F452228

General Info

Members Datasets Scaffolds Average Seq Length
480 262 960 368

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10001081|Ga0182008_100010816
Length 356
Sequence MANTWQAGRRIGLGLTLAAAVLALPAHAQEEKVLNIYNWSDYIGDDTIKNFEKETGIKVRYDVFDNNEILNAKLVAGKSGYDIVVPTAQWARLQIDAGLLRKLDKSKLTNLGNNDYLVDWLWGYTTVGINVNKVKAALGGMPMPDNAWELIFDPKYAAKLKSCGVSFLDSPSEVLPAALQYLGKPAYSKTAADYQEAGKVLQAIRPYVTLFSSSGYINDMANGSVCVALGWSGDINIARQRAIDAKNGNVIQVLVPKTAALMFDTMAIPADAPHPNNAHLFINYILRPQVHASLSNKVFYANPNLASIKYVRKDIGENKAIFLPDADKQRMAAPEATTADIRRLMTRIYTKFKTGV

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
97 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
127 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
128 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
129 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
132 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
133 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
204 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
209 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
210 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
211 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
212 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
213 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
214 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
215 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
216 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
217 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
223 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
228 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
233 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
234 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
235 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
236 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
237 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
238 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
239 2643221645 Massilia sp. Root351 Isolate Unclassified
240 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
241 2643221660 Methylibium sp. Root1272 Isolate Unclassified
242 2643221664 Massilia sp. Root418 Isolate Unclassified
243 2738541280 Massilia sp. GV090 Isolate Unclassified
244 2738541297 Duganella sp. GV083 Isolate Unclassified
245 2738541300 Massilia sp. GV016 Isolate Unclassified
246 2738541357 Duganella sp. GV053 Isolate Unclassified
247 2738543003 Duganella sp. GV066 Isolate Unclassified
248 2738543018 Massilia sp. GV045 Isolate Unclassified
249 2738543026 Duganella sp. GV089 Isolate Unclassified
250 2738543029 Duganella sp. GV039 Isolate Unclassified
251 2738543030 Massilia sp. GV097 Isolate Unclassified
252 2821131069 Duganella sp. 1224 Isolate Unclassified
253 2842711865 Duganella sp. R-73148 Isolate Unclassified
254 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
255 2857553236 Duganella sp. R-74557 Isolate Unclassified
256 2857558681 Duganella sp. R-74565 Isolate Unclassified
257 2857564685 Duganella sp. R-74599 Isolate Unclassified
258 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
259 2904424332 Duganella sp. 1411 Isolate Rhizosphere
260 2919476304 Duganella sp. 3397 Isolate Unclassified
261 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
262 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.71
Metatranscriptomes 0.62
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.79
Nodule 0.21
Rhizoplane 2.08
Rhizosphere 58.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10001081 3300014497 Bacteria 18801
2 JGI25156J39149_1000278 3300002705 Bacteria 34709
3 JGI25156J39149_1000973 3300002705 Bacteria 13642
4 JGI25156J39149_1011021 3300002705 Bacteria 2075
5 JGI25156J39149_1016398 3300002705 Bacteria 1441
6 JGI25154J39366_1000221 3300002738 Bacteria 38916
7 JGI25154J39366_1002307 3300002738 Bacteria 5115
8 JGI25157J39369_1000049 3300002741 Bacteria 115611
9 JGI25164J39214_1002144 3300002772 Bacteria 3312
10 JGI25152J39213_1008298 3300002773 Bacteria 2589
11 JGI25150J39212_1006247 3300002774 Bacteria 2476
12 JGI26128J50194_1000683 3300003347 Bacteria 1969
13 Ga0055539_1000583 3300003752 Bacteria 10242
14 Ga0055539_1001782 3300003752 Bacteria 3705
15 Ga0055533_1000010 3300003756 Bacteria 491196
16 Ga0055525_1000775 3300003759 Bacteria 10334
17 Ga0055535_1000508 3300003761 Bacteria 34490
18 Ga0055535_1000607 3300003761 Bacteria 29519
19 Ga0055535_1000906 3300003761 Bacteria 20145
20 Ga0055535_1004988 3300003761 Bacteria 3036
21 Ga0055529_1000103 3300003763 Bacteria 127175
22 Ga0055529_1000125 3300003763 Bacteria 110810
23 Ga0055529_1000461 3300003763 Bacteria 39448
24 Ga0055529_1000731 3300003763 Bacteria 21383
25 Ga0055526_1000016 3300003771 Bacteria 213710
26 Ga0055526_1000118 3300003771 Bacteria 69508
