F452173

General Info

Members Datasets Scaffolds Average Seq Length
480 168 960 316

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100001217|Ga0070669_1000012172
Length 387
Sequence VDKGRVGKRKVVREKGQGTRDKVQEPRSKNQINFKPQTPKSSIQYPASRSALADYKSSLKHLVMTNRRTFLQQSGAVAFTSLLLPGIGRAATFFEGKAKTPVGLQLYTLGNLMSTDAKGTLQKLAVIGYKELESAGSQKGNWYGYKPKEFASMVKDAGMHWRSAHVGGAPFTLEMIMKMAKPKTAEDSARIQKMAEQFKNTPSLNLTENHQQLADAAAEGGITYLVCSSIPVSTLDEIKTAVDVFNKAGEACKKNGVQFAYHNHTTEFDQVEGHRPFDYILDNTDKDLVKMELDLAWATKAKQDPVQLFKLHPGRYPLWHVKDLDKTTMNPTEVGAGIVDFKNAFDHSKDSGMKYFFVEQDGAPQPLQNVTNSYNYLNKMLDQKNKS

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.21
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.62
Rhizosphere 98.12
Stem 0
Stem Tuber 0
Unclassified 9.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100001217 3300005353 Bacteria 18690
2 rootH2_10066796 3300003320 Bacteria 3756
3 Ga0070658_10002976 3300005327 Bacteria 14028
4 Ga0070658_10193197 3300005327 Bacteria 1716
5 Ga0070658_10208361 3300005327 Bacteria 1651
6 Ga0070676_10000262 3300005328 Bacteria 22949
7 Ga0070676_10042848 3300005328 Bacteria 2630
8 Ga0070676_10079502 3300005328 Bacteria 1986
9 Ga0070676_10138932 3300005328 Bacteria 1544
10 Ga0070683_100004434 3300005329 Bacteria 11572
11 Ga0070683_100082257 3300005329 Unclassified 3015
12 Ga0070683_100096301 3300005329 Bacteria 2783
13 Ga0070670_100086092 3300005331 Bacteria 2700
14 Ga0068869_100006489 3300005334 Bacteria 7424
15 Ga0068869_100014039 3300005334 Bacteria 5345
16 Ga0068869_100039920 3300005334 Bacteria 3353
17 Ga0068869_100065945 3300005334 Bacteria 2667
18 Ga0068869_100133448 3300005334 Bacteria 1911
19 Ga0070666_10000174 3300005335 Bacteria 43931
20 Ga0070666_10000265 3300005335 Bacteria 34771
21 Ga0070666_10045112 3300005335 Bacteria 2955
22 Ga0070666_10058974 3300005335 Bacteria 2596
23 Ga0070680_100005945 3300005336 Bacteria 9259
24 Ga0070680_100041434 3300005336 Bacteria 3734
25 Ga0070682_100059028 3300005337 Bacteria 2421
26 Ga0068868_100000845 3300005338 Bacteria 20760
27 Ga0068868_100016266 3300005338 Bacteria 5520
28 Ga0068868_100021249 3300005338 Bacteria 4888
29 Ga0068868_100516735 3300005338 Bacteria 1048
30 Ga0070660_100070786 3300005339 Bacteria 2722
31 Ga0070689_100117588 3300005340 Bacteria 2120
32 Ga0070689_100165126 3300005340 Bacteria 1791
33 Ga0070689_100293199 3300005340 Bacteria 1352
34 Ga0070687_100051649 3300005343 Bacteria 2130
35 Ga0070661_100001488 3300005344 Bacteria 16275
36 Ga0070661_100013499 3300005344 Bacteria 5735
37 Ga0070661_100082420 3300005344 Bacteria 2375
38 Ga0070661_100166743 3300005344 Bacteria 1671
39 Ga0070668_100000036 3300005347 Bacteria 81256
40 Ga0070668_100078467 3300005347 Bacteria 2583
41 Ga0070668_100134202 3300005347 Bacteria 1989
42 Ga0070668_100344503 3300005347 Bacteria 1260
43 Ga0070669_100392027 3300005353 Bacteria 1135
44 Ga0070675_100023993 3300005354 Bacteria 4882
45 Ga0070675_100065355 3300005354 Bacteria 3007
46 Ga0070675_100077486 3300005354 Bacteria 2767
47 Ga0070675_100147440 3300005354 Bacteria 2016
48 Ga0070675_100200159 3300005354 Bacteria 1733
49 Ga0070675_100226004 3300005354 Bacteria 1631
50 Ga0070671_100010752 3300005355 Bacteria 7345
51 Ga0070671_100135317 3300005355 Bacteria 2077
52 Ga0070671_100157346 3300005355 Bacteria 1920
53 Ga0070674_100017387 3300005356 Bacteria 4523
54 Ga0070673_100000905 3300005364 Bacteria 16759
55 Ga0070673_100035035 3300005364 Bacteria 3804
56 Ga0070673_100040591 3300005364 Bacteria 3571
57 Ga0070673_100045542 3300005364 Unclassified 3402
58 Ga0070673_100046088 3300005364 Unclassified 3384
59 Ga0070673_100372813 3300005364 Bacteria 1271
60 Ga0070688_100009819 3300005365 Bacteria 5260
61 Ga0070688_100014229 3300005365 Bacteria 4504
62 Ga0070688_100279385 3300005365 Bacteria 1199
63 Ga0070659_100002804 3300005366 Bacteria 12414
64 Ga0070659_100016040 3300005366 Bacteria 5620
65 Ga0070667_100000151 3300005367 Bacteria 86629
66 Ga0070667_100017922 3300005367 Bacteria 5869
67 Ga0070667_100046547 3300005367 Bacteria 3649
68 Ga0070701_10080272 3300005438 Bacteria 1764
69 Ga0070663_100144575 3300005455 Unclassified 1818
70 Ga0070663_100161764 3300005455 Bacteria 1724
71 Ga0070678_100020750 3300005456 Bacteria 4316
72 Ga0070662_100019390 3300005457 Unclassified 4617
73 Ga0070662_100040699 3300005457 Bacteria 3310
74 Ga0070662_100086568 3300005457 Bacteria 2344
75 Ga0070662_100156407 3300005457 Bacteria 1780
76 Ga0070662_100260363 3300005457 Bacteria 1397
77 Ga0070662_100361083 3300005457 Bacteria 1192
78 Ga0070681_10009892 3300005458 Bacteria 9396
