666_10000838 Ga0070666_1000083815 465
128 3300005335 Ga0070666_10020715 Ga0070666_100207152 465
129 3300005335 Ga0070666_10040756 Ga0070666_100407563 465
130 3300005336 Ga0070680_100000991 Ga0070680_10000099128 465
131 3300005336 Ga0070680_100015200 Ga0070680_1000152004 465
132 3300005336 Ga0070680_100058866 Ga0070680_1000588665 465
133 3300005338 Ga0068868_100031256 Ga0068868_1000312564 465
134 3300005339 Ga0070660_100016422 Ga0070660_1000164222 465
135 3300005341 Ga0070691_10021727 Ga0070691_100217272 465
136 3300005344 Ga0070661_100003146 Ga0070661_10000314613 465
137 3300005344 Ga0070661_100067736 Ga0070661_1000677362 465
138 3300005345 Ga0070692_10003865 Ga0070692_100038654 465
139 3300005347 Ga0070668_100000311 Ga0070668_10000031126 465
140 3300005347 Ga0070668_100052251 Ga0070668_1000522515 465
141 3300005353 Ga0070669_100046578 Ga0070669_1000465782 465
142 3300005353 Ga0070669_100163945 Ga0070669_1001639452 465
143 3300005355 Ga0070671_100002820 Ga0070671_1000028207 465
144 3300005355 Ga0070671_100063815 Ga0070671_1000638153 465
145 3300005355 Ga0070671_100068897 Ga0070671_1000688971 465
146 3300005364 Ga0070673_100002844 Ga0070673_10000284410 465
147 3300005364 Ga0070673_100039066 Ga0070673_1000390664 465
148 3300005364 Ga0070673_100051755 Ga0070673_1000517552 465
149 3300005366 Ga0070659_100001228 Ga0070659_1000012284 465
150 3300005366 Ga0070659_100003152 Ga0070659_1000031528 465
151 3300005366 Ga0070659_100049286 Ga0070659_1000492865 465
152 3300005367 Ga0070667_100005391 Ga0070667_1000053913 465
153 3300005367 Ga0070667_100027559 Ga0070667_1000275596 465
154 3300005367 Ga0070667_100081330 Ga0070667_1000813301 465
155 3300005435 Ga0070714_100176331 Ga0070714_1001763312 465
156 3300005436 Ga0070713_100029762 Ga0070713_1000297624 465
157 3300005444 Ga0070694_100002933 Ga0070694_10000293310 465
158 3300005456 Ga0070678_100005521 Ga0070678_1000055218 465
159 3300005457 Ga0070662_100001109 Ga0070662_10000110910 465
160 3300005457 Ga0070662_100009090 Ga0070662_1000090906 465
161 3300005457 Ga0070662_100049594 Ga0070662_1000495944 465
162 3300005530 Ga0070679_100003857 Ga0070679_1000038576 465
163 3300005530 Ga0070679_100031364 Ga0070679_1000313644 465
164 3300005530 Ga0070679_100129373 Ga0070679_1001293732 465
165 3300005530 Ga0070679_100138245 Ga0070679_1001382451 465
166 3300005539 Ga0068853_100032341 Ga0068853_1000323416 465
167 3300005539 Ga0068853_100142173 Ga0068853_1001421732 465
168 3300005543 Ga0070672_100002604 Ga0070672_1000026047 465
169 3300005543 Ga0070672_100167058 Ga0070672_1001670582 465
170 3300005548 Ga0070665_100026883 Ga0070665_1000268834 465
171 3300005548 Ga0070665_100068981 Ga0070665_1000689813 465
172 3300005563 Ga0068855_100244120 Ga0068855_1002441202 465
173 3300005564 Ga0070664_100042316 Ga0070664_1000423166 465
174 3300005564 Ga0070664_100059786 Ga0070664_1000597862 465
175 3300005577 Ga0068857_100022119 Ga0068857_1000221191 465