27 Ga0055526_1000323 3300003771 Bacteria 39660
28 Ga0055526_1001301 3300003771 Bacteria 17893
29 Ga0055530_10010772 3300003791 Bacteria 3343
30 Ga0065165_1000774 3300005262 Bacteria 43046
31 Ga0065704_10116252 3300005289 Bacteria 1857
32 Ga0065715_10133414 3300005293 Bacteria 1973
33 Ga0070658_10040640 3300005327 Bacteria 3752
34 Ga0068869_100053998 3300005334 Bacteria 2923
35 Ga0070687_100011810 3300005343 Bacteria 3835
36 Ga0070687_100035062 3300005343 Bacteria 2488
37 Ga0070687_100041827 3300005343 Bacteria 2318
38 Ga0070687_100046054 3300005343 Bacteria 2231
39 Ga0070675_100108464 3300005354 Bacteria 2345
40 Ga0070673_100108886 3300005364 Bacteria 2295
41 Ga0070673_100150024 3300005364 Bacteria 1974
42 Ga0070678_100111731 3300005456 Bacteria 2139
43 Ga0070678_100227732 3300005456 Bacteria 1552
44 Ga0070662_100015686 3300005457 Bacteria 5079
45 Ga0068867_100042592 3300005459 Bacteria 3322
46 Ga0068867_100171795 3300005459 Bacteria 1717
47 Ga0068853_100008381 3300005539 Bacteria 8302
48 Ga0068855_100052495 3300005563 Bacteria 4799
49 Ga0068857_100024975 3300005577 Bacteria 5263
50 Ga0068854_100022112 3300005578 Bacteria 4326
51 Ga0068856_100039320 3300005614 Bacteria 4644
52 Ga0068861_100040263 3300005719 Bacteria 3493
53 Ga0075367_10135200 3300006178 Bacteria 1525
54 Ga0075369_10049013 3300006186 Bacteria 1824
55 Ga0075366_10006521 3300006195 Bacteria 6399
56 Ga0075366_10011236 3300006195 Bacteria 5052
57 Ga0075366_10042565 3300006195 Bacteria 2689
58 Ga0075366_10056980 3300006195 Bacteria 2322
59 Ga0075370_10016883 3300006353 Bacteria 3936
60 Ga0075370_10049446 3300006353 Bacteria 2384
61 Ga0105244_10018325 3300009036 Bacteria 3929
62 Ga0105244_10023373 3300009036 Bacteria 3389
63 Ga0105240_10001892 3300009093 Bacteria 34765
64 Ga0105240_10180657 3300009093 Bacteria 2490
65 Ga0105241_10335256 3300009174 Bacteria 1309
66 Ga0105248_10527724 3300009177 Bacteria 1331
67 Ga0105237_10000080 3300009545 Bacteria 127788
68 Ga0105237_10000296 3300009545 Bacteria 68633
69 Ga0105238_10000711 3300009551 Bacteria 34783
70 Ga0105238_10009413 3300009551 Bacteria 9781
71 Ga0105239_10000116 3300010375 Bacteria 112811
72 Ga0105239_10000250 3300010375 Bacteria 80439
73 Ga0105239_10025926 3300010375 Bacteria 6455
74 Ga0157369_10043726 3300013105 Bacteria 4881
75 Ga0157378_10086731 3300013297 Bacteria 2838
76 Ga0157379_10069629 3300014968 Bacteria 3147
77 Ga0182006_1000096 3300015261 Bacteria 104597
78 Ga0182006_1000251 3300015261 Bacteria 49986
79 Ga0182007_10000105 3300015262 Bacteria 59619
80 Ga0182005_1000013 3300015265 Bacteria 396391
81 Ga0182005_1000038 3300015265 Bacteria 160030
82 Ga0163161_10042734 3300017792 Bacteria 3261
83 Ga0213872_10000020 3300021361 Bacteria 159607
84 Ga0213872_10002650 3300021361 Bacteria 10379
85 Ga0213872_10007586 3300021361 Bacteria 5320
86 Ga0213872_10036586 3300021361 Bacteria 2243
87 Ga0209674_100003 3300025226 Bacteria 2196646
88 Ga0209672_104405 3300025228 Bacteria 2616
89 Ga0209672_106061 3300025228 Bacteria 2006
90 Ga0209563_100049 3300025230 Bacteria 358472
91 Ga0209563_107585 3300025230 Bacteria 1770
92 Ga0207427_100280 3300025231 Bacteria 37213
93 Ga0209437_104864 3300025233 Bacteria 2332
94 Ga0209258_100080 3300025242 Bacteria 255287
95 Ga0209258_100163 3300025242 Bacteria 149677
96 Ga0209258_100180 3300025242 Bacteria 137306
97 Ga0209258_101256 3300025242 Bacteria 9694
98 Ga0207425_1000170 3300025245 Bacteria 53604
99 Ga0207425_1000435 3300025245 Bacteria 27645
100 Ga0207425_1000624 3300025245 Bacteria 20169
101 Ga0209646_1000072 3300025246 Bacteria 224823
102 Ga0209646_1000138 3300025246 Bacteria 114892
103 Ga0209026_1000021 3300025250 Bacteria 375165
104 Ga0209677_100145 3300025253 Bacteria 65577
105 Ga0209677_100209 3300025253 Bacteria 45370
106 Ga0209759_1000025 3300025256 Bacteria 317082
107 Ga0209759_1000612 3300025256 Bacteria 34434
108 Ga0209759_1000937 3300025256 Bacteria 21027
109 Ga0209759_1001401 3300025256 Bacteria 13807
110 Ga0209759_1002119 3300025256 Bacteria 9190
111 Ga0209759_1011147 3300025256 Bacteria 2578
112 Ga0209759_1022566 3300025256 Bacteria 1404
113 Ga0209129_1000115 3300025258 Bacteria 141048
114 Ga0209129_1007977 3300025258 Bacteria 3025
115 Ga0209455_1000030 3300025272 Bacteria 533479
116 Ga0209455_1000044 3300025272 Bacteria 410787
117 Ga0209455_1000059 3300025272 Bacteria 339995
118 Ga0209455_1000144 3300025272 Bacteria 137313
119 Ga0209673_1005874 3300025273 Bacteria 6071
120 Ga0209673_1007682 3300025273 Bacteria 4915
121 Ga0209025_1005755 3300025294 Bacteria 9953
122 Ga0209025_1009840 3300025294 Bacteria 6588
123 Ga0209564_1000002 3300025295 Bacteria 1636803
124 Ga0209564_1000007 3300025295 Bacteria 1028582
125 Ga0209564_1000053 3300025295 Bacteria 351452
126 Ga0209758_1000089 3300025297 Bacteria 251523
127 Ga0209758_1000225 3300025297 Bacteria 121158