79 Ga0070681_10049923 3300005458 Bacteria 4176
80 Ga0068867_100001155 3300005459 Bacteria 18059
81 Ga0068867_100021109 3300005459 Bacteria 4645
82 Ga0070685_10012446 3300005466 Unclassified 4470
83 Ga0070685_10022188 3300005466 Bacteria 3457
84 Ga0070679_100012369 3300005530 Bacteria 8153
85 Ga0070679_100591019 3300005530 Unclassified 1053
86 Ga0070684_100006173 3300005535 Bacteria 9242
87 Ga0070684_100025179 3300005535 Unclassified 4999
88 Ga0070684_100104802 3300005535 Bacteria 2530
89 Ga0070684_100127856 3300005535 Bacteria 2290
90 Ga0070684_100172565 3300005535 Bacteria 1964
91 Ga0070684_100288873 3300005535 Bacteria 1503
92 Ga0070684_100433990 3300005535 Bacteria 1213
93 Ga0068853_100001327 3300005539 Bacteria 17802
94 Ga0068853_100014472 3300005539 Bacteria 6462
95 Ga0068853_100056364 3300005539 Bacteria 3388
96 Ga0068853_100059469 3300005539 Bacteria 3301
97 Ga0070672_100000481 3300005543 Bacteria 23169
98 Ga0070672_100013168 3300005543 Bacteria 5833
99 Ga0070672_100085974 3300005543 Bacteria 2528
100 Ga0070672_100135099 3300005543 Bacteria 2031
101 Ga0070665_100004271 3300005548 Bacteria 15022
102 Ga0070665_100018270 3300005548 Bacteria 7032
103 Ga0070665_100302650 3300005548 Bacteria 1602
104 Ga0068855_100002469 3300005563 Bacteria 22826
105 Ga0068855_100002849 3300005563 Bacteria 21261
106 Ga0068855_100010544 3300005563 Bacteria 11144
107 Ga0068855_100082423 3300005563 Bacteria 3728
108 Ga0068855_100616835 3300005563 Bacteria 1168
109 Ga0070664_100000360 3300005564 Bacteria 33570
110 Ga0070664_100018351 3300005564 Bacteria 5746
111 Ga0070664_100023562 3300005564 Bacteria 5086
112 Ga0070664_100043242 3300005564 Bacteria 3801
113 Ga0070664_100069291 3300005564 Bacteria 3018
114 Ga0070664_100229137 3300005564 Bacteria 1665
115 Ga0070664_100425834 3300005564 Bacteria 1216
116 Ga0068857_100000323 3300005577 Bacteria 32881
117 Ga0068854_100075528 3300005578 Bacteria 2474
118 Ga0068854_100122803 3300005578 Bacteria 1974
119 Ga0068854_100160800 3300005578 Bacteria 1739
120 Ga0068854_100188543 3300005578 Bacteria 1615
121 Ga0068856_100000636 3300005614 Bacteria 38160
122 Ga0070702_100002295 3300005615 Bacteria 8198
123 Ga0068852_100006889 3300005616 Bacteria 8260
124 Ga0068852_100018436 3300005616 Bacteria 5498
125 Ga0068852_100122792 3300005616 Bacteria 2381
126 Ga0068852_100131550 3300005616 Bacteria 2305
127 Ga0068852_100162432 3300005616 Bacteria 2087
128 Ga0068852_100181427 3300005616 Bacteria 1980
129 Ga0068852_100229960 3300005616 Unclassified 1767
130 Ga0068859_100001134 3300005617 Bacteria 27162
131 Ga0068859_100009512 3300005617 Bacteria 9814
132 Ga0068859_100067440 3300005617 Bacteria 3612
133 Ga0068859_100111078 3300005617 Bacteria 2803
134 Ga0068859_100323326 3300005617 Bacteria 1637
135 Ga0068864_100003274 3300005618 Bacteria 13375
136 Ga0068864_100023198 3300005618 Bacteria 5209
137 Ga0068864_100027391 3300005618 Bacteria 4813
138 Ga0068864_100244647 3300005618 Unclassified 1663
139 Ga0068864_100280591 3300005618 Bacteria 1555
140 Ga0068866_10094502 3300005718 Bacteria 1636
141 Ga0068861_100056525 3300005719 Bacteria 2995
142 Ga0068861_100068070 3300005719 Unclassified 2750
143 Ga0068870_10072429 3300005840 Bacteria 1883
144 Ga0068870_10078222 3300005840 Bacteria 1821
145 Ga0068863_100000510 3300005841 Bacteria 39514
146 Ga0068863_100007927 3300005841 Bacteria 10382
147 Ga0068863_100065208 3300005841 Unclassified 3446
148 Ga0068858_100000760 3300005842 Bacteria 33815
149 Ga0068858_100024468 3300005842 Bacteria 5625
150 Ga0068858_100030128 3300005842 Bacteria 5039
151 Ga0068858_100172241 3300005842 Bacteria 2041
152 Ga0068858_100175739 3300005842 Bacteria 2020
153 Ga0068860_100002392 3300005843 Bacteria 19698
154 Ga0068860_100008850 3300005843 Bacteria 10028
155 Ga0068860_100025347 3300005843 Bacteria 5723
156 Ga0068862_100154179 3300005844 Bacteria 2046
157 Ga0097621_100005221 3300006237 Bacteria 9133
158 Ga0097621_100014884 3300006237 Bacteria 5836
159 Ga0097621_100032204 3300006237 Bacteria 4166
160 Ga0097621_100044776 3300006237 Bacteria 3571
161 Ga0097621_100078359 3300006237 Bacteria 2745
162 Ga0097621_100228353 3300006237 Unclassified 1624
163 Ga0097621_100351670 3300006237 Bacteria 1311
164 Ga0068871_100045371 3300006358 Bacteria 3538
165 Ga0068871_100087114 3300006358 Unclassified 2596
166 Ga0068871_100143778 3300006358 Bacteria 2030
167 Ga0068871_100160081 3300006358 Bacteria 1925
168 Ga0068871_100233109 3300006358 Bacteria 1598
169 Ga0068871_100370227 3300006358 Bacteria 1271
170 Ga0075429_100414109 3300006880 Bacteria 1180
171 Ga0068865_100010664 3300006881 Bacteria 5729