176 3300005577 Ga0068857_100030116 Ga0068857_1000301161 465
177 3300005577 Ga0068857_100058446 Ga0068857_1000584465 465
178 3300005578 Ga0068854_100008500 Ga0068854_1000085004 465
179 3300005578 Ga0068854_100067255 Ga0068854_1000672552 465
180 3300005614 Ga0068856_100074158 Ga0068856_1000741584 465
181 3300005614 Ga0068856_100088704 Ga0068856_1000887043 465
182 3300005614 Ga0068856_100153620 Ga0068856_1001536202 465
183 3300005616 Ga0068852_100029111 Ga0068852_1000291112 465
184 3300005616 Ga0068852_100066607 Ga0068852_1000666073 465
185 3300005617 Ga0068859_100121237 Ga0068859_1001212372 465
186 3300005618 Ga0068864_100000762 Ga0068864_10000076214 465
187 3300005618 Ga0068864_100004606 Ga0068864_10000460614 465
188 3300005618 Ga0068864_100084053 Ga0068864_1000840532 465
189 3300005719 Ga0068861_100240022 Ga0068861_1002400221 465
190 3300005841 Ga0068863_100003982 Ga0068863_10000398210 465
191 3300005841 Ga0068863_100006462 Ga0068863_1000064629 465
192 3300005841 Ga0068863_100172789 Ga0068863_1001727892 465
193 3300005842 Ga0068858_100006075 Ga0068858_1000060754 465
194 3300005842 Ga0068858_100017918 Ga0068858_1000179182 465
195 3300005842 Ga0068858_100064724 Ga0068858_1000647244 465
196 3300005843 Ga0068860_100012609 Ga0068860_1000126095 465
197 3300005844 Ga0068862_100007769 Ga0068862_1000077696 465
198 3300005844 Ga0068862_100050515 Ga0068862_1000505152 465
199 3300006028 Ga0070717_10011680 Ga0070717_100116802 465
200 3300006237 Ga0097621_100006176 Ga0097621_1000061766 465
201 3300006237 Ga0097621_100160944 Ga0097621_1001609442 465
202 3300006358 Ga0068871_100093161 Ga0068871_1000931614 465
203 3300006931 Ga0097620_100121233 Ga0097620_1001212333 465
204 3300009098 Ga0105245_10010277 Ga0105245_100102771 465
205 3300009177 Ga0105248_10001027 Ga0105248_1000102730 465
206 3300009177 Ga0105248_10003789 Ga0105248_1000378920 465
207 3300009177 Ga0105248_10012356 Ga0105248_100123562 465
208 3300009177 Ga0105248_10017489 Ga0105248_100174894 465
209 3300009545 Ga0105237_10171433 Ga0105237_101714331 465
210 3300009545 Ga0105237_10192655 Ga0105237_101926552 465
211 3300009551 Ga0105238_10043309 Ga0105238_100433094 465
212 3300009551 Ga0105238_10184586 Ga0105238_101845862 465
213 3300009551 Ga0105238_10294685 Ga0105238_102946851 465
214 3300009553 Ga0105249_10009991 Ga0105249_100099916 465
215 3300010375 Ga0105239_10138658 Ga0105239_101386582 465
216 3300013100 Ga0157373_10023886 Ga0157373_100238865 465
217 3300013100 Ga0157373_10048833 Ga0157373_100488331 465
218 3300013100 Ga0157373_10054340 Ga0157373_100543402 465
219 3300013102 Ga0157371_10012406 Ga0157371_100124063 465
220 3300013102 Ga0157371_10075429 Ga0157371_100754292 465
221 3300013102 Ga0157371_10093071 Ga0157371_100930712 465
222 3300013104 Ga0157370_10030708 Ga0157370_100307083 465
223 3300013104 Ga0157370_10121600 Ga0157370_101216004 465
224 3300013105 Ga0157369_10009078 Ga0157369_1000907812 465
225 3300013296 Ga0157374_10001518 Ga0157374_1000151814 465