128 Ga0209758_1000228 3300025297 Bacteria 119948
129 Ga0209758_1000394 3300025297 Bacteria 75557
130 Ga0209050_1000374 3300025298 Bacteria 85298
131 Ga0209051_1003155 3300025303 Bacteria 11068
132 Ga0209051_1032655 3300025303 Bacteria 1981
133 Ga0207655_1006318 3300025728 Bacteria 7872
134 Ga0207682_10018586 3300025893 Bacteria 2719
135 Ga0207705_10020837 3300025909 Bacteria 4680
136 Ga0207695_10020992 3300025913 Bacteria 7461
137 Ga0207695_10069535 3300025913 Bacteria 3602
138 Ga0207671_10004679 3300025914 Bacteria 12948
139 Ga0207671_10011972 3300025914 Bacteria 7013
140 Ga0207662_10018335 3300025918 Bacteria 3970
141 Ga0207662_10056746 3300025918 Bacteria 2340
142 Ga0207657_10029841 3300025919 Bacteria 4957
143 Ga0207657_10125281 3300025919 Bacteria 2110
144 Ga0207657_10269356 3300025919 Bacteria 1354
145 Ga0207694_10003638 3300025924 Bacteria 12208
146 Ga0207694_10004090 3300025924 Bacteria 11471
147 Ga0207659_10046435 3300025926 Bacteria 3067
148 Ga0207706_10009625 3300025933 Bacteria 8870
149 Ga0207686_10030856 3300025934 Bacteria 3178
150 Ga0207669_10039796 3300025937 Bacteria 2721
151 Ga0207691_10081286 3300025940 Bacteria 2913
152 Ga0207711_10262713 3300025941 Bacteria 1587
153 Ga0207689_10014227 3300025942 Bacteria 6771
154 Ga0207667_10009539 3300025949 Bacteria 11420
155 Ga0207651_10101672 3300025960 Bacteria 2134
156 Ga0207640_10011003 3300025981 Bacteria 5108
157 Ga0207639_10014781 3300026041 Bacteria 5498
158 Ga0207678_10271161 3300026067 Bacteria 1455
159 Ga0207702_10000800 3300026078 Bacteria 33369
160 Ga0207648_10059840 3300026089 Bacteria 3322
161 Ga0207675_100052490 3300026118 Bacteria 3804
162 Ga0207683_10045373 3300026121 Bacteria 3844
163 Ga0207698_10226282 3300026142 Bacteria 1694
164 Ga0209281_1004417 3300027111 Bacteria 4217
165 Ga0209981_1001531 3300027378 Bacteria 2925
166 Ga0209996_1001584 3300027395 Bacteria 2773
167 Ga0209995_1000303 3300027471 Bacteria 7736
168 Ga0209968_1000359 3300027526 Bacteria 7590
169 Ga0209966_1000031 3300027695 Bacteria 63685
170 Ga0209974_10013101 3300027876 Bacteria 2765
171 Ga0268266_10057246 3300028379 Bacteria 3354
172 Ga0268266_10215598 3300028379 Bacteria 1762
173 Ga0268265_10426394 3300028380 Bacteria 1233
174 Ga0265336_10000006 3300028666 Bacteria 348453
175 Ga0265336_10000032 3300028666 Bacteria 167925
176 Ga0307517_10025872 3300028786 Bacteria 7146
177 Ga0307515_10000006 3300028794 Bacteria 725810
178 Ga0307515_10000013 3300028794 Bacteria 568456
179 Ga0307515_10000043 3300028794 Bacteria 304612
180 Ga0307515_10000291 3300028794 Bacteria 123206
181 Ga0307515_10000652 3300028794 Bacteria 80185
182 Ga0307515_10001063 3300028794 Bacteria 62886
183 Ga0307515_10001678 3300028794 Bacteria 49347
184 Ga0307515_10003883 3300028794 Bacteria 31216
185 Ga0307515_10009632 3300028794 Bacteria 18642
186 Ga0307515_10009637 3300028794 Bacteria 18637
187 Ga0307515_10023444 3300028794 Bacteria 10813
188 Ga0307515_10107197 3300028794 Bacteria 3306
189 Ga0265324_10001596 3300029957 Bacteria 12620
190 Ga0307512_10025065 3300030522 Bacteria 5292
191 Ga0265328_10000063 3300031239 Bacteria 61942
192 Ga0307513_10029768 3300031456 Bacteria 6216
193 Ga0307513_10085509 3300031456 Bacteria 3236
194 Ga0307513_10137698 3300031456 Bacteria 2374
195 Ga0307509_10000120 3300031507 Bacteria 114238
196 Ga0307509_10003007 3300031507 Bacteria 26366
197 Ga0307509_10048180 3300031507 Bacteria 4578
198 Ga0307509_10111171 3300031507 Bacteria 2743
199 Ga0307508_10000163 3300031616 Bacteria 80086
200 Ga0307508_10000248 3300031616 Bacteria 65511
201 Ga0307508_10000254 3300031616 Bacteria 65091
202 Ga0307508_10021341 3300031616 Bacteria 5888
203 Ga0307508_10285463 3300031616 Bacteria 1244
204 Ga0307514_10026508 3300031649 Bacteria 4686
205 Ga0307514_10073484 3300031649 Bacteria 2557
206 Ga0265314_10135247 3300031711 Bacteria 1532
207 Ga0307516_10000381 3300031730 Bacteria 58016
208 Ga0307516_10000402 3300031730 Bacteria 56504
209 Ga0307516_10000860 3300031730 Bacteria 41628
210 Ga0307516_10000878 3300031730 Bacteria 41335
211 Ga0307516_10012872 3300031730 Bacteria 8976
212 Ga0307516_10050466 3300031730 Bacteria 4082
213 Ga0307516_10134101 3300031730 Bacteria 2253
214 Ga0307510_10030745 3300033180 Bacteria 6082
215 Ga0307510_10033981 3300033180 Bacteria 5717
216 Ga0373934_0064307 3300035086 Bacteria 1464
217 Ga0373939_0003667 3300035114 Bacteria 3617
218 Ga0373931_0005337 3300035691 Bacteria 5932
219 Ga0395899_0153161 3300037312 Bacteria 1633
220 Ga0395898_0016172 3300037466 Bacteria 7642
221 Ga0395898_0025134 3300037466 Bacteria 6006
222 Ga0395905_0299998 3300037471 Bacteria 1494
223 Ga0395901_0014533 3300038443 Bacteria 8005
224 Ga0436361_0156868 3300039447 Bacteria 10726
225 Ga0436361_0194657 3300039447 Bacteria 16315
226 Ga0436361_0372225 3300039447 Bacteria 5721