172 Ga0068865_100062236 3300006881 Bacteria 2619
173 Ga0097620_100001134 3300006931 Bacteria 27162
174 Ga0097620_100009512 3300006931 Bacteria 9814
175 Ga0097620_100067443 3300006931 Bacteria 3612
176 Ga0097620_100111092 3300006931 Bacteria 2803
177 Ga0097620_100323306 3300006931 Bacteria 1637
178 Ga0105240_10000273 3300009093 Bacteria 102198
179 Ga0105240_10000986 3300009093 Bacteria 50790
180 Ga0105240_10068645 3300009093 Bacteria 4390
181 Ga0105240_10138245 3300009093 Bacteria 2915
182 Ga0105240_10346823 3300009093 Unclassified 1685
183 Ga0111539_10174398 3300009094 Bacteria 2512
184 Ga0105247_10022110 3300009101 Bacteria 3828
185 Ga0105243_10037448 3300009148 Bacteria 3771
186 Ga0105241_10001753 3300009174 Bacteria 16461
187 Ga0105241_10019153 3300009174 Bacteria 5047
188 Ga0105241_10139113 3300009174 Bacteria 1975
189 Ga0105241_10270747 3300009174 Bacteria 1447
190 Ga0105242_10010310 3300009176 Bacteria 7164
191 Ga0105242_10363571 3300009176 Bacteria 1340
192 Ga0105242_10459120 3300009176 Bacteria 1202
193 Ga0105237_10005174 3300009545 Bacteria 14756
194 Ga0105237_10014033 3300009545 Bacteria 8380
195 Ga0105237_10036552 3300009545 Bacteria 4971
196 Ga0105237_10062575 3300009545 Bacteria 3721
197 Ga0105238_10006791 3300009551 Bacteria 11428
198 Ga0105238_10026821 3300009551 Bacteria 5873
199 Ga0105249_10000514 3300009553 Bacteria 35783
200 Ga0105249_10018550 3300009553 Bacteria 6194
201 Ga0105249_10162186 3300009553 Bacteria 2161
202 Ga0105239_10019031 3300010375 Bacteria 7588
203 Ga0105239_10019137 3300010375 Bacteria 7567
204 Ga0105239_10062372 3300010375 Unclassified 4091
205 Ga0105239_10082118 3300010375 Bacteria 3548
206 Ga0105239_10135803 3300010375 Bacteria 2738
207 Ga0105246_10032056 3300011119 Bacteria 3482
208 Ga0105246_10244119 3300011119 Bacteria 1421
209 Ga0157373_10001683 3300013100 Bacteria 16884
210 Ga0157373_10023916 3300013100 Bacteria 4427
211 Ga0157371_10002532 3300013102 Bacteria 17358
212 Ga0157371_10002605 3300013102 Bacteria 17116
213 Ga0157371_10006357 3300013102 Bacteria 9770
214 Ga0157371_10021977 3300013102 Bacteria 4682
215 Ga0157371_10042570 3300013102 Bacteria 3237
216 Ga0157371_10080125 3300013102 Bacteria 2312
217 Ga0157371_10276452 3300013102 Bacteria 1212
218 Ga0157370_10031520 3300013104 Bacteria 5184
219 Ga0157370_10032183 3300013104 Bacteria 5122
220 Ga0157370_10116818 3300013104 Bacteria 2492
221 Ga0157370_10119165 3300013104 Bacteria 2464
222 Ga0157370_10381960 3300013104 Bacteria 1297
223 Ga0157370_10471872 3300013104 Unclassified 1153
224 Ga0157370_10500381 3300013104 Bacteria 1116
225 Ga0157369_10039577 3300013105 Bacteria 5152
226 Ga0157369_10040833 3300013105 Bacteria 5064
227 Ga0157369_10104826 3300013105 Unclassified 3011
228 Ga0157369_10114956 3300013105 Unclassified 2858
229 Ga0157369_10494887 3300013105 Bacteria 1265
230 Ga0157369_10526768 3300013105 Bacteria 1222
231 Ga0157374_10000153 3300013296 Bacteria 63211
232 Ga0157374_10000693 3300013296 Bacteria 29673
233 Ga0157374_10012676 3300013296 Bacteria 7341
234 Ga0157374_10049323 3300013296 Bacteria 3910
235 Ga0157378_10001467 3300013297 Bacteria 21296
236 Ga0157378_10007374 3300013297 Bacteria 9609
237 Ga0157378_10022204 3300013297 Bacteria 5585
238 Ga0157378_10062064 3300013297 Bacteria 3337
239 Ga0157378_10064768 3300013297 Bacteria 3270
240 Ga0157378_10124359 3300013297 Bacteria 2381
241 Ga0157378_10161025 3300013297 Bacteria 2099
242 Ga0157378_10400314 3300013297 Bacteria 1352
243 Ga0157378_10646237 3300013297 Bacteria 1073
244 Ga0163162_10000040 3300013306 Bacteria 133855
245 Ga0163162_10018617 3300013306 Bacteria 6805
246 Ga0163162_10022082 3300013306 Bacteria 6271
247 Ga0163162_10059426 3300013306 Bacteria 3855
248 Ga0163162_10059927 3300013306 Bacteria 3839
249 Ga0163162_10122135 3300013306 Unclassified 2709
250 Ga0163162_10242487 3300013306 Bacteria 1933
251 Ga0163162_10327224 3300013306 Bacteria 1665
252 Ga0157372_10017471 3300013307 Bacteria 7700
253 Ga0157372_10018987 3300013307 Bacteria 7398
254 Ga0157372_10030645 3300013307 Bacteria 5885
255 Ga0157372_10034341 3300013307 Bacteria 5575
256 Ga0157372_10071320 3300013307 Bacteria 3912
257 Ga0157372_10114408 3300013307 Bacteria 3093
258 Ga0157372_10124102 3300013307 Bacteria 2968
259 Ga0157372_10128360 3300013307 Bacteria 2916
260 Ga0157372_10187715 3300013307 Bacteria 2394
261 Ga0157372_10214918 3300013307 Unclassified 2228
262 Ga0157372_10283518 3300013307 Bacteria 1926
263 Ga0157372_10316117 3300013307 Bacteria 1818
264 Ga0157372_10863817 3300013307 Bacteria 1050
265 Ga0157375_10001694 3300013308 Bacteria 18935