226 3300013306 Ga0163162_10001258 Ga0163162_1000125813 465
227 3300013306 Ga0163162_10015095 Ga0163162_100150955 465
228 3300013307 Ga0157372_10049605 Ga0157372_100496053 465
229 3300013307 Ga0157372_10072635 Ga0157372_100726354 465
230 3300013307 Ga0157372_10346669 Ga0157372_103466692 465
231 3300013308 Ga0157375_10000994 Ga0157375_100009943 465
232 3300014325 Ga0163163_10006707 Ga0163163_100067077 465
233 3300014325 Ga0163163_10018399 Ga0163163_100183996 465
234 3300025901 Ga0207688_10021432 Ga0207688_100214324 465
235 3300025903 Ga0207680_10008904 Ga0207680_100089045 465
236 3300025903 Ga0207680_10043888 Ga0207680_100438882 465
237 3300025904 Ga0207647_10000439 Ga0207647_100004396 465
238 3300025904 Ga0207647_10015334 Ga0207647_100153341 465
239 3300025904 Ga0207647_10044816 Ga0207647_100448162 465
240 3300025904 Ga0207647_10048460 Ga0207647_100484602 465
241 3300025904 Ga0207647_10050737 Ga0207647_100507372 465
242 3300025907 Ga0207645_10003349 Ga0207645_100033497 465
243 3300025909 Ga0207705_10002166 Ga0207705_100021665 465
244 3300025909 Ga0207705_10010067 Ga0207705_100100674 465
245 3300025909 Ga0207705_10081921 Ga0207705_100819211 465
246 3300025912 Ga0207707_10095953 Ga0207707_100959534 465
247 3300025913 Ga0207695_10074903 Ga0207695_100749034 465
248 3300025913 Ga0207695_10251393 Ga0207695_102513931 465
249 3300025914 Ga0207671_10062638 Ga0207671_100626384 465
250 3300025917 Ga0207660_10000480 Ga0207660_1000048030 465
251 3300025917 Ga0207660_10069389 Ga0207660_100693893 465
252 3300025919 Ga0207657_10001850 Ga0207657_1000185026 465
253 3300025919 Ga0207657_10006355 Ga0207657_100063558 465
254 3300025919 Ga0207657_10014323 Ga0207657_100143238 465
255 3300025921 Ga0207652_10032675 Ga0207652_100326754 465
256 3300025921 Ga0207652_10047780 Ga0207652_100477803 465
257 3300025921 Ga0207652_10231736 Ga0207652_102317361 465
258 3300025923 Ga0207681_10004417 Ga0207681_100044171 465
259 3300025924 Ga0207694_10053966 Ga0207694_100539665 465
260 3300025925 Ga0207650_10009501 Ga0207650_100095014 465
261 3300025925 Ga0207650_10053090 Ga0207650_100530903 465
262 3300025925 Ga0207650_10076544 Ga0207650_100765443 465
263 3300025927 Ga0207687_10145484 Ga0207687_101454842 465
264 3300025928 Ga0207700_10069001 Ga0207700_100690012 465
265 3300025931 Ga0207644_10000848 Ga0207644_100008487 465
266 3300025931 Ga0207644_10000966 Ga0207644_100009664 465
267 3300025931 Ga0207644_10004061 Ga0207644_100040612 465
268 3300025932 Ga0207690_10001344 Ga0207690_100013444 465
269 3300025932 Ga0207690_10002399 Ga0207690_100023994 465
270 3300025932 Ga0207690_10006308 Ga0207690_100063082 465
271 3300025933 Ga0207706_10003663 Ga0207706_1000366316 465
272 3300025933 Ga0207706_10005540 Ga0207706_1000554011 465
273 3300025933 Ga0207706_10007869 Ga0207706_100078696 465
274 3300025933 Ga0207706_10056689 Ga0207706_100566894 465
275 3300025939 Ga0207665_10029535 Ga0207665_100295355 465