227 Ga0436361_0402949 3300039447 Bacteria 5279
228 Ga0436361_0538733 3300039447 Bacteria 51899
229 Ga0436361_0565164 3300039447 Bacteria 9490
230 Ga0436361_0648806 3300039447 Bacteria 3107
231 Ga0436361_0881810 3300039447 Bacteria 5351
232 Ga0436361_1024184 3300039447 Bacteria 85708
233 Ga0451789_0811653 3300041443 Bacteria 1360
234 Ga0451800_0868808 3300041459 Bacteria 1395
235 Ga0451804_1082106 3300041463 Bacteria 1302
236 Ga0451841_1010115 3300041498 Bacteria 2068
237 Ga0451853_1771620 3300041512 Bacteria 3784
238 Ga0439441_012590 3300042001 Bacteria 1454
239 Ga0450911_000100 3300042115 Bacteria 34941
240 Ga0439446_0045018 3300042156 Bacteria 1307
241 Ga0451577_0001772 3300042876 Bacteria 27758
242 Ga0451577_0003669 3300042876 Bacteria 16820
243 Ga0451577_0009709 3300042876 Bacteria 9227
244 Ga0451577_0056047 3300042876 Bacteria 3515
245 Ga0451577_0090365 3300042876 Bacteria 2733
246 Ga0451577_0133766 3300042876 Bacteria 2226
247 Ga0451577_0213475 3300042876 Bacteria 1743
248 Ga0466972_0001230 3300044658 Bacteria 12352
249 Ga0466964_0034736 3300044706 Bacteria 2013
250 Ga0453684_0012115 3300044712 Bacteria 14310
251 Ga0453684_0012190 3300044712 Bacteria 14255
252 Ga0453684_0211576 3300044712 Bacteria 2253
253 Ga0451576_0001050 3300045051 Bacteria 50847
254 Ga0451576_0009311 3300045051 Bacteria 11404
255 Ga0451576_0010372 3300045051 Bacteria 10697
256 Ga0451576_0016728 3300045051 Bacteria 8089
257 Ga0451576_0048696 3300045051 Bacteria 4450
258 Ga0451576_0112861 3300045051 Bacteria 2829
259 Ga0495617_000004 3300046452 Bacteria 511274
260 Ga0495617_003868 3300046452 Bacteria 5514
261 Ga0495617_024899 3300046452 Bacteria 2018
262 Ga0495627_000008 3300046453 Bacteria 572150
263 Ga0495592_0000222 3300046454 Bacteria 48902
264 Ga0495590_0000006 3300046457 Bacteria 372949
265 Ga0495638_0000042 3300046460 Bacteria 232752
266 Ga0495638_0004288 3300046460 Bacteria 10819
267 Ga0495638_0047985 3300046460 Bacteria 2675
268 Ga0495638_0048926 3300046460 Bacteria 2645
269 Ga0495638_0052253 3300046460 Bacteria 2546
270 Ga0495651_0231344 3300046462 Bacteria 1273
271 Ga0495653_0000118 3300046463 Bacteria 65731
272 Ga0495650_0000165 3300046471 Bacteria 146945
273 Ga0495650_0000263 3300046471 Bacteria 101749
274 Ga0495650_0000348 3300046471 Bacteria 82107
275 Ga0495650_0000936 3300046471 Bacteria 33895
276 Ga0495650_0003118 3300046471 Bacteria 12429
277 Ga0495650_0004301 3300046471 Bacteria 9827
278 Ga0495650_0005288 3300046471 Bacteria 8449
279 Ga0495650_0006717 3300046471 Bacteria 7120
280 Ga0495605_0000022 3300046474 Bacteria 248321
281 Ga0495605_0008690 3300046474 Bacteria 5735
282 Ga0495639_0002854 3300046475 Bacteria 7518
283 Ga0495639_0005245 3300046475 Bacteria 5570
284 Ga0495584_0002276 3300046491 Bacteria 10942
285 Ga0495585_0000358 3300046492 Bacteria 44242
286 Ga0495607_0001650 3300046501 Bacteria 19320
287 Ga0495607_0004271 3300046501 Bacteria 10574
288 Ga0495607_0011037 3300046501 Bacteria 6034
289 Ga0495583_0000303 3300046506 Bacteria 78395
290 Ga0495583_0000402 3300046506 Bacteria 65718
291 Ga0495583_0000927 3300046506 Bacteria 34448
292 Ga0495583_0000967 3300046506 Bacteria 33114
293 Ga0495606_0000014 3300046507 Bacteria 289347
294 Ga0495606_0000111 3300046507 Bacteria 138144
295 Ga0495606_0000169 3300046507 Bacteria 115434
296 Ga0495606_0000569 3300046507 Bacteria 58510
297 Ga0495606_0000841 3300046507 Bacteria 46218
298 Ga0495606_0000857 3300046507 Bacteria 45724
299 Ga0495606_0001809 3300046507 Bacteria 27190
300 Ga0495606_0002532 3300046507 Bacteria 21024
301 Ga0495606_0003050 3300046507 Bacteria 18259
302 Ga0495606_0003515 3300046507 Bacteria 16548
303 Ga0495606_0008309 3300046507 Bacteria 9050
304 Ga0495608_0194772 3300046511 Bacteria 1279
305 Ga0495610_0000010 3300046512 Bacteria 538821
306 Ga0495610_0002041 3300046512 Bacteria 17239
307 Ga0495610_0006167 3300046512 Bacteria 8337
308 Ga0495610_0009487 3300046512 Bacteria 6147
309 Ga0495620_0031114 3300046515 Bacteria 2449
310 Ga0495632_0007443 3300046519 Bacteria 6876
311 Ga0495632_0048282 3300046519 Bacteria 2108
312 Ga0495637_0018493 3300046520 Bacteria 3231
313 Ga0495643_0000137 3300046522 Bacteria 117968
314 Ga0495643_0000967 3300046522 Bacteria 29428
315 Ga0495644_0001861 3300046523 Bacteria 8507
316 Ga0495644_0005430 3300046523 Bacteria 4979
317 Ga0495644_0005983 3300046523 Bacteria 4739
318 Ga0495648_0000272 3300046524 Bacteria 58140
319 Ga0495648_0002123 3300046524 Bacteria 18676
320 Ga0495648_0003766 3300046524 Bacteria 13191
321 Ga0495648_0005096 3300046524 Bacteria 11022
322 Ga0495648_0029958 3300046524 Bacteria 3605
323 Ga0495648_0107686 3300046524 Bacteria 1523
324 Ga0495642_0003839 3300046528 Bacteria 5890
325 Ga0495642_0017740 3300046528 Bacteria 2781
326 Ga0495654_0000002 3300046530 Bacteria 1021205
327 Ga0495654_0002542 3300046530 Bacteria 11694