266 Ga0157375_10051721 3300013308 Bacteria 4036
267 Ga0157375_10083551 3300013308 Bacteria 3238
268 Ga0157375_10089250 3300013308 Bacteria 3139
269 Ga0157375_10137707 3300013308 Bacteria 2566
270 Ga0157375_10170570 3300013308 Bacteria 2323
271 Ga0157375_10203406 3300013308 Unclassified 2136
272 Ga0157375_10346113 3300013308 Bacteria 1652
273 Ga0163163_10001181 3300014325 Bacteria 22125
274 Ga0163163_10029933 3300014325 Bacteria 5240
275 Ga0163163_10126785 3300014325 Bacteria 2591
276 Ga0157380_10018387 3300014326 Bacteria 5186
277 Ga0157377_10031341 3300014745 Bacteria 2888
278 Ga0157377_10040975 3300014745 Bacteria 2567
279 Ga0157379_10000114 3300014968 Bacteria 55633
280 Ga0157379_10023185 3300014968 Bacteria 5505
281 Ga0157379_10068354 3300014968 Bacteria 3176
282 Ga0157379_10090826 3300014968 Bacteria 2740
283 Ga0157379_10139909 3300014968 Bacteria 2182
284 Ga0157376_10000278 3300014969 Bacteria 34737
285 Ga0157376_10003309 3300014969 Bacteria 11097
286 Ga0157376_10079445 3300014969 Unclassified 2812
287 Ga0157376_10161580 3300014969 Unclassified 2031
288 Ga0163161_10009051 3300017792 Bacteria 6888
289 Ga0163161_10018156 3300017792 Bacteria 4931
290 Ga0163161_10079909 3300017792 Bacteria 2406
291 Ga0163161_10169034 3300017792 Bacteria 1671
292 Ga0206352_11258222 3300020078 Bacteria 1501
293 Ga0213876_10003829 3300021384 Bacteria 8521
294 Ga0207697_10007681 3300025315 Bacteria 4782
295 Ga0207697_10126420 3300025315 Bacteria 1103
296 Ga0207682_10088855 3300025893 Bacteria 1337
297 Ga0207688_10148058 3300025901 Bacteria 1385
298 Ga0207680_10004183 3300025903 Bacteria 6832
299 Ga0207680_10005732 3300025903 Bacteria 5954
300 Ga0207680_10110256 3300025903 Bacteria 1784
301 Ga0207680_10188756 3300025903 Bacteria 1398
302 Ga0207645_10000631 3300025907 Bacteria 29230
303 Ga0207645_10002363 3300025907 Bacteria 14882
304 Ga0207645_10002472 3300025907 Bacteria 14528
305 Ga0207645_10020637 3300025907 Bacteria 4309
306 Ga0207645_10044542 3300025907 Bacteria 2839
307 Ga0207643_10066031 3300025908 Bacteria 2074
308 Ga0207705_10004245 3300025909 Bacteria 10851
309 Ga0207705_10010371 3300025909 Bacteria 6775
310 Ga0207705_10031483 3300025909 Bacteria 3787
311 Ga0207705_10170136 3300025909 Unclassified 1640
312 Ga0207654_10002696 3300025911 Bacteria 9017
313 Ga0207654_10166884 3300025911 Bacteria 1426
314 Ga0207654_10219893 3300025911 Bacteria 1259
315 Ga0207707_10040372 3300025912 Bacteria 4075
316 Ga0207707_10136005 3300025912 Bacteria 2149
317 Ga0207695_10000130 3300025913 Bacteria 224214
318 Ga0207695_10000981 3300025913 Bacteria 50713
319 Ga0207695_10306816 3300025913 Bacteria 1478
320 Ga0207671_10008668 3300025914 Bacteria 8586
321 Ga0207671_10013703 3300025914 Bacteria 6441
322 Ga0207660_10077448 3300025917 Unclassified 2434
323 Ga0207657_10018767 3300025919 Bacteria 6588
324 Ga0207657_10262258 3300025919 Bacteria 1375
325 Ga0207649_10002021 3300025920 Bacteria 11533
326 Ga0207649_10081271 3300025920 Bacteria 2098
327 Ga0207652_10001124 3300025921 Bacteria 24086
328 Ga0207652_10006214 3300025921 Bacteria 9645
329 Ga0207652_10212519 3300025921 Bacteria 1742
330 Ga0207681_10162027 3300025923 Bacteria 1687
331 Ga0207694_10037118 3300025924 Unclassified 3740
332 Ga0207694_10043765 3300025924 Bacteria 3456
333 Ga0207659_10129480 3300025926 Bacteria 1946
334 Ga0207644_10032731 3300025931 Unclassified 3630
335 Ga0207690_10019573 3300025932 Bacteria 4171
336 Ga0207690_10205185 3300025932 Bacteria 1499
337 Ga0207706_10006646 3300025933 Bacteria 10694
338 Ga0207706_10008847 3300025933 Bacteria 9267
339 Ga0207706_10034086 3300025933 Bacteria 4530
340 Ga0207706_10117050 3300025933 Bacteria 2344
341 Ga0207706_10150857 3300025933 Bacteria 2044
342 Ga0207709_10137757 3300025935 Bacteria 1673
343 Ga0207670_10023019 3300025936 Bacteria 3871
344 Ga0207670_10042567 3300025936 Bacteria 2994
345 Ga0207669_10011482 3300025937 Bacteria 4313
346 Ga0207704_10328803 3300025938 Bacteria 1182
347 Ga0207691_10000067 3300025940 Bacteria 84512
348 Ga0207691_10007465 3300025940 Bacteria 10524
349 Ga0207691_10027133 3300025940 Bacteria 5373
350 Ga0207691_10105009 3300025940 Bacteria 2517
351 Ga0207691_10157598 3300025940 Bacteria 1993
352 Ga0207691_10281262 3300025940 Bacteria 1431
353 Ga0207711_10356907 3300025941 Bacteria 1354
354 Ga0207689_10003978 3300025942 Bacteria 13443
355 Ga0207689_10010859 3300025942 Bacteria 7834
356 Ga0207689_10013446 3300025942 Bacteria 6989
357 Ga0207689_10048471 3300025942 Bacteria 3504
358 Ga0207689_10109354 3300025942 Bacteria 2271
359 Ga0207661_10004201 3300025944 Bacteria 10073