276 3300025940 Ga0207691_10000780 Ga0207691_100007804 465
277 3300025940 Ga0207691_10007278 Ga0207691_100072785 465
278 3300025940 Ga0207691_10027933 Ga0207691_100279337 465
279 3300025941 Ga0207711_10003705 Ga0207711_1000370510 465
280 3300025941 Ga0207711_10004689 Ga0207711_100046897 465
281 3300025941 Ga0207711_10005802 Ga0207711_100058029 465
282 3300025941 Ga0207711_10022211 Ga0207711_100222116 465
283 3300025941 Ga0207711_10078493 Ga0207711_100784933 465
284 3300025942 Ga0207689_10062927 Ga0207689_100629272 465
285 3300025944 Ga0207661_10051296 Ga0207661_100512963 465
286 3300025944 Ga0207661_10079506 Ga0207661_100795064 465
287 3300025945 Ga0207679_10006995 Ga0207679_100069957 465
288 3300025945 Ga0207679_10027040 Ga0207679_100270406 465
289 3300025945 Ga0207679_10065822 Ga0207679_100658223 465
290 3300025949 Ga0207667_10010120 Ga0207667_100101205 465
291 3300025949 Ga0207667_10083122 Ga0207667_100831223 465
292 3300025960 Ga0207651_10008228 Ga0207651_100082284 465
293 3300025960 Ga0207651_10040993 Ga0207651_100409934 465
294 3300025961 Ga0207712_10000474 Ga0207712_100004749 465
295 3300025972 Ga0207668_10000021 Ga0207668_1000002133 465
296 3300025981 Ga0207640_10023105 Ga0207640_100231053 465
297 3300025986 Ga0207658_10005418 Ga0207658_100054188 465
298 3300025986 Ga0207658_10040539 Ga0207658_100405393 465
299 3300025986 Ga0207658_10095398 Ga0207658_100953984 465
300 3300026035 Ga0207703_10002922 Ga0207703_100029226 465
301 3300026035 Ga0207703_10019739 Ga0207703_100197397 465
302 3300026035 Ga0207703_10031558 Ga0207703_100315584 465
303 3300026041 Ga0207639_10060029 Ga0207639_100600292 465
304 3300026067 Ga0207678_10013484 Ga0207678_100134843 465
305 3300026067 Ga0207678_10019808 Ga0207678_100198083 465
306 3300026078 Ga0207702_10045877 Ga0207702_100458775 465
307 3300026078 Ga0207702_10122274 Ga0207702_101222741 465
308 3300026088 Ga0207641_10002878 Ga0207641_100028788 465
309 3300026088 Ga0207641_10009836 Ga0207641_100098369 465
310 3300026088 Ga0207641_10043924 Ga0207641_100439242 465
311 3300026088 Ga0207641_10079341 Ga0207641_100793414 465
312 3300026088 Ga0207641_10109698 Ga0207641_101096982 465
313 3300026088 Ga0207641_10166303 Ga0207641_101663032 465
314 3300026089 Ga0207648_10001456 Ga0207648_1000145624 465
315 3300026095 Ga0207676_10001750 Ga0207676_100017505 465
316 3300026095 Ga0207676_10006168 Ga0207676_100061687 465
317 3300026095 Ga0207676_10008195 Ga0207676_100081954 465
318 3300026116 Ga0207674_10005849 Ga0207674_100058493 465
319 3300026116 Ga0207674_10010262 Ga0207674_100102628 465
320 3300026116 Ga0207674_10015727 Ga0207674_100157276 465
321 3300026116 Ga0207674_10035924 Ga0207674_100359247 465
322 3300026116 Ga0207674_10094309 Ga0207674_100943094 465
323 3300026121 Ga0207683_10000430 Ga0207683_1000043010 465
324 3300026121 Ga0207683_10023224 Ga0207683_100232245 465
325 3300026142 Ga0207698_10002083 Ga0207698_100020832 465