328 Ga0495654_0087836 3300046530 Bacteria 1446
329 Ga0495598_0022155 3300046537 Bacteria 1697
330 Ga0495609_0000581 3300046538 Bacteria 28761
331 Ga0495609_0070020 3300046538 Bacteria 1542
332 Ga0495597_0000258 3300046542 Bacteria 48374
333 Ga0495597_0002193 3300046542 Bacteria 12822
334 Ga0495622_0000025 3300046557 Bacteria 146973
335 Ga0495622_0000027 3300046557 Bacteria 135256
336 Ga0495622_0000394 3300046557 Bacteria 29579
337 Ga0495622_0040393 3300046557 Bacteria 2171
338 Ga0495633_0000209 3300046558 Bacteria 74452
339 Ga0495633_0000368 3300046558 Bacteria 48404
340 Ga0495633_0003441 3300046558 Bacteria 10533
341 Ga0495633_0010199 3300046558 Bacteria 5140
342 Ga0495668_0000088 3300046616 Bacteria 151503
343 Ga0495668_0000135 3300046616 Bacteria 111827
344 Ga0495668_0000338 3300046616 Bacteria 62775
345 Ga0495668_0001951 3300046616 Bacteria 18306
346 Ga0495668_0005363 3300046616 Bacteria 8734
347 Ga0495611_0008997 3300046648 Bacteria 4222
348 Ga0495625_0000277 3300046660 Bacteria 79659
349 Ga0495625_0000482 3300046660 Bacteria 59590
350 Ga0495625_0000709 3300046660 Bacteria 47119
351 Ga0495625_0003641 3300046660 Bacteria 15113
352 Ga0495625_0009727 3300046660 Bacteria 8005
353 Ga0495625_0009872 3300046660 Bacteria 7939
354 Ga0495625_0037946 3300046660 Bacteria 3530
355 Ga0495659_0001473 3300046664 Bacteria 7981
356 Ga0495661_0003433 3300046665 Bacteria 11694
357 Ga0495588_0138957 3300046674 Bacteria 1283
358 Ga0495670_0001496 3300046691 Bacteria 11398
359 Ga0495671_0000002 3300046692 Bacteria 1136189
360 Ga0495649_0000464 3300046694 Bacteria 34868
361 Ga0495589_0012850 3300046794 Bacteria 4328
362 Ga0495660_0000641 3300046810 Bacteria 27196
363 Ga0495660_0001221 3300046810 Bacteria 17944
364 Ga0495660_0006960 3300046810 Bacteria 6665
365 Ga0495660_0073482 3300046810 Bacteria 1808
366 Ga0495636_0008718 3300047318 Bacteria 3998
367 Ga0495636_0029138 3300047318 Bacteria 2252
368 Ga0495672_0000031 3300047320 Bacteria 298258
369 Ga0495672_0000241 3300047320 Bacteria 77378
370 Ga0495687_000568 3300047443 Bacteria 43554
371 Ga0495687_033355 3300047443 Bacteria 2336
372 Ga0495677_0004182 3300047445 Bacteria 5565
373 Ga0495679_010746 3300047446 Bacteria 3575
374 Ga0495673_0000005 3300047469 Bacteria 943364
375 Ga0495673_0000026 3300047469 Bacteria 476378
376 Ga0495673_0000028 3300047469 Bacteria 473418
377 Ga0495673_0014677 3300047469 Bacteria 4066
378 Ga0495681_0018255 3300047470 Bacteria 3868
379 Ga0495686_0001652 3300047472 Bacteria 23244
380 Ga0495686_0002781 3300047472 Bacteria 15956
381 Ga0495686_0003059 3300047472 Bacteria 14830
382 Ga0495686_0007740 3300047472 Bacteria 8007
383 Ga0495686_0009665 3300047472 Bacteria 6928
384 Ga0495686_0021886 3300047472 Bacteria 4236
385 Ga0496102_0000166 3300048905 Bacteria 88956
386 Ga0496102_0052393 3300048905 Bacteria 3718
387 Ga0496103_0006861 3300048906 Bacteria 6799
388 Ga0496107_0099228 3300048910 Bacteria 2134
389 Ga0496107_0314723 3300048910 Bacteria 1165
390 Ga0496114_0137422 3300048917 Bacteria 2114
391 Ga0496116_0045732 3300048919 Bacteria 2960
392 Ga0496117_0000132 3300048920 Bacteria 162117
393 Ga0496118_0000099 3300048921 Bacteria 160412
394 Ga0496121_0032149 3300048924 Bacteria 4776
395 Ga0496122_0005859 3300048925 Bacteria 14410
396 Ga0496122_0041901 3300048925 Bacteria 3610
397 Ga0496123_0010542 3300048926 Bacteria 8148
398 Ga0496123_0059830 3300048926 Bacteria 2460
399 Ga0496124_0014925 3300048927 Bacteria 7479
400 Ga0496124_0018474 3300048927 Bacteria 6528
401 Ga0496124_0056867 3300048927 Bacteria 3297
402 Ga0496124_0078436 3300048927 Bacteria 2722
403 Ga0496124_0166415 3300048927 Bacteria 1713
404 Ga0496125_0006005 3300048928 Bacteria 13294
405 Ga0496125_0072395 3300048928 Bacteria 2685
406 Ga0496126_0011221 3300048929 Bacteria 9296
407 Ga0496126_0028250 3300048929 Bacteria 5347
408 Ga0495678_000006 3300049459 Bacteria 463690
409 Ga0495678_000608 3300049459 Bacteria 33616
410 Ga0495678_004127 3300049459 Bacteria 8590
411 Ga0495682_0000813 3300049460 Bacteria 19684
412 Ga0495682_0001927 3300049460 Bacteria 10320
413 Ga0501222_008530 3300049662 Bacteria 1360
414 Ga0501269_000248 3300049766 Bacteria 15561
415 nmdc:mga0k408_1301_c1 3300050493 Bacteria 13499
416 nmdc:mga0k408_28280_c1 3300050493 Bacteria 3187
417 nmdc:mga0k408_50850_c1 3300050493 Bacteria 2399
418 nmdc:mga0k408_90901_c1 3300050493 Bacteria 1793
419 nmdc:mga07m45_14579_c1 3300050496 Bacteria 4191
420 nmdc:mga07m45_87621_c1 3300050496 Bacteria 1782
421 nmdc:mga0sz30_59268_c1 3300050516 Bacteria 1633
422 Ga0500635_0000017 3300053080 Bacteria 113720
423 Ga0500635_0000137 3300053080 Bacteria 42016
424 Ga0500578_0000683 3300053086 Bacteria 40592
425 Ga0500650_0024940 3300053098 Bacteria 2670
426 Ga0500593_000161 3300053117 Bacteria 26877
427 Ga0500594_0002447 3300053118 Bacteria 4045