360 Ga0207661_10005213 3300025944 Bacteria 9137
361 Ga0207661_10079650 3300025944 Bacteria 2700
362 Ga0207679_10000575 3300025945 Bacteria 24610
363 Ga0207679_10013541 3300025945 Bacteria 5346
364 Ga0207679_10023446 3300025945 Unclassified 4221
365 Ga0207679_10076721 3300025945 Bacteria 2540
366 Ga0207679_10119635 3300025945 Unclassified 2094
367 Ga0207667_10000131 3300025949 Bacteria 115088
368 Ga0207667_10001209 3300025949 Bacteria 32290
369 Ga0207667_10002579 3300025949 Bacteria 22509
370 Ga0207667_10303204 3300025949 Bacteria 1632
371 Ga0207667_10492042 3300025949 Unclassified 1244
372 Ga0207651_10012824 3300025960 Bacteria 4763
373 Ga0207651_10092431 3300025960 Bacteria 2219
374 Ga0207651_10354710 3300025960 Bacteria 1236
375 Ga0207712_10009298 3300025961 Bacteria 6217
376 Ga0207668_10000274 3300025972 Bacteria 34337
377 Ga0207668_10150876 3300025972 Bacteria 1799
378 Ga0207640_10132172 3300025981 Bacteria 1806
379 Ga0207640_10251031 3300025981 Bacteria 1373
380 Ga0207658_10000225 3300025986 Bacteria 59285
381 Ga0207658_10017690 3300025986 Bacteria 4915
382 Ga0207658_10197353 3300025986 Bacteria 1677
383 Ga0207658_10285530 3300025986 Bacteria 1416
384 Ga0207677_10009301 3300026023 Bacteria 5525
385 Ga0207677_10011712 3300026023 Bacteria 5009
386 Ga0207677_10059546 3300026023 Bacteria 2634
387 Ga0207703_10001243 3300026035 Bacteria 23868
388 Ga0207703_10003872 3300026035 Bacteria 12442
389 Ga0207703_10063530 3300026035 Bacteria 3028
390 Ga0207703_10174802 3300026035 Unclassified 1891
391 Ga0207703_10331281 3300026035 Bacteria 1396
392 Ga0207703_10390456 3300026035 Bacteria 1289
393 Ga0207639_10002258 3300026041 Bacteria 12947
394 Ga0207639_10004446 3300026041 Bacteria 9460
395 Ga0207639_10010341 3300026041 Bacteria 6462
396 Ga0207639_10347072 3300026041 Unclassified 1325
397 Ga0207639_10507194 3300026041 Bacteria 1103
398 Ga0207678_10021646 3300026067 Bacteria 5638
399 Ga0207678_10037823 3300026067 Bacteria 4196
400 Ga0207678_10171676 3300026067 Bacteria 1851
401 Ga0207702_10001388 3300026078 Bacteria 24146
402 Ga0207702_10157639 3300026078 Unclassified 2070
403 Ga0207641_10001176 3300026088 Bacteria 26293
404 Ga0207641_10002568 3300026088 Bacteria 16688
405 Ga0207648_10003938 3300026089 Bacteria 15449
406 Ga0207648_10081221 3300026089 Bacteria 2828
407 Ga0207648_10148119 3300026089 Bacteria 2071
408 Ga0207648_10302929 3300026089 Bacteria 1433
409 Ga0207676_10004026 3300026095 Bacteria 10374
410 Ga0207676_10012414 3300026095 Bacteria 6104
411 Ga0207676_10167092 3300026095 Unclassified 1913
412 Ga0207674_10001817 3300026116 Bacteria 27232
413 Ga0207674_10011356 3300026116 Bacteria 10010
414 Ga0207674_10062929 3300026116 Bacteria 3747
415 Ga0207675_100009922 3300026118 Bacteria 8914
416 Ga0207675_100039558 3300026118 Bacteria 4401
417 Ga0207675_100259467 3300026118 Bacteria 1684
418 Ga0207683_10002450 3300026121 Bacteria 16184
419 Ga0207683_10015716 3300026121 Bacteria 6441
420 Ga0207698_10005224 3300026142 Bacteria 7984
421 Ga0207698_10009894 3300026142 Bacteria 6098
422 Ga0207698_10180862 3300026142 Bacteria 1868
423 Ga0207698_10189899 3300026142 Bacteria 1829
424 Ga0207698_10281368 3300026142 Bacteria 1539
425 Ga0207698_10300067 3300026142 Unclassified 1495
426 Ga0207698_10413240 3300026142 Bacteria 1293
427 Ga0207698_10549692 3300026142 Unclassified 1131
428 Ga0268266_10019204 3300028379 Bacteria 5820
429 Ga0268266_10290640 3300028379 Unclassified 1522
430 Ga0268265_10147652 3300028380 Bacteria 1978
431 Ga0268265_10562819 3300028380 Bacteria 1084
432 Ga0268264_10023894 3300028381 Bacteria 4986
433 Ga0268264_10042479 3300028381 Bacteria 3763
434 Ga0268264_10092092 3300028381 Bacteria 2616
435 Ga0307515_10000493 3300028794 Bacteria 94441
436 Ga0265327_10002707 3300031251 Bacteria 18175
437 Ga0307509_10288218 3300031507 Bacteria 1398
438 Ga0307510_10005124 3300033180 Bacteria 15574
439 Ga0373956_0059553 3300035119 Bacteria 1728
440 Ga0373933_0039104 3300035724 Bacteria 2790
441 Ga0373947_0066815 3300035725 Bacteria 2195
442 Ga0373937_0100593 3300036401 Bacteria 2683
443 Ga0373937_0186280 3300036401 Unclassified 1950
444 Ga0395899_0009825 3300037312 Bacteria 7340
445 Ga0395899_0020917 3300037312 Bacteria 4962
446 Ga0395900_0018331 3300037418 Bacteria 7141
447 Ga0395900_0051806 3300037418 Bacteria 4226
448 Ga0395900_0178300 3300037418 Unclassified 2161
449 Ga0395900_0371706 3300037418 Unclassified 1399
450 Ga0395898_0009452 3300037466 Bacteria 10240
451 Ga0395898_0015207 3300037466 Bacteria 7900
452 Ga0395898_0022489 3300037466 Bacteria 6385