326 3300026142 Ga0207698_10027766 Ga0207698_100277661 465
327 3300026142 Ga0207698_10043719 Ga0207698_100437195 465
328 3300028379 Ga0268266_10035679 Ga0268266_100356794 465
329 3300028380 Ga0268265_10004300 Ga0268265_100043008 465
330 3300028380 Ga0268265_10005129 Ga0268265_100051296 465
331 3300028380 Ga0268265_10021934 Ga0268265_100219342 465
332 3300028380 Ga0268265_10040095 Ga0268265_100400954 465
333 3300028381 Ga0268264_10012695 Ga0268264_100126956 465
334 3300031456 Ga0307513_10223999 Ga0307513_102239991 465
335 3300031731 Ga0307405_10041740 Ga0307405_100417402 465
336 3300031852 Ga0307410_10135390 Ga0307410_101353902 465
337 3300031901 Ga0307406_10022473 Ga0307406_100224732 465
338 3300031995 Ga0307409_100009254 Ga0307409_1000092544 465
339 3300031995 Ga0307409_100232153 Ga0307409_1002321532 465
340 3300032002 Ga0307416_100030889 Ga0307416_1000308892 465
341 3300032004 Ga0307414_10026075 Ga0307414_100260753 465
342 3300032004 Ga0307414_10204326 Ga0307414_102043261 465
343 3300032005 Ga0307411_10036096 Ga0307411_100360964 465
344 3300032126 Ga0307415_100004482 Ga0307415_1000044826 465
345 3300037312 Ga0395899_0001755 Ga0395899_0001755_2026_3423 465
346 3300037312 Ga0395899_0021978 Ga0395899_0021978_750_2147 465
347 3300037312 Ga0395899_0024244 Ga0395899_0024244_447_1844 465
348 3300037312 Ga0395899_0029005 Ga0395899_0029005_2237_3634 465
349 3300037312 Ga0395899_0043711 Ga0395899_0043711_1325_2722 465
350 3300037312 Ga0395899_0077725 Ga0395899_0077725_868_2265 465
351 3300037312 Ga0395899_0088685 Ga0395899_0088685_268_1665 465
352 3300037312 Ga0395899_0150180 Ga0395899_0150180_32_1429 465
353 3300037418 Ga0395900_0001160 Ga0395900_0001160_2328_3725 465
354 3300037418 Ga0395900_0001294 Ga0395900_0001294_6616_8013 465
355 3300037418 Ga0395900_0002862 Ga0395900_0002862_4367_5764 465
356 3300037418 Ga0395900_0024736 Ga0395900_0024736_3465_4862 465
357 3300037418 Ga0395900_0047444 Ga0395900_0047444_2098_3495 465
358 3300037418 Ga0395900_0052467 Ga0395900_0052467_859_2256 465
359 3300037418 Ga0395900_0074303 Ga0395900_0074303_950_2347 465
360 3300037418 Ga0395900_0095723 Ga0395900_0095723_811_2208 465
361 3300037418 Ga0395900_0181571 Ga0395900_0181571_21_1418 465
362 3300037466 Ga0395898_0003838 Ga0395898_0003838_771_2168 465
363 3300037466 Ga0395898_0009643 Ga0395898_0009643_1319_2716 465
364 3300037466 Ga0395898_0039337 Ga0395898_0039337_1743_3140 465
365 3300037466 Ga0395898_0060688 Ga0395898_0060688_823_2220 465
366 3300037471 Ga0395905_0003105 Ga0395905_0003105_9192_10589 465
367 3300037471 Ga0395905_0006273 Ga0395905_0006273_783_2180 465
368 3300037471 Ga0395905_0009943 Ga0395905_0009943_4076_5473 465
369 3300037471 Ga0395905_0010357 Ga0395905_0010357_7141_8538 465
370 3300037471 Ga0395905_0018669 Ga0395905_0018669_2377_3774 465
371 3300037471 Ga0395905_0019640 Ga0395905_0019640_3204_4601 465
372 3300037471 Ga0395905_0035506 Ga0395905_0035506_633_2030 465