428 Ga0500594_0017746 3300053118 Bacteria 1745
429 Ga0500594_0026248 3300053118 Bacteria 1499
430 Ga0500618_000174 3300053125 Bacteria 53245
431 Ga0500623_038665 3300053127 Bacteria 2446
432 Ga0500628_000557 3300053129 Bacteria 6809
433 Ga0500642_0025319 3300053130 Bacteria 2408
434 Ga0500652_000930 3300053131 Bacteria 9670
435 Ga0500658_0025750 3300053134 Bacteria 2262
436 Ga0500559_0000011 3300053136 Bacteria 164751
437 Ga0500564_038350 3300053138 Bacteria 2208
438 Ga0500568_0025164 3300053139 Bacteria 2514
439 Ga0500586_000450 3300053145 Bacteria 8201
440 Ga0500619_000022 3300053154 Bacteria 50600
441 Ga0500622_0000028 3300053156 Bacteria 218994
442 Ga0500627_0037590 3300053158 Bacteria 2067
443 Ga0500636_0123081 3300053177 Bacteria 1453
444 Ga0500661_008893 3300055283 Bacteria 1846
445 Ga0590071_002479 3300059421 Bacteria 4646
446 Ga0587083_0011696 3300059505 Bacteria 1455
447 Ga0587067_009106 3300059640 Bacteria 1471
448 Ga0587076_004662 3300059645 Bacteria 1726
449 2587729512 2585428057 Bacteria 6737412
450 2587733973 2585428058 Bacteria 6853932
451 2587754264 2585428062 Bacteria 6842168
452 2587755052 2585428062 Bacteria 6842168
453 2588294592 2588253510 Bacteria 6901809
454 2601670090 2600255292 Bacteria 6300551
455 2643969635 2643221592 Bacteria 6608788
456 2644143935 2643221625 Bacteria 6512927
457 2644251927 2643221645 Bacteria 7207331
458 2644276358 2643221648 Bacteria 6521465
459 2644337816 2643221660 Bacteria 4208257
460 2644360576 2643221664 Bacteria 7272945
461 2738740369 2738541280 Bacteria 6630198
462 2738828890 2738541297 Bacteria 6549566
463 2738843380 2738541300 Bacteria 6675882
464 2739152686 2738541357 Bacteria 6549408
465 2739194606 2738543003 Bacteria 6549560
466 2739275547 2738543018 Bacteria 6718814
467 2739321082 2738543026 Bacteria 6549408
468 2739339323 2738543029 Bacteria 6549249
469 2739344591 2738543030 Bacteria 6719714
470 2821133121 2821131069 Bacteria 6108407
471 2842714800 2842711865 Bacteria 7155354
472 2857552933 2857547612 Bacteria 6179999
473 2857553248 2857553236 Bacteria 6166726
474 2857563105 2857558681 Bacteria 6617694
475 2857567312 2857564685 Bacteria 6290584
476 2885083154 2885080285 Bacteria 6355622
477 2904427317 2904424332 Bacteria 7633521
478 2919479829 2919476304 Bacteria 5888696
479 2932413599 2932410948 Bacteria 6312192
480 2932417659 2932416698 Bacteria 6315112
481 Ga0182008_10001081
482 JGI25156J39149_1000278
483 JGI25156J39149_1000973
484 JGI25156J39149_1011021
485 JGI25156J39149_1016398
486 JGI25154J39366_1000221
487 JGI25154J39366_1002307
488 JGI25157J39369_1000049
489 JGI25164J39214_1002144
490 JGI25152J39213_1008298
491 JGI25150J39212_1006247
492 JGI26128J50194_1000683
493 Ga0055539_1000583
494 Ga0055539_1001782
495 Ga0055533_1000010
496 Ga0055525_1000775
497 Ga0055535_1000508
498 Ga0055535_1000607
499 Ga0055535_1000906
500 Ga0055535_1004988
501 Ga0055529_1000103
502 Ga0055529_1000125
503 Ga0055529_1000461
504 Ga0055529_1000731
505 Ga0055526_1000016
506 Ga0055526_1000118
507 Ga0055526_1000323
508 Ga0055526_1001301
509 Ga0055530_10010772
510 Ga0065165_1000774
511 Ga0065704_10116252
512 Ga0065715_10133414
513 Ga0070658_10040640
514 Ga0068869_100053998
515 Ga0070687_100011810
516 Ga0070687_100035062
517 Ga0070687_100041827
518 Ga0070687_100046054
519 Ga0070675_100108464
520 Ga0070673_100108886
521 Ga0070673_100150024
522 Ga0070678_100111731
523 Ga0070678_100227732
524 Ga0070662_100015686
525 Ga0068867_100042592
526 Ga0068867_100171795
527 Ga0068853_100008381
528 Ga0068855_100052495
529 Ga0068857_100024975
530 Ga0068854_100022112
531 Ga0068856_100039320
532 Ga0068861_100040263
533 Ga0075367_10135200
534 Ga0075369_10049013
535 Ga0075366_10006521
536 Ga0075366_10011236
537 Ga0075366_10042565
538 Ga0075366_10056980
539 Ga0075370_10016883
540 Ga0075370_10049446
541 Ga0105244_10018325
542 Ga0105244_10023373
543 Ga0105240_10001892
544 Ga0105240_10180657
545 Ga0105241_10335256
546 Ga0105248_10527724
547 Ga0105237_10000080
548 Ga0105237_10000296
549 Ga0105238_10000711
550 Ga0105238_10009413
551 Ga0105239_10000116
552 Ga0105239_10000250
553 Ga0105239_10025926
554 Ga0157369_10043726
555 Ga0157378_10086731
556 Ga0157379_10069629
557 Ga0182006_1000096
558 Ga0182006_1000251
559 Ga0182007_10000105
560 Ga0182005_1000013
561 Ga0182005_1000038
562 Ga0163161_10042734
563 Ga0213872_10000020
564 Ga0213872_10002650
565 Ga0213872_10007586
566 Ga0213872_10036586
567 Ga0209674_100003
568 Ga0209672_104405
569 Ga0209672_106061
570 Ga0209563_100049
571 Ga0209563_107585
572 Ga0207427_100280
573 Ga0209437_104864
574 Ga0209258_100080
575 Ga0209258_100163
576 Ga0209258_100180
577 Ga0209258_101256
578 Ga0207425_1000170
579 Ga0207425_1000435
580 Ga0207425_1000624
581 Ga0209646_1000072
582 Ga0209646_1000138
583 Ga0209026_1000021
584 Ga0209677_100145
585 Ga0209677_100209
586 Ga0209759_1000025