453 Ga0395898_0363349 3300037466 Unclassified 1380
454 Ga0395905_0008849 3300037471 Bacteria 9893
455 Ga0395905_0160880 3300037471 Unclassified 2110
456 Ga0395905_0576936 3300037471 Bacteria 1026
457 Ga0395901_0025149 3300038443 Bacteria 6112
458 Ga0395901_0037185 3300038443 Bacteria 5035
459 Ga0395901_0039186 3300038443 Bacteria 4903
460 Ga0436365_0473715 3300039437 Bacteria 54513
461 Ga0451577_0013097 3300042876 Bacteria 7774
462 Ga0466972_0001168 3300044658 Bacteria 12577
463 Ga0453684_0087318 3300044712 Bacteria 3866
464 Ga0466968_0018641 3300044735 Bacteria 2785
465 Ga0495580_0157274 3300046472 Unclassified 1574
466 Ga0495606_0008070 3300046507 Bacteria 9238
467 Ga0495618_0259415 3300046514 Bacteria 1089
468 Ga0495630_0088423 3300046517 Bacteria 2340
469 Ga0495625_0008013 3300046660 Bacteria 9070
470 Ga0495599_0341605 3300046678 Bacteria 899
471 Ga0495658_0213343 3300046683 Bacteria 1207
472 Ga0495600_0105414 3300046809 Bacteria 1837
473 Ga0495674_0165144 3300047319 Bacteria 1850
474 Ga0495674_0283197 3300047319 Bacteria 1358
475 Ga0495686_0000061 3300047472 Bacteria 236734
476 Ga0496104_0426644 3300048907 Unclassified 1238
477 Ga0496108_0459706 3300048911 Bacteria 1112
478 Ga0496109_0038376 3300048912 Bacteria 4330
479 Ga0501080_0154226 3300049742 Bacteria 2122
480 2910248441 2910245624 Bacteria 6935613
481 Ga0070669_100001217
482 rootH2_10066796
483 Ga0070658_10002976
484 Ga0070658_10193197
485 Ga0070658_10208361
486 Ga0070676_10000262
487 Ga0070676_10042848
488 Ga0070676_10079502
489 Ga0070676_10138932
490 Ga0070683_100004434
491 Ga0070683_100082257
492 Ga0070683_100096301
493 Ga0070670_100086092
494 Ga0068869_100006489
495 Ga0068869_100014039
496 Ga0068869_100039920
497 Ga0068869_100065945
498 Ga0068869_100133448
499 Ga0070666_10000174
500 Ga0070666_10000265
501 Ga0070666_10045112
502 Ga0070666_10058974
503 Ga0070680_100005945
504 Ga0070680_100041434
505 Ga0070682_100059028
506 Ga0068868_100000845
507 Ga0068868_100016266
508 Ga0068868_100021249
509 Ga0068868_100516735
510 Ga0070660_100070786
511 Ga0070689_100117588
512 Ga0070689_100165126
513 Ga0070689_100293199
514 Ga0070687_100051649
515 Ga0070661_100001488
516 Ga0070661_100013499
517 Ga0070661_100082420
518 Ga0070661_100166743
519 Ga0070668_100000036
520 Ga0070668_100078467
521 Ga0070668_100134202
522 Ga0070668_100344503
523 Ga0070669_100392027
524 Ga0070675_100023993
525 Ga0070675_100065355
526 Ga0070675_100077486
527 Ga0070675_100147440
528 Ga0070675_100200159
529 Ga0070675_100226004
530 Ga0070671_100010752
531 Ga0070671_100135317
532 Ga0070671_100157346
533 Ga0070674_100017387
534 Ga0070673_100000905
535 Ga0070673_100035035
536 Ga0070673_100040591
537 Ga0070673_100045542
538 Ga0070673_100046088
539 Ga0070673_100372813
540 Ga0070688_100009819
541 Ga0070688_100014229
542 Ga0070688_100279385
543 Ga0070659_100002804
544 Ga0070659_100016040
545 Ga0070667_100000151
546 Ga0070667_100017922
547 Ga0070667_100046547
548 Ga0070701_10080272
549 Ga0070663_100144575
550 Ga0070663_100161764
551 Ga0070678_100020750
552 Ga0070662_100019390
553 Ga0070662_100040699
554 Ga0070662_100086568
555 Ga0070662_100156407
556 Ga0070662_100260363
557 Ga0070662_100361083
558 Ga0070681_10009892
559 Ga0070681_10049923
560 Ga0068867_100001155
561 Ga0068867_100021109
562 Ga0070685_10012446
563 Ga0070685_10022188
564 Ga0070679_100012369
565 Ga0070679_100591019
566 Ga0070684_100006173
567 Ga0070684_100025179
568 Ga0070684_100104802
569 Ga0070684_100127856
570 Ga0070684_100172565
571 Ga0070684_100288873
572 Ga0070684_100433990
573 Ga0068853_100001327
574 Ga0068853_100014472
575 Ga0068853_100056364
576 Ga0068853_100059469
577 Ga0070672_100000481
578 Ga0070672_100013168
579 Ga0070672_100085974
580 Ga0070672_100135099
581 Ga0070665_100004271
582 Ga0070665_100018270
583 Ga0070665_100302650
584 Ga0068855_100002469
585 Ga0068855_100002849
586 Ga0068855_100010544
587 Ga0068855_100082423
588 Ga0068855_100616835
589 Ga0070664_100000360
590 Ga0070664_100018351
591 Ga0070664_100023562
592 Ga0070664_100043242
593 Ga0070664_100069291
594 Ga0070664_100229137
595 Ga0070664_100425834
596 Ga0068857_100000323
597 Ga0068854_100075528
598 Ga0068854_100122803
599 Ga0068854_100160800
600 Ga0068854_100188543
601 Ga0068856_100000636
602 Ga0070702_100002295
603 Ga0068852_100006889
604 Ga0068852_100018436
605 Ga0068852_100122792
606 Ga0068852_100131550
607 Ga0068852_100162432
608 Ga0068852_100181427
609 Ga0068852_100229960
610 Ga0068859_100001134
611 Ga0068859_100009512
612 Ga0068859_100067440
613 Ga0068859_100111078
614 Ga0068859_100323326
615 Ga0068864_100003274
616 Ga0068864_100023198