373 3300037471 Ga0395905_0056025 Ga0395905_0056025_699_2096 465
374 3300037471 Ga0395905_0061535 Ga0395905_0061535_233_1630 465
375 3300037471 Ga0395905_0061905 Ga0395905_0061905_1738_3135 465
376 3300037471 Ga0395905_0108282 Ga0395905_0108282_164_1561 465
377 3300037471 Ga0395905_0131722 Ga0395905_0131722_133_1530 465
378 3300038443 Ga0395901_0004243 Ga0395901_0004243_10167_11564 465
379 3300038443 Ga0395901_0006960 Ga0395901_0006960_7274_8671 465
380 3300038443 Ga0395901_0022491 Ga0395901_0022491_1364_2761 465
381 3300038443 Ga0395901_0032257 Ga0395901_0032257_1593_2990 465
382 3300038443 Ga0395901_0033324 Ga0395901_0033324_526_1923 465
383 3300038443 Ga0395901_0034316 Ga0395901_0034316_3486_4883 465
384 3300038443 Ga0395901_0043535 Ga0395901_0043535_41_1438 465
385 3300038443 Ga0395901_0086110 Ga0395901_0086110_494_1891 465
386 3300038443 Ga0395901_0086482 Ga0395901_0086482_1720_3117 465
387 3300038443 Ga0395901_0088845 Ga0395901_0088845_1043_2440 465
388 3300038443 Ga0395901_0094834 Ga0395901_0094834_529_1926 465
389 3300042157 Ga0439458_0001603 Ga0439458_0001603_1796_3193 465
390 3300044656 Ga0466969_0008330 Ga0466969_0008330_1173_2570 465
391 3300044684 Ga0466966_0004129 Ga0466966_0004129_700_2097 465
392 3300044684 Ga0466966_0048464 Ga0466966_0048464_776_2173 465
393 3300044684 Ga0466966_0049385 Ga0466966_0049385_381_1778 465
394 3300044693 Ga0466961_0002424 Ga0466961_0002424_7159_8556 465
395 3300044693 Ga0466961_0022371 Ga0466961_0022371_1040_2437 465
396 3300044693 Ga0466961_0041537 Ga0466961_0041537_1200_2597 465
397 3300044694 Ga0466963_0008434 Ga0466963_0008434_3517_4914 465
398 3300044694 Ga0466963_0020936 Ga0466963_0020936_2572_3969 465
399 3300044694 Ga0466963_0023436 Ga0466963_0023436_102_1499 465
400 3300044694 Ga0466963_0043221 Ga0466963_0043221_555_1952 465
401 3300044719 Ga0466971_0020132 Ga0466971_0020132_361_1758 465
402 3300044719 Ga0466971_0021817 Ga0466971_0021817_1202_2599 465
403 3300044842 Ga0466957_0003787 Ga0466957_0003787_5326_6723 465
404 3300044842 Ga0466957_0046594 Ga0466957_0046594_894_2291 465
405 3300044842 Ga0466957_0077953 Ga0466957_0077953_54_1451 465
406 3300044901 Ga0466960_0039264 Ga0466960_0039264_314_1711 465
407 3300045049 Ga0466959_0128468 Ga0466959_0128468_34_1431 465
408 3300045049 Ga0466959_0135723 Ga0466959_0135723_175_1572 465
409 3300045049 Ga0466959_0157786 Ga0466959_0157786_72_1469 465
410 3300045836 Ga0466958_0001810 Ga0466958_0001810_1799_3196 465
411 3300045976 Ga0466967_0069810 Ga0466967_0069810_572_1969 465
412 3300045976 Ga0466967_0206986 Ga0466967_0206986_246_1643 465
413 3300048904 Ga0496101_0036899 Ga0496101_0036899_269_1666 465
414 3300048904 Ga0496101_0041652 Ga0496101_0041652_1420_2817 465
415 3300048909 Ga0496106_0003705 Ga0496106_0003705_2398_3795 465
416 3300048910 Ga0496107_0008249 Ga0496107_0008249_4616_6013 465
417 3300048911 Ga0496108_0003999 Ga0496108_0003999_8206_9603 465
418 3300048911 Ga0496108_0028436 Ga0496108_0028436_2966_4363 465