587 Ga0209759_1000612
588 Ga0209759_1000937
589 Ga0209759_1001401
590 Ga0209759_1002119
591 Ga0209759_1011147
592 Ga0209759_1022566
593 Ga0209129_1000115
594 Ga0209129_1007977
595 Ga0209455_1000030
596 Ga0209455_1000044
597 Ga0209455_1000059
598 Ga0209455_1000144
599 Ga0209673_1005874
600 Ga0209673_1007682
601 Ga0209025_1005755
602 Ga0209025_1009840
603 Ga0209564_1000002
604 Ga0209564_1000007
605 Ga0209564_1000053
606 Ga0209758_1000089
607 Ga0209758_1000225
608 Ga0209758_1000228
609 Ga0209758_1000394
610 Ga0209050_1000374
611 Ga0209051_1003155
612 Ga0209051_1032655
613 Ga0207655_1006318
614 Ga0207682_10018586
615 Ga0207705_10020837
616 Ga0207695_10020992
617 Ga0207695_10069535
618 Ga0207671_10004679
619 Ga0207671_10011972
620 Ga0207662_10018335
621 Ga0207662_10056746
622 Ga0207657_10029841
623 Ga0207657_10125281
624 Ga0207657_10269356
625 Ga0207694_10003638
626 Ga0207694_10004090
627 Ga0207659_10046435
628 Ga0207706_10009625
629 Ga0207686_10030856
630 Ga0207669_10039796
631 Ga0207691_10081286
632 Ga0207711_10262713
633 Ga0207689_10014227
634 Ga0207667_10009539
635 Ga0207651_10101672
636 Ga0207640_10011003
637 Ga0207639_10014781
638 Ga0207678_10271161
639 Ga0207702_10000800
640 Ga0207648_10059840
641 Ga0207675_100052490
642 Ga0207683_10045373
643 Ga0207698_10226282
644 Ga0209281_1004417
645 Ga0209981_1001531
646 Ga0209996_1001584
647 Ga0209995_1000303
648 Ga0209968_1000359
649 Ga0209966_1000031
650 Ga0209974_10013101
651 Ga0268266_10057246
652 Ga0268266_10215598
653 Ga0268265_10426394
654 Ga0265336_10000006
655 Ga0265336_10000032
656 Ga0307517_10025872
657 Ga0307515_10000006
658 Ga0307515_10000013
659 Ga0307515_10000043
660 Ga0307515_10000291
661 Ga0307515_10000652
662 Ga0307515_10001063
663 Ga0307515_10001678
664 Ga0307515_10003883
665 Ga0307515_10009632
666 Ga0307515_10009637
667 Ga0307515_10023444
668 Ga0307515_10107197
669 Ga0265324_10001596
670 Ga0307512_10025065
671 Ga0265328_10000063
672 Ga0307513_10029768
673 Ga0307513_10085509
674 Ga0307513_10137698
675 Ga0307509_10000120
676 Ga0307509_10003007
677 Ga0307509_10048180
678 Ga0307509_10111171
679 Ga0307508_10000163
680 Ga0307508_10000248
681 Ga0307508_10000254
682 Ga0307508_10021341
683 Ga0307508_10285463
684 Ga0307514_10026508
685 Ga0307514_10073484
686 Ga0265314_10135247
687 Ga0307516_10000381
688 Ga0307516_10000402
689 Ga0307516_10000860
690 Ga0307516_10000878
691 Ga0307516_10012872
692 Ga0307516_10050466
693 Ga0307516_10134101
694 Ga0307510_10030745
695 Ga0307510_10033981
696 Ga0373934_0064307
697 Ga0373939_0003667
698 Ga0373931_0005337
699 Ga0395899_0153161
700 Ga0395898_0016172
701 Ga0395898_0025134
702 Ga0395905_0299998
703 Ga0395901_0014533
704 Ga0436361_0156868
705 Ga0436361_0194657
706 Ga0436361_0372225
707 Ga0436361_0402949
708 Ga0436361_0538733
709 Ga0436361_0565164
710 Ga0436361_0648806
711 Ga0436361_0881810
712 Ga0436361_1024184
713 Ga0451789_0811653
714 Ga0451800_0868808
715 Ga0451804_1082106
716 Ga0451841_1010115
717 Ga0451853_1771620
718 Ga0439441_012590
719 Ga0450911_000100
720 Ga0439446_0045018
721 Ga0451577_0001772
722 Ga0451577_0003669
723 Ga0451577_0009709
724 Ga0451577_0056047
725 Ga0451577_0090365
726 Ga0451577_0133766
727 Ga0451577_0213475
728 Ga0466972_0001230
729 Ga0466964_0034736
730 Ga0453684_0012115
731 Ga0453684_0012190
732 Ga0453684_0211576
733 Ga0451576_0001050
734 Ga0451576_0009311
735 Ga0451576_0010372
736 Ga0451576_0016728
737 Ga0451576_0048696
738 Ga0451576_0112861
739 Ga0495617_000004
740 Ga0495617_003868
741 Ga0495617_024899
742 Ga0495627_000008
743 Ga0495592_0000222
744 Ga0495590_0000006
745 Ga0495638_0000042
746 Ga0495638_0004288
747 Ga0495638_0047985
748 Ga0495638_0048926
749 Ga0495638_0052253
750 Ga0495651_0231344
751 Ga0495653_0000118
752 Ga0495650_0000165
753 Ga0495650_0000263
754 Ga0495650_0000348
755 Ga0495650_0000936
756 Ga0495650_0003118
757 Ga0495650_0004301
758 Ga0495650_0005288
759 Ga0495650_0006717
760 Ga0495605_0000022
761 Ga0495605_0008690
762 Ga0495639_0002854
763 Ga0495639_0005245
764 Ga0495584_0002276
765 Ga0495585_0000358
766 Ga0495607_0001650
767 Ga0495607_0004271
768 Ga0495607_0011037
769 Ga0495583_0000303
770 Ga0495583_0000402
771 Ga0495583_0000927
772 Ga0495583_0000967
773 Ga0495606_0000014
774 Ga0495606_0000111
775 Ga0495606_0000169
776 Ga0495606_0000569
777 Ga0495606_0000841
778 Ga0495606_0000857
779 Ga0495606_0001809
780 Ga0495606_0002532
781 Ga0495606_0003050
782 Ga0495606_0003515
783 Ga0495606_0008309
784 Ga0495608_0194772
785 Ga0495610_0000010
786 Ga0495610_0002041
787 Ga0495610_0006167
788 Ga0495610_0009487
789 Ga0495620_0031114
790 Ga0495632_0007443
791 Ga0495632_0048282
792 Ga0495637_0018493
793 Ga0495643_0000137
794 Ga0495643_0000967
795 Ga0495644_0001861
796 Ga0495644_0005430
797 Ga0495644_0005983
798 Ga0495648_0000272
799 Ga0495648_0002123
800 Ga0495648_0003766
801 Ga0495648_0005096