617 Ga0068864_100027391
618 Ga0068864_100244647
619 Ga0068864_100280591
620 Ga0068866_10094502
621 Ga0068861_100056525
622 Ga0068861_100068070
623 Ga0068870_10072429
624 Ga0068870_10078222
625 Ga0068863_100000510
626 Ga0068863_100007927
627 Ga0068863_100065208
628 Ga0068858_100000760
629 Ga0068858_100024468
630 Ga0068858_100030128
631 Ga0068858_100172241
632 Ga0068858_100175739
633 Ga0068860_100002392
634 Ga0068860_100008850
635 Ga0068860_100025347
636 Ga0068862_100154179
637 Ga0097621_100005221
638 Ga0097621_100014884
639 Ga0097621_100032204
640 Ga0097621_100044776
641 Ga0097621_100078359
642 Ga0097621_100228353
643 Ga0097621_100351670
644 Ga0068871_100045371
645 Ga0068871_100087114
646 Ga0068871_100143778
647 Ga0068871_100160081
648 Ga0068871_100233109
649 Ga0068871_100370227
650 Ga0075429_100414109
651 Ga0068865_100010664
652 Ga0068865_100062236
653 Ga0097620_100001134
654 Ga0097620_100009512
655 Ga0097620_100067443
656 Ga0097620_100111092
657 Ga0097620_100323306
658 Ga0105240_10000273
659 Ga0105240_10000986
660 Ga0105240_10068645
661 Ga0105240_10138245
662 Ga0105240_10346823
663 Ga0111539_10174398
664 Ga0105247_10022110
665 Ga0105243_10037448
666 Ga0105241_10001753
667 Ga0105241_10019153
668 Ga0105241_10139113
669 Ga0105241_10270747
670 Ga0105242_10010310
671 Ga0105242_10363571
672 Ga0105242_10459120
673 Ga0105237_10005174
674 Ga0105237_10014033
675 Ga0105237_10036552
676 Ga0105237_10062575
677 Ga0105238_10006791
678 Ga0105238_10026821
679 Ga0105249_10000514
680 Ga0105249_10018550
681 Ga0105249_10162186
682 Ga0105239_10019031
683 Ga0105239_10019137
684 Ga0105239_10062372
685 Ga0105239_10082118
686 Ga0105239_10135803
687 Ga0105246_10032056
688 Ga0105246_10244119
689 Ga0157373_10001683
690 Ga0157373_10023916
691 Ga0157371_10002532
692 Ga0157371_10002605
693 Ga0157371_10006357
694 Ga0157371_10021977
695 Ga0157371_10042570
696 Ga0157371_10080125
697 Ga0157371_10276452
698 Ga0157370_10031520
699 Ga0157370_10032183
700 Ga0157370_10116818
701 Ga0157370_10119165
702 Ga0157370_10381960
703 Ga0157370_10471872
704 Ga0157370_10500381
705 Ga0157369_10039577
706 Ga0157369_10040833
707 Ga0157369_10104826
708 Ga0157369_10114956
709 Ga0157369_10494887
710 Ga0157369_10526768
711 Ga0157374_10000153
712 Ga0157374_10000693
713 Ga0157374_10012676
714 Ga0157374_10049323
715 Ga0157378_10001467
716 Ga0157378_10007374
717 Ga0157378_10022204
718 Ga0157378_10062064
719 Ga0157378_10064768
720 Ga0157378_10124359
721 Ga0157378_10161025
722 Ga0157378_10400314
723 Ga0157378_10646237
724 Ga0163162_10000040
725 Ga0163162_10018617
726 Ga0163162_10022082
727 Ga0163162_10059426
728 Ga0163162_10059927
729 Ga0163162_10122135
730 Ga0163162_10242487
731 Ga0163162_10327224
732 Ga0157372_10017471
733 Ga0157372_10018987
734 Ga0157372_10030645
735 Ga0157372_10034341
736 Ga0157372_10071320
737 Ga0157372_10114408
738 Ga0157372_10124102
739 Ga0157372_10128360
740 Ga0157372_10187715
741 Ga0157372_10214918
742 Ga0157372_10283518
743 Ga0157372_10316117
744 Ga0157372_10863817
745 Ga0157375_10001694
746 Ga0157375_10051721
747 Ga0157375_10083551
748 Ga0157375_10089250
749 Ga0157375_10137707
750 Ga0157375_10170570
751 Ga0157375_10203406
752 Ga0157375_10346113
753 Ga0163163_10001181
754 Ga0163163_10029933
755 Ga0163163_10126785
756 Ga0157380_10018387
757 Ga0157377_10031341
758 Ga0157377_10040975
759 Ga0157379_10000114
760 Ga0157379_10023185
761 Ga0157379_10068354
762 Ga0157379_10090826
763 Ga0157379_10139909
764 Ga0157376_10000278
765 Ga0157376_10003309
766 Ga0157376_10079445
767 Ga0157376_10161580
768 Ga0163161_10009051
769 Ga0163161_10018156
770 Ga0163161_10079909
771 Ga0163161_10169034
772 Ga0206352_11258222
773 Ga0213876_10003829
774 Ga0207697_10007681
775 Ga0207697_10126420
776 Ga0207682_10088855
777 Ga0207688_10148058
778 Ga0207680_10004183
779 Ga0207680_10005732
780 Ga0207680_10110256
781 Ga0207680_10188756
782 Ga0207645_10000631
783 Ga0207645_10002363
784 Ga0207645_10002472
785 Ga0207645_10020637
786 Ga0207645_10044542
787 Ga0207643_10066031
788 Ga0207705_10004245
789 Ga0207705_10010371
790 Ga0207705_10031483
791 Ga0207705_10170136
792 Ga0207654_10002696
793 Ga0207654_10166884
794 Ga0207654_10219893
795 Ga0207707_10040372
796 Ga0207707_10136005
797 Ga0207695_10000130
798 Ga0207695_10000981
799 Ga0207695_10306816
800 Ga0207671_10008668
801 Ga0207671_10013703
802 Ga0207660_10077448
803 Ga0207657_10018767
804 Ga0207657_10262258
805 Ga0207649_10002021
806 Ga0207649_10081271
807 Ga0207652_10001124
808 Ga0207652_10006214
809 Ga0207652_10212519
810 Ga0207681_10162027
811 Ga0207694_10037118
812 Ga0207694_10043765
813 Ga0207659_10129480