419 3300048911 Ga0496108_0053933 Ga0496108_0053933_1367_2764 465
420 3300048912 Ga0496109_0002175 Ga0496109_0002175_9393_10790 465
421 3300048912 Ga0496109_0088703 Ga0496109_0088703_805_2202 465
422 3300048913 Ga0496110_0001640 Ga0496110_0001640_10857_12254 465
423 3300048913 Ga0496110_0018858 Ga0496110_0018858_4271_5668 465
424 3300048914 Ga0496111_0000805 Ga0496111_0000805_11203_12600 465
425 3300048914 Ga0496111_0011651 Ga0496111_0011651_2787_4184 465
426 3300048915 Ga0496112_0053771 Ga0496112_0053771_606_2003 465
427 3300048915 Ga0496112_0084776 Ga0496112_0084776_1434_2831 465
428 3300048916 Ga0496113_0002011 Ga0496113_0002011_6697_8094 465
429 3300048916 Ga0496113_0074995 Ga0496113_0074995_203_1600 465
430 3300050515 nmdc:mga0a205_248_c1 nmdc:mga0a205_248_c1_11302_12699 465
431 3300061719 Ga0466962_0006842 Ga0466962_0006842_1173_2570 465
432 3300061719 Ga0466962_0008622 Ga0466962_0008622_2804_4201 465
433 3300061719 Ga0466962_0053479 Ga0466962_0053479_251_1648 465
434 3300001989 JGI24739J22299_10004201 JGI24739J22299_100042015 466
435 3300001990 JGI24737J22298_10002032 JGI24737J22298_100020325 466
436 3300002075 JGI24738J21930_10001744 JGI24738J21930_100017449 466
437 3300005327 Ga0070658_10000205 Ga0070658_1000020556 466
438 3300005329 Ga0070683_100000969 Ga0070683_10000096923 466
439 3300005335 Ga0070666_10000435 Ga0070666_100004355 466
440 3300005339 Ga0070660_100000009 Ga0070660_10000000973 466
441 3300005344 Ga0070661_100000100 Ga0070661_10000010073 466
442 3300005355 Ga0070671_100007173 Ga0070671_1000071734 466
443 3300005366 Ga0070659_100000048 Ga0070659_10000004843 466
444 3300005367 Ga0070667_100002041 Ga0070667_1000020418 466
445 3300005455 Ga0070663_100021950 Ga0070663_1000219503 466
446 3300005457 Ga0070662_100000035 Ga0070662_10000003564 466
447 3300005535 Ga0070684_100018452 Ga0070684_1000184524 466
448 3300005539 Ga0068853_100001837 Ga0068853_1000018375 466
449 3300005547 Ga0070693_100000718 Ga0070693_10000071811 466
450 3300005548 Ga0070665_100014071 Ga0070665_1000140715 466
451 3300005563 Ga0068855_100008756 Ga0068855_1000087566 466
452 3300005564 Ga0070664_100000025 Ga0070664_10000002529 466
453 3300005578 Ga0068854_100048861 Ga0068854_1000488611 466
454 3300005614 Ga0068856_100000124 Ga0068856_10000012441 466
455 3300005616 Ga0068852_100000258 Ga0068852_10000025823 466
456 3300005618 Ga0068864_100273241 Ga0068864_1002732411 466
457 3300009177 Ga0105248_10000163 Ga0105248_1000016374 466
458 3300009551 Ga0105238_10019299 Ga0105238_100192995 466
459 3300013102 Ga0157371_10000722 Ga0157371_1000072217 466
460 3300013296 Ga0157374_10010533 Ga0157374_100105333 466
461 3300014325 Ga0163163_10000173 Ga0163163_100001738 466
462 3300025903 Ga0207680_10004951 Ga0207680_100049513 466
463 3300025904 Ga0207647_10014577 Ga0207647_100145775 466
464 3300025909 Ga0207705_10000114 Ga0207705_1000011462 466
465 3300025919 Ga0207657_10000071 Ga0207657_1000007128 466