802 Ga0495648_0029958
803 Ga0495648_0107686
804 Ga0495642_0003839
805 Ga0495642_0017740
806 Ga0495654_0000002
807 Ga0495654_0002542
808 Ga0495654_0087836
809 Ga0495598_0022155
810 Ga0495609_0000581
811 Ga0495609_0070020
812 Ga0495597_0000258
813 Ga0495597_0002193
814 Ga0495622_0000025
815 Ga0495622_0000027
816 Ga0495622_0000394
817 Ga0495622_0040393
818 Ga0495633_0000209
819 Ga0495633_0000368
820 Ga0495633_0003441
821 Ga0495633_0010199
822 Ga0495668_0000088
823 Ga0495668_0000135
824 Ga0495668_0000338
825 Ga0495668_0001951
826 Ga0495668_0005363
827 Ga0495611_0008997
828 Ga0495625_0000277
829 Ga0495625_0000482
830 Ga0495625_0000709
831 Ga0495625_0003641
832 Ga0495625_0009727
833 Ga0495625_0009872
834 Ga0495625_0037946
835 Ga0495659_0001473
836 Ga0495661_0003433
837 Ga0495588_0138957
838 Ga0495670_0001496
839 Ga0495671_0000002
840 Ga0495649_0000464
841 Ga0495589_0012850
842 Ga0495660_0000641
843 Ga0495660_0001221
844 Ga0495660_0006960
845 Ga0495660_0073482
846 Ga0495636_0008718
847 Ga0495636_0029138
848 Ga0495672_0000031
849 Ga0495672_0000241
850 Ga0495687_000568
851 Ga0495687_033355
852 Ga0495677_0004182
853 Ga0495679_010746
854 Ga0495673_0000005
855 Ga0495673_0000026
856 Ga0495673_0000028
857 Ga0495673_0014677
858 Ga0495681_0018255
859 Ga0495686_0001652
860 Ga0495686_0002781
861 Ga0495686_0003059
862 Ga0495686_0007740
863 Ga0495686_0009665
864 Ga0495686_0021886
865 Ga0496102_0000166
866 Ga0496102_0052393
867 Ga0496103_0006861
868 Ga0496107_0099228
869 Ga0496107_0314723
870 Ga0496114_0137422
871 Ga0496116_0045732
872 Ga0496117_0000132
873 Ga0496118_0000099
874 Ga0496121_0032149
875 Ga0496122_0005859
876 Ga0496122_0041901
877 Ga0496123_0010542
878 Ga0496123_0059830
879 Ga0496124_0014925
880 Ga0496124_0018474
881 Ga0496124_0056867
882 Ga0496124_0078436
883 Ga0496124_0166415
884 Ga0496125_0006005
885 Ga0496125_0072395
886 Ga0496126_0011221
887 Ga0496126_0028250
888 Ga0495678_000006
889 Ga0495678_000608
890 Ga0495678_004127
891 Ga0495682_0000813
892 Ga0495682_0001927
893 Ga0501222_008530
894 Ga0501269_000248
895 nmdc:mga0k408_1301_c1
896 nmdc:mga0k408_28280_c1
897 nmdc:mga0k408_50850_c1
898 nmdc:mga0k408_90901_c1
899 nmdc:mga07m45_14579_c1
900 nmdc:mga07m45_87621_c1
901 nmdc:mga0sz30_59268_c1
902 Ga0500635_0000017
903 Ga0500635_0000137
904 Ga0500578_0000683
905 Ga0500650_0024940
906 Ga0500593_000161
907 Ga0500594_0002447
908 Ga0500594_0017746
909 Ga0500594_0026248
910 Ga0500618_000174
911 Ga0500623_038665
912 Ga0500628_000557
913 Ga0500642_0025319
914 Ga0500652_000930
915 Ga0500658_0025750
916 Ga0500559_0000011
917 Ga0500564_038350
918 Ga0500568_0025164
919 Ga0500586_000450
920 Ga0500619_000022
921 Ga0500622_0000028
922 Ga0500627_0037590
923 Ga0500636_0123081
924 Ga0500661_008893
925 Ga0590071_002479
926 Ga0587083_0011696
927 Ga0587067_009106
928 Ga0587076_004662
929 2587729512
930 2587733973
931 2587754264
932 2587755052
933 2588294592
934 2601670090
935 2643969635
936 2644143935
937 2644251927
938 2644276358
939 2644337816
940 2644360576
941 2738740369
942 2738828890
943 2738843380
944 2739152686
945 2739194606
946 2739275547
947 2739321082
948 2739339323
949 2739344591
950 2821133121
951 2842714800
952 2857552933
953 2857553248
954 2857563105
955 2857567312
956 2885083154
957 2904427317
958 2919479829
959 2932413599
960 2932417659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

46

322

0.84

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

36

292

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyt-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine 0.9675 32 371
7oyu-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine 0.967 32 371
7oyz-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d in complex with spermidine 0.9637 32 371
7oys-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine 0.9625 29 371
6ye0-assembly1.cif.gz_B e.coli's putrescine receptor potf complexed with putrescine 0.962 32 371
ID Description Score Start End Superfamily
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9777 33 137 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9729 33 337 3.40.190.10
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9687 33 137 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9669 33 337 3.40.190.10
af_P31133_137_369_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9617 139 371 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7X2IIX7-F1-model_v4 Putrescine-binding periplasmic protein 0.9841 24 372 GO:0015846
GO:0019808
GO:0042597
AF-A0A1J5PTY2-F1-model_v4 Putrescine-binding periplasmic protein 0.9821 59 372 GO:0015846
GO:0019808
GO:0042597
AF-A0A3M4DHW7-F1-model_v4 deleted 0.9801 75 372
AF-A0A6N8T8T4-F1-model_v4 deleted 0.9797 83 339
AF-A0A3S4IZZ6-F1-model_v4 Putrescine-binding periplasmic protein 0.9764 74 372 GO:0015846
GO:0019808
GO:0042597

Map