814 Ga0207644_10032731
815 Ga0207690_10019573
816 Ga0207690_10205185
817 Ga0207706_10006646
818 Ga0207706_10008847
819 Ga0207706_10034086
820 Ga0207706_10117050
821 Ga0207706_10150857
822 Ga0207709_10137757
823 Ga0207670_10023019
824 Ga0207670_10042567
825 Ga0207669_10011482
826 Ga0207704_10328803
827 Ga0207691_10000067
828 Ga0207691_10007465
829 Ga0207691_10027133
830 Ga0207691_10105009
831 Ga0207691_10157598
832 Ga0207691_10281262
833 Ga0207711_10356907
834 Ga0207689_10003978
835 Ga0207689_10010859
836 Ga0207689_10013446
837 Ga0207689_10048471
838 Ga0207689_10109354
839 Ga0207661_10004201
840 Ga0207661_10005213
841 Ga0207661_10079650
842 Ga0207679_10000575
843 Ga0207679_10013541
844 Ga0207679_10023446
845 Ga0207679_10076721
846 Ga0207679_10119635
847 Ga0207667_10000131
848 Ga0207667_10001209
849 Ga0207667_10002579
850 Ga0207667_10303204
851 Ga0207667_10492042
852 Ga0207651_10012824
853 Ga0207651_10092431
854 Ga0207651_10354710
855 Ga0207712_10009298
856 Ga0207668_10000274
857 Ga0207668_10150876
858 Ga0207640_10132172
859 Ga0207640_10251031
860 Ga0207658_10000225
861 Ga0207658_10017690
862 Ga0207658_10197353
863 Ga0207658_10285530
864 Ga0207677_10009301
865 Ga0207677_10011712
866 Ga0207677_10059546
867 Ga0207703_10001243
868 Ga0207703_10003872
869 Ga0207703_10063530
870 Ga0207703_10174802
871 Ga0207703_10331281
872 Ga0207703_10390456
873 Ga0207639_10002258
874 Ga0207639_10004446
875 Ga0207639_10010341
876 Ga0207639_10347072
877 Ga0207639_10507194
878 Ga0207678_10021646
879 Ga0207678_10037823
880 Ga0207678_10171676
881 Ga0207702_10001388
882 Ga0207702_10157639
883 Ga0207641_10001176
884 Ga0207641_10002568
885 Ga0207648_10003938
886 Ga0207648_10081221
887 Ga0207648_10148119
888 Ga0207648_10302929
889 Ga0207676_10004026
890 Ga0207676_10012414
891 Ga0207676_10167092
892 Ga0207674_10001817
893 Ga0207674_10011356
894 Ga0207674_10062929
895 Ga0207675_100009922
896 Ga0207675_100039558
897 Ga0207675_100259467
898 Ga0207683_10002450
899 Ga0207683_10015716
900 Ga0207698_10005224
901 Ga0207698_10009894
902 Ga0207698_10180862
903 Ga0207698_10189899
904 Ga0207698_10281368
905 Ga0207698_10300067
906 Ga0207698_10413240
907 Ga0207698_10549692
908 Ga0268266_10019204
909 Ga0268266_10290640
910 Ga0268265_10147652
911 Ga0268265_10562819
912 Ga0268264_10023894
913 Ga0268264_10042479
914 Ga0268264_10092092
915 Ga0307515_10000493
916 Ga0265327_10002707
917 Ga0307509_10288218
918 Ga0307510_10005124
919 Ga0373956_0059553
920 Ga0373933_0039104
921 Ga0373947_0066815
922 Ga0373937_0100593
923 Ga0373937_0186280
924 Ga0395899_0009825
925 Ga0395899_0020917
926 Ga0395900_0018331
927 Ga0395900_0051806
928 Ga0395900_0178300
929 Ga0395900_0371706
930 Ga0395898_0009452
931 Ga0395898_0015207
932 Ga0395898_0022489
933 Ga0395898_0363349
934 Ga0395905_0008849
935 Ga0395905_0160880
936 Ga0395905_0576936
937 Ga0395901_0025149
938 Ga0395901_0037185
939 Ga0395901_0039186
940 Ga0436365_0473715
941 Ga0451577_0013097
942 Ga0466972_0001168
943 Ga0453684_0087318
944 Ga0466968_0018641
945 Ga0495580_0157274
946 Ga0495606_0008070
947 Ga0495618_0259415
948 Ga0495630_0088423
949 Ga0495625_0008013
950 Ga0495599_0341605
951 Ga0495658_0213343
952 Ga0495600_0105414
953 Ga0495674_0165144
954 Ga0495674_0283197
955 Ga0495686_0000061
956 Ga0496104_0426644
957 Ga0496108_0459706
958 Ga0496109_0038376
959 Ga0501080_0154226
960 2910248441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

121

380

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8387 35 297
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8315 35 297
3obe-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8208 36 315
8bvk-assembly1.cif.gz_A the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.7896 36 299
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.7777 36 316
ID Description Score Start End Superfamily
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8206 38 315 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7672 38 315 3.20.20.150
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7665 37 312 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.751 38 314 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7409 38 314 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A4Q3NNB0-F1-model_v4 deleted 0.9667 141 314
AF-A0A1N6VKZ3-F1-model_v4 Xylose isomerase-like TIM barrel 0.9627 189 312 GO:0016853
AF-A0A318VBP8-F1-model_v4 deleted 0.9596 239 317
AF-A0A4Q3ATP5-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9539 192 316 GO:0016853
AF-A0A841FN49-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9515 36 314 GO:0016853

Map