466 3300025932 Ga0207690_10000036 Ga0207690_10000036138 466
467 3300025933 Ga0207706_10000086 Ga0207706_1000008674 466
468 3300025933 Ga0207706_10142249 Ga0207706_101422492 466
469 3300025941 Ga0207711_10002528 Ga0207711_1000252811 466
470 3300025944 Ga0207661_10001356 Ga0207661_1000135616 466
471 3300025945 Ga0207679_10001003 Ga0207679_1000100322 466
472 3300025949 Ga0207667_10003552 Ga0207667_1000355211 466
473 3300025981 Ga0207640_10006316 Ga0207640_100063165 466
474 3300026041 Ga0207639_10002533 Ga0207639_1000253314 466
475 3300026067 Ga0207678_10036149 Ga0207678_100361493 466
476 3300026078 Ga0207702_10000254 Ga0207702_1000025425 466
477 3300026095 Ga0207676_10056198 Ga0207676_100561983 466
478 3300026142 Ga0207698_10006944 Ga0207698_100069445 466
479 3300032126 Ga0307415_100003507 Ga0307415_1000035077 466
480 3300037418 Ga0395900_0245268 Ga0395900_0245268_103_1533 466

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00883

Peptidase_M17

Cytosol aminopeptidase family, catalytic domain

150

460

0.92

PF21337

Peptidase_M17_N_1

M17 aminopeptidase, N-terminal domain

18

153

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ij3-assembly1.cif.gz_A 1.8 angstrom resolution crystal structure of cytosol aminopeptidase from coxiella burnetii 0.9233 7 461
3ij3-assembly1.cif.gz_A 1.8 angstrom resolution crystal structure of cytosol aminopeptidase from coxiella burnetii 0.9155 7 461
4zla-assembly1.cif.gz_B bestatin complex structure of leucine aminopeptidase from helicobacter pylori 0.8719 8 460
4zla-assembly1.cif.gz_D bestatin complex structure of leucine aminopeptidase from helicobacter pylori 0.8707 8 465
4zi6-assembly1.cif.gz_B crystal structure of leucine aminopeptidase from helicobacter pylori 0.8705 8 460
ID Description Score Start End Superfamily
3ij3A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9507 137 461 3.40.630.10
3ij3A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.945 137 461 3.40.630.10
6omeA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9283 144 459 3.40.630.10
4zi6D02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9262 133 460 3.40.630.10
af_P9WHT3_177_515_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9232 137 458 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A3N5CWV1-F1-model_v4 Leucyl aminopeptidase family protein 0.9649 5 461 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A484Z5T4-F1-model_v4 Peptidase B (EC 3.4.11.23) 0.9642 253 381 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A2Z4JYP0-F1-model_v4 Aminopeptidase 0.9588 1 461 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A2A4IE33-F1-model_v4 Aminopeptidase 0.9583 1 462 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A6N0X1Y3-F1-model_v4 Leucyl aminopeptidase family protein 0.9565 1 462 GO:0005737
GO:0006508
GO:0030145
GO:0070006

Feature Viewer

pLDDT pTM Quality
87.61 